U.S. patent application number 11/438609 was filed with the patent office on 2007-06-07 for aggrecanase molecules.
This patent application is currently assigned to Wyeth. Invention is credited to Michael J. Agostino, Lisa A. Collins-Racie, Christopher J. Corcoran, Carl R. Flannery, Bethany A. Freeman, Edward R. LaVallie, Weilan Zeng.
Application Number | 20070128616 11/438609 |
Document ID | / |
Family ID | 27663239 |
Filed Date | 2007-06-07 |
United States Patent
Application |
20070128616 |
Kind Code |
A1 |
Corcoran; Christopher J. ;
et al. |
June 7, 2007 |
Aggrecanase molecules
Abstract
Novel aggrecanase proteins and the nucleotide sequences encoding
them as well as processes for producing them are disclosed. Methods
of identifying and developing inhibitors of the aggrecanase enzymes
and antibodies to the enzymes for treatment of conditions
characterized by the degradation of aggrecan are also
disclosed.
Inventors: |
Corcoran; Christopher J.;
(Arlington, MA) ; Agostino; Michael J.; (Andover,
MA) ; LaVallie; Edward R.; (Harvard, MA) ;
Flannery; Carl R.; (Acton, MA) ; Zeng; Weilan;
(Waltham, MA) ; Collins-Racie; Lisa A.; (Acton,
MA) ; Freeman; Bethany A.; (Arlington, MA) |
Correspondence
Address: |
KIRKPATRICK & LOCKHART PRESTON GATES ELLIS LLP
STATE STREET FINANCIAL CENTER
ONE LINCOLN STREET
BOSTON
MA
02111-2950
US
|
Assignee: |
Wyeth
Madison
NJ
|
Family ID: |
27663239 |
Appl. No.: |
11/438609 |
Filed: |
May 22, 2006 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
10354983 |
Jan 31, 2003 |
7078217 |
|
|
11438609 |
May 22, 2006 |
|
|
|
60353680 |
Jan 31, 2002 |
|
|
|
Current U.S.
Class: |
435/6.13 ;
435/226; 435/320.1; 435/325; 435/6.14; 435/7.1; 530/388.26;
536/23.2; 702/19 |
Current CPC
Class: |
A61P 25/24 20180101;
A61P 19/00 20180101; A61P 25/06 20180101; A61P 29/00 20180101; A61P
35/00 20180101; A61P 1/04 20180101; A61P 25/00 20180101; A61P 37/08
20180101; A61P 19/02 20180101; A61P 25/16 20180101; A61P 9/00
20180101; A61P 11/00 20180101; A61P 25/28 20180101; A61P 13/00
20180101; A61P 27/02 20180101; A61P 1/00 20180101; A61P 19/10
20180101; A61P 25/02 20180101; A61P 37/02 20180101; A61P 37/06
20180101; A61P 43/00 20180101; A61P 11/06 20180101; A61P 7/00
20180101; A61P 1/02 20180101; A61P 17/02 20180101; C12N 9/6421
20130101; A61P 25/14 20180101; A61K 2039/505 20130101 |
Class at
Publication: |
435/006 ;
536/023.2; 435/226; 435/320.1; 435/325; 530/388.26; 435/007.1;
702/019 |
International
Class: |
C12Q 1/68 20060101
C12Q001/68; G01N 33/53 20060101 G01N033/53; G06F 19/00 20060101
G06F019/00; C07H 21/04 20060101 C07H021/04; C12N 9/64 20060101
C12N009/64; C07K 16/40 20060101 C07K016/40 |
Claims
1. An isolated DNA molecule comprising a DNA sequence chosen from:
a) the sequence of SEQ ID NO: 1 from nucleotide #1-#3663; b)
fragments of SEQ ID NO: 1; c) variants of SEQ ID NO: 1; d)
sequences which hybridize under stringent conditions with SEQ ID
NO: 1; and e) naturally occurring human allelic sequences and
equivalent degenerative codon sequences of (a) to (d).
2. A vector comprising a DNA molecule of claim 1 in operative
association with an expression control sequence therefor.
3. A host cell transformed with the DNA sequence of claim 1.
4. A host cell transformed with a DNA sequence of claim 2.
5. A method for producing an isolated human aggrecanase protein,
said method comprising: a) culturing a host cell transformed with a
DNA molecule according to claim 1; and b) recovering and purifying
said aggrecanase protein encoded by the DNA molecule from the
culture medium.
6. The method of claim 5, wherein said host cell is an insect
cell.
7-8. (canceled)
9. An antibody that binds to an isolated aggrecanase protein
comprising an amino acid sequence chosen from: a) the amino acid
sequence of SEQ ID NO: 2 from amino acid #1-#1221; b) fragments of
SEQ ID NO: 2; and c) variants of aggrecanase proteins consisting of
addition, substitution, and deletion mutants of the sequences of
(a) to (b).
10. The antibody of claim 9, wherein the antibody inhibits
aggrecanase activity.
11. A method for identifying inhibitors of aggrecanase comprising
a) providing an aggrecanase protein chosen from SEQ ID NO: 2 or a
fragment thereof; b) combining the aggrecanase protein with a
potential inhibitor; and c) evaluating whether the potential
inhibitor inhibits aggrecanase activity.
12. The method of claim 11 wherein the method further comprises
evaluating the aggrecanase protein in a three dimensional
structural analysis prior to combining with the potential
inhibitor.
13. The method of claim 11 wherein the method further comprises
evaluating the aggrecanase protein in a computer aided drug design
program prior to combining with the potential inhibitor.
14. A pharmaceutical composition for inhibiting the proteolytic
activity of aggrecanase, wherein the composition comprises an
antibody according to claim 9 and a pharmaceutical carrier.
15. A method for inhibiting aggrecanase in a mammal comprising
administering to said mammal an amount of the composition of claim
14 effective to inhibit aggrecanase activity.
16. The method of claim 15, wherein the composition is administered
intravenously, subcutaneously, or intramuscularly.
17. The method of claim 15, wherein the composition is administered
at a dosage of about 500 .mu.g/kg to about 1 mg/kg.
18. The DNA molecule of claim 1, wherein the DNA molecule comprises
nucleotides 1-3663 of SEQ ID NO:1.
Description
RELATED APPLICATION
[0001] This application relies on the benefit of priority of U.S.
provisional patent application No. 60/353,680, filed on Jan. 31,
2002, the entire disclosure of which is incorporated by
reference.
FIELD OF THE INVENTION
[0002] The present invention relates to the discovery of nucleotide
sequences encoding novel aggrecanase molecules, aggrecanase
proteins and fragments thereof, and processes for producing them.
The invention further relates to identification and development of
inhibitors of and antibodies to the aggrecanase enzymes. These
inhibitors and antibodies may be useful for the treatment of
various aggrecanase-associated conditions including
osteoarthritis.
BACKGROUND OF THE INVENTION
[0003] Aggrecan is a major extracellular component of articular
cartilage. It is a proteoglycan responsible for providing cartilage
with its mechanical properties of compressibility and elasticity.
The loss of aggrecan has been implicated in the degradation of
articular cartilage in arthritic diseases. Osteoarthritis is a
debilitating disease which affects at least 30 million Americans
(MacLean et al., J Rheumatol 25:2213-8 (1998)). Osteoarthritis can
severely reduce quality of life due to degradation of articular
cartilage and the resulting chronic pain. An early and important
characteristic of the osteoarthritic process is loss of aggrecan
from the extracellular matrix (Brandt and Mankin, Pathogenesis of
Osteoarthritis, in Textbook of Rheumatology, WB Saunders Company,
Philadelphia, Pa., at 1355-1373 (1993)). The large,
sugar-containing portion of aggrecan is thereby lost from the
extra-cellular matrix, resulting in deficiencies in the
biomechanical characteristics of the cartilage.
[0004] A proteolytic activity termed "aggrecanase" is believed to
be responsible for the cleavage of aggrecan thereby having a role
in cartilage degradation associated with osteoarthritis and
inflammatory joint disease. Research has been conducted to identify
the enzymes responsible for the degradation of aggrecan in human
osteoarthritic cartilage. At least two enzymatic cleavage sites
have been identified within the interglobular domain of aggrecan.
One enzymatic cleavage site within the interglobular domain of
aggrecan (Asn.sup.341-Phe.sup.342) has been observed to be cleaved
by several known metalloproteases. Flannery et al., J Biol Chem
267:1008-14 (1992); Fosang et al., Biochemical J. 304:347-351
(1994). Cleavage at a second aggrecan cleavage site within aggrecan
(Glu.sup.373-Ala.sup.374) due to IL-1 induced cartilage aggrecan
cleavage results in the generation of an aggrecan fragment found in
human synovial fluid (Sandy et al., J Clin Invest 69:1512-1516
(1992); Lohmander et aL., Arthritis Rheum 36:1214-1222 (1993);
Sandy et al., J Biol Chem 266: 8683-8685 (1991)). Aggrecan cleavage
at (Glu.sup.373-Ala.sup.374) has been attributed to aggrecanase
activity (Sandy et al., J Clin Invest 69:1512-1516 (1992). This
Glu.sup.373-Ala.sup.374 cleavage site will be referred to as the
aggrecanase cleavage site.
[0005] Recently, identification of two enzymes, aggrecanase-1
(ADAMTS4) and aggrecanase-2 (ADAMTS-11) within the
"Disintegrin-like and Metalloprotease with Thrombospondin type 1
motif" (ADAMTS) family have been identified which are synthesized
by IL-1 stimulated cartilage and cleave aggrecan at the
Glu.sup.373-Ala.sup.374 site (Tortorella et al., Science 284:1664-6
(1999); Abbaszade et al., J Biol Chem 274: 23443-23450 (1999)). It
is possible that these enzymes could be synthesized by
osteoarthritic human articular cartilage. It is also contemplated
that there are other, related enzymes in the ADAMTS family which
are capable of cleaving aggrecan at the Glu.sup.373-Ala.sup.374
bond and could contribute to aggrecan cleavage in osteoarthritis.
Therefore, there is a need to identify various aggrecanase enzymes
and determine ways to block their enzymatic activity.
SUMMARY OF THE INVENTION
[0006] The present invention is directed to the identification of
novel aggrecanase protein molecules capable of cleaving aggrecan,
nucleotide sequences which encode the aggrecanase enzymes, and
processes for the production of aggrecanases. These enzymes are
contemplated to be characterized as having proteolytic aggrecanase
activity. The invention further includes compositions comprising
these enzymes.
[0007] The invention also includes antibodies to these enzymes, in
one embodiment, for example, antibodies that block aggrecanase
activity. In addition, the invention includes methods for
identifying and developing inhibitors of aggrecanase which block
the enzyme's proteolytic activity. These inhibitors and antibodies
may be used in various assays and therapies for treatment of
conditions characterized by the degradation of articular cartilage.
This invention provides nucleotide molecules that encode novel
aggrecanase proteins. Accordingly, in one embodiment, the invention
features an isolated DNA molecule comprising a DNA sequence chosen
from: nucleotide #1 to nucleotide #3663 of SEQ ID NO: 1 (FIGS. 1A
and 1B); fragments of SEQ ID NO: 1 which encode polypeptides or
proteins that exhibit aggrecanase activity; variants of SEQ ID NO:
1 that encode proteins or polypeptides that exhibit aggrecanase
activity, and fragments thereof; sequences which hybridize under
stringent conditions with SEQ ID NO: 1; naturally occurring human
allelic sequences; and equivalent degenerative codon sequences
[0008] In another aspect, the invention comprises an isolated
aggrecanase protein comprising an amino acid sequence chosen from:
amino acid #1 (methionine) to amino acid #1221 (isoleucine) of SEQ
ID NO: 2 (FIG. 2); fragments of SEQ ID NO: 2 which exhibit
aggrecanase activity, and variants and fragments of aggrecanase
proteins that exhibit proteolytic activity, including deletion and
substitution mutants. In yet another aspect, the invention provides
methods for producing an isolated aggrecanase protein. One such
method includes (1) transforming a host cell with a DNA sequence,
such as the DNA sequence depicted in SEQ ID NO: 1; (2) culturing
the host cell; and (3) purifying the aggrecanase enzyme set forth
in SEQ ID NO: 2 that is encoded by the DNA sequence, from the cell
culture medium.
[0009] The invention also provides antibodies that bind to isolated
aggrecanase proteins of the invention. In one embodiment, such an
antibody reduces, inhibits or antagonizes aggrecanase activity. The
invention further provides methods for developing and identifying
inhibitors of aggrecanase activity comprising the use of
aggrecanase protein chosen from SEQ ID NO: 2 or a fragment or a
variant thereof. In one embodiment, inhibitors of aggrecanase
activity prevent cleavage of aggrecan.
[0010] Additionally, the invention provides pharmaceutical
compositions for inhibiting the proteolytic activity of
aggrecanase, wherein the compositions comprise at least one
antibody according to the invention and at least one pharmaceutical
carrier. The invention also provides methods for inhibiting
aggrecanase activity in a mammal comprising administering to the
mammal an effective amount of a pharmaceutical composition
according to the invention to inhibit aggrecanase activity.
[0011] Additional aspects of the disclosure will be set forth in
part in the description, and in part be obvious from the
description, or may be learned from practicing the invention. The
invention is set forth and particularly pointed out in the claims,
and the disclosure should not be construed as limiting the scope of
the claims. The following detailed description includes exemplary
representations of various embodiments of the invention, which are
not restrictive of the invention as claimed. The accompanying
figures constitute a part of this specification and, together with
the description, serve to illustrate embodiments and not limit the
invention.
BRIEF DESCRIPTION OF THE FIGURES AND SEQUENCES
[0012] FIGS. 1A and 1B showthe full-length nucleotide sequence for
ADAMTS-18 (EST18). (SEQ ID NO: 1)
[0013] FIG. 2 shows the full-length amino acid sequence for
ADAMTS-18, based on the nucleotide sequence of SEQ ID NO: 1. (SEQ
ID NO: 2)
[0014] FIGS. 3A and 3B show a nucleotide sequence of ADAMTS-18
(EST18). (SEQ ID NO: 3)
[0015] FIG. 4 shows the predicted amino acid sequence of ADAMTS-18
based on the nucleotide sequence of SEQ ID NO: 3. (SEQ ID NO:
4)
[0016] FIGS. 5A and 5B show a virtual nucleotide sequence for
ADAMTS-18, which was identified by Celera database-mining
techniques. (SEQ ID NO: 5) FIG. 6A shows a schematic representation
of the PCR primers used for amplification of fragments of a EST18
nucleotide sequence. FIG. 6B shows a schematic representation of
the overlapping nucleotide sequence fragments of EST18 including
sites for restriction enzymes.
[0017] FIG. 7 shows a nucleotide sequence encoding for atruncated
form of ADAMTS-18 linked to a Streptavidin-tag. (SEQ ID NO: 7)
[0018] FIG. 8 shows an amino acid sequence for a truncated form of
ADAMTS-18 including a Streptavidin-tag, based on SEQ ID NO: 7. (SEQ
ID NO: 8)
[0019] FIG. 9 shows a schematic representation of the hydrophobic
plot generated for the protein of SEQ ID NO: 2 using the GCG
plotstructure program.
[0020] FIG. 10 shows a schematic representation of an assay for
detecting aggrecanase activity.
DETAILED DESCRIPTION OF THE INVENTION
[0021] I. Definitions
[0022] In order that the present invention may be more readily
understood, certain terms are first defined. Additional definitions
are set forth throughout the detailed description.
[0023] The term "aggrecanase" refers to a family of polypeptides
that are capable of cleaving the aggrecan protein. Generally, these
are proteins that cleave aggrecan at the Glu.sup.373-Ala.sup.374
aggrecanase cleavage site. Aggrecanases of the present invention
encompass but are not limited to the amino acid sequence of SEQ ID
NO: 2. The term "aggrecanase" includes naturally occurring variants
of the amino acid sequence set forth in SEQ ID NO: 2, as well as
fragments of SEQ ID NO: 2 that are active in one or more of the
assays provided. For example, included in this definition are amino
acid sequences substantially similar or substantially identical to
the amino acid of SEQ ID NO: 2 or a fragment thereof; or an amino
acid sequence at least about 50%, about 55%, about 60%, about 65%,
about 70%, about 75%, about 80%, about 85%, about 90%, about 92%,
about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or
about 99% identical to the amino acid sequence of SEQ ID NO: 2, or
a fragment thereof. The term "aggrecanase" further includes the
proteins encoded by the nucleic acid sequence of SEQ ID NO: 1
disclosed, fragments and variants thereof. In one embodiment, the
nucleic acids of the present invention will possess a sequence
which is either derived from, or is a variant of a natural
aggrecanase encoding gene, or a fragment thereof.
[0024] The term "aggrecanase activity" refers to at least one
cellular process interrupted or initiated by an aggrecanase enzyme
binding to aggrecan. Generally, activity refers to proteolytic
cleavage of aggrecan by aggrecanase. Aggrecanase activities
include, but are not limited to, binding of aggrecanase to aggrecan
and cleavage of aggrecan by aggrecanase. Activity can also include
a biological response resulting from the binding to or cleavage of
aggrecan by aggrecanases of the invention.
[0025] The term "antibody" refers to an immunoglobulin or a
fragment thereof, and encompasses any polypeptide comprising an
antigen-binding site. The term includes but is not limited to
polyclonal, monoclonal, monospecific, polyspecific, non-specific,
humanized, human, single-chain, chimeric, synthetic, recombinant,
hybrid, mutated, grafted, and in vitro generated antibodies. It
also includes, unless otherwise stated, antibody fragments such as
Fab, F(ab').sub.2, Fv, scFv, Fd, dAb, and other antibody fragments
which retain the antigen binding function.
[0026] The term "effective amount" refers to a dosage or amount of
a composition at least one aggrecanase inhibitor or antibody of the
invention that is sufficient to treat a patient.
[0027] The term "inhibit" or "inhibition" of aggrecanase or
aggrecanase activity refers to a reduction, inhibition of otherwise
diminution of at least one activity of aggrecanase due to binding
of an inhibitor to the aggrecanase or aggrecan. The reduction,
inhibition or diminution of binding can be measured by ore of many
assays provided. Inhibition of aggrecanase activity does not
necessarily indicate a complete negation of aggrecanase activity. A
reduction in activity can be, for example, at least about 10%, 20%,
30%, 40%, 50%, 60%, 70%, 80%, 90% or more. in one embodiment,
inhibition is measured by a reduction in the detection of cleavage
products of aggrecan.
[0028] The term "isolated" describes a nucleic acid molecule or
polypeptide molecule that is substantially free of its natural
environment. For instance, an isolated protein is substantially
free of cellular material or other contaminating proteins from the
cell or tissue source from which it is derived. The term "isolated"
also refers to an aggrecanase protein according to the invention
which is free from association with other proteases and retains
aggrecanase proteolytic activity. In addition, the term "isolated"
refers to nucleic acid molecules that encode aggrecanases of the
invention and are free from other cellular material and
contaminants.
[0029] The term "neoepitope antibody" refers to an antibody that
specifically recognizes a new N- or C-terminal amino acid sequence
generated by proteolytic cleavage but which does not bind to such
an epitope on the intact (uncleaved) substrate.
[0030] The term "operative association" with an expression control
sequence generally refers to the presence of a specific nucleotide
sequence or sequences that control or affect transcription rate or
efficiency of a nucleotide molecule linked to the sequence. For
example, a promoter sequence that is located proximally to the 5'
end of an aggrecanase coding nucleotide sequence may be in
operative association with the aggrecanase encoding nucleotide
sequence. Expression control sequences include, but are not limited
to, for example, promoters, enhancers, and other expression control
sequences, or any combination of such elements, either 5' or 3' to
an aggrecanase encoding nucleotide sequence in order to control its
expression. Not all of these elements are required, however. A
skilled artisan can select the appropriate expression control
sequences, for example, depending on desired expression levels for
the aggrecanases of the invention.
[0031] The term "specific binding" of an antibody means that the
antibody binds to at least one novel aggrecanase molecule of the
present invention and the antibody will not show any significant
binding to molecules other than at least one novel aggrecanase
molecule. The term is also applicable where, e.g., an antigen
binding domain of an antibody is specific for a particular epitope,
which is represented on a number of antigens, and the specific
binding member (the antibody) carrying the antigen binding domain
will be able to bind to the various antigens carrying the epitope.
Therefore, it is contemplated that an antibody of the invention
will bind to an epitope on multiple novel aggrecanase proteins.
Typically, the binding is considered specific when the affinity
constant Ka is higher than 10.sup.8 M.sup.-1. An antibody is said
to "specifically bind" to an antigen if, under appropriately
selected conditions, such binding is not substantially inhibited,
while at the same time non-specific binding is inhibited. The
conditions are usually defined in terms of concentration of
antibodies, ionic strength of the solution, temperature, time
allowed for binding, concentration of additional molecules
associated with the binding reaction (e.g., serum albumin, milk
casein), etc. Such conditions are well known in the art, and a
skilled artisan using routine techniques can select appropriate
conditions.
[0032] The term "highly stringent" or "high stringency" describes
conditions for hybridization and washing used for determining
nucleic acid-nucleic acid interactions. Nucleic acid hybridization
will be affected by such conditions as salt concentration,
temperature, or organic solvents, in addition to the base
composition, length of the complementary strands, and the number of
nucleotide base mismatches between the hybridizing nucleic acids,
as will be readily appreciated by those skilled in the art. The
stringency conditions are dependent on the length of the nucleic
acid and the base composition of the nucleic acid and can be
determined by techniques well known in the art. Generally,
stringency can be altered or controlled by, for example,
manipulating temperature and salt concentration during
hybridization and washing. For example, a combination of high
temperature and low salt concentration increases stringency. Such
conditions are known to those skilled in the art and can be found
in, for example, "Current Protocols in Molecular Biology," John
Wiley & Sons, N.Y. (1989), 6.3.1-6.3.6. Both aqueous and
nonaqueous conditions as described in the art can be used. One
example of highly stringent hybridization conditions is
hybridization in 6.times.sodium chloride/sodium citrate (SSC) at
about 45.degree. C., followed by at least one wash in
0.2.times.SSC, 0.1% SDS at 50.degree. C. A second example of highly
stringent hybridization conditions is hybridization in 6.times.SSC
at about 45.degree. C., followed by at least one wash in
0.2.times.SSC, 0.1% SDS at 55.degree. C. Another example of highly
stringent hybridization conditions is hybridization in 6.times.SSC
at about 45.degree. C., followed by at least one wash in
0.2.times.SSC, 0.1% SDS at 60.degree. C. A further example of
highly stringent hybridization conditions is hybridization in
6.times.SSC at about 45.degree. C., followed by at least one wash
in 0.2.times.SSC, 0.1% SDS at 65.degree. C. Highly stringent
conditions include hybridization in 0.5M sodium phosphate, 7% SDS
at 65.degree. C., followed by at least one wash at 0.2.times.SSC,
1% SDS at 65.degree. C.
[0033] The phrase "moderately stringent" or "moderate stringency"
hybridization refers to conditions that permit a nucleic acid to
bind a complementary nucleic acid that has at least about 60%, at
least about 75%, or at least about 85%, identity to the nucleic
acid; with greater than about 90% identity to the nucleic acid
especially preferred. Moderately stringent conditions comprise but
are not limited to, for example, hybridization in 50% formamide,
5.times. Denhart's solution, 5.times.SSPE, 0.2% SDS at 42.degree.
C., followed by washing in 0.2 .times.SSPE, 0.2% SDS, at 65.degree.
C. (see, e.g., Sambrook et al., Molecular Cloning A Laboratory
Manual, Cold Spring Harbor Laboratory Press, 1989).
[0034] The phrase "substantially identical" or "substantially
similar" means that the relevant amino acid or nucleotide sequence
will be identical to or have insubstantial differences (through
conserved amino acid substitutions) in comparison to the sequences
which are disclosed. Nucleotide and polypeptides of the invention
include, for example, those that are at least about 50%, at least
about 55%, at least about 60%, at least about 65%, at least about
70%, at least about 75%, at least about 80%, at least about 85%, at
least about 90%, at least about 92%, at least about 93%, at least
about 94%, at least about 95%, at least about 96%, at least about
97%, at least about 98%, or at least about 99% identical in
sequence to nucleic acid molecules and polypeptides disclosed.
[0035] For polypeptides, at least 20, 30, 50, 100, or more amino
acids will be compared between the original polypeptide and the
variant polypeptide that is substantially identical to the
original. For nucleic acids, at least 50, 100, 150, 300 or more
nucleotides will be compared between the original nucleic acid and
the variant nucleic acid that is substantially identical to the
original. Thus, a variant could be substantially identical in a
region or regions, but divergent in others, while still meeting the
definition of "substantially identical." Percent identity between
two sequences is determined by standard alignment algorithms such
as, for example, Basic Local Alignment Tool (BLAST) described in
Altschul et al., J. Mol. Biol., 215:403-410 (1990), the algorithm
of Needleman et al., J. Mol. Biol., 48:444-453 (1970), or the
algorithm of Meyers et al., Comput. AppI. Biosci., 4:11-17
(1988).
[0036] The term "treating" or "treatment" refers to both
therapeutic treatment and prophylactic or preventative measures.
Those in need of treatment may include individuals already having a
particular medical disorder as well as those who may ultimately
acquire the disorder (i.e., those needing preventative measures).
Treatment may regulate aggrecanase activity or the level of
aggrecanase to prevent or ameliorate clinical symptoms of at least
one diseases. The inhibitors and/or antibodies may function by, for
example, preventing the interaction or binding of aggrecanase to
aggrecan, or by reducing or inhibiting aggrecanase activity.
[0037] The term "variant" refers to nucleotide and amino acid
sequences that are substantially identical or similar to the
nucleotide and amino acid sequences provided, respectively.
Variants can be naturally occurring, for example, naturally
occurring human and non-human nucleotide sequences that encode
aggrecanase or aggrecanase-like proteins, or be generated
artificially. Examples of variants are aggrecanases resulting from
alternative splicing of the aggrecanase mRNA, including both 3' and
5' spliced variants of the aggrecanases of the invention, point
mutations and other mutations, or proteolytic cleavage of the
aggrecanase protein. Variants of aggrecanases of the invention
include nucleic acid molecules or fragments thereof and amino acid
sequences and fragments thereof, that are substantially identical
or similar to other nucleic acids (or their complementary strands
when they are optimally aligned (with appropriate insertions or
deletions) or amino acid sequences respectively. In one embodiment,
there is at least about 50% identity, at least about 55% identity,
at least about 60% identity, at least about 65% identity, at least
about 70% identity, at least about 75% identity, at least about 80%
identity, at least about 85% identity, at least at least about 90%,
at least about 92% identity, at least about 93% identity, at least
about 94% identity, at least about 95% identity, at least about 96%
identity, at least about 97% identity, at least about 98% identity,
or at least about 99% identity between a nucleic acid molecule or
protein of the invention and another nucleic acid molecule or
protein respectively, when optimally aligned. Additionally,
variants include proteins or polypeptides that exhibit aggrecanase
activity, as defined.
[0038] To assist in the identification of the sequences listed in
the specification and figures, the following table (Table 1) is
provided, which lists the SEQ ID NOs, the figure location, and a
brief description of each sequence. TABLE-US-00001 TABLE 1
SEQUENCES FIGS. DESCRIPTION SEQ ID NO: 1 full-length nucleotide
sequence of ADAMTS-18 (EST-18) SEQ ID NO: 2 full-length a.a.
sequence of ADAMTS-18 encoded by SEQ ID NO: 1 SEQ ID NO: 3 a
nucleotide sequence of ADAMTS-18 (EST18) SEQ ID NO: 4 predicted
a.a. sequence of ADAMTS-18 based on SEQ ID NO: 3 SEQ ID NO: 5
virtual nucleotide sequence for ADAMTS-18 SEQ ID NO: 6 zinc binding
signature region of aggrecanase-1 SEQ ID NO: 7 truncated EST18
nucleotide sequence including a Streptavidin tag SEQ ID NO: 8
truncated a.a. sequence of EST18 protein including a Streptavidin
tag encoded by SEQ ID NO: 7 SEQ ID NO: 9 primer SEQ ID NO: 10
primer SEQ ID NO: 11 primer SEQ ID NO: 12 primer SEQ ID NO: 13
peptide sequence SEQ ID NO: 14 peptide sequence SEQ ID NO: 15 CD-36
binding motif SEQ ID NO: 16 primer SEQ ID NO: 17 primer SEQ ID NO:
18 primer SEQ ID NO: 19 primer SEQ ID NO: 20 primer SEQ ID NO: 21
oligonucleotide SEQ ID NO: 22 oligonucleotide SEQ ID NO: 23
oligonucleotide SEQ ID NO: 24 oligonucleotide SEQ ID NO: 25
oligonucleotide SEQ ID NO: 26 oligonucleotide SEQ ID NO: 27 primer
SEQ ID NO: 28 primer SEQ ID NO: 29 epitope tag SEQ ID NO: 30
nucleotide insert SEQ ID NO: 31 nucleotide sequence containing an
Xhol site SEQ ID NO: 32 a 68 base pair adapter nucleotide sequence
SEQ ID NO: 33 neoepitope sequence a.a. = amino acid
[0039] II. Novel Aggrecanase Molecules
[0040] In one embodiment, a nucleotide sequence of an aggrecanase
molecule according to the present invention is set forth in SEQ ID
NO: 1, including nucleotide #1 to nucleotide #3663 of SEQ ID NO: 1
(FIGS. 1A and 1B). The invention further includes equivalent
degenerative codon sequences of the sequence set forth in SEQ ID
NO: 1, as well as fragments and variants thereof which encode
proteins that exhibit aggrecanase activity. The nucleic acid
sequences of the invention include both naturally occurring
sequences and variants thereof and those that are artificially
generated. Full length nucleotide sequences encoding the
aggrecanase molecules of the present invention may be obtained in
one embodiment, for example, by using the nucleotide sequence set
forth in SEQ ID NO: 3 to design probes for screening for the
full-length aggrecanase nucleotide sequence using standard
techniques.
[0041] The amino acid sequence of the isolated aggrecanase-like
molecule is set forth in SEQ ID NO: 2, including amino acid #1
(methionine) to amino acid #1221 (isoleucine) of SEQ ID NO: 2 (FIG.
2).
[0042] The invention further includes fragments of the amino acid
sequence which encode molecules exhibiting aggrecanase
activity.
[0043] The invention includes methods for obtaining full length
aggrecanase molecules, the nucleotide sequences that encode
aggrecanase molecules obtained by the methods and proteins encoded
by the nucleotide sequences. Methods for isolation of the full
length sequence include, for example, utilizing the aggrecanase
nucleotide sequence set forth in SEQ ID NO: 3 (FIGS. 3A and 3B) for
designing probes for screening, or otherwise screen for full-length
nucleotide sequence using standard procedures known to those
skilled in the art.
[0044] The human aggrecanase protein or a fragment thereof may be
produced by culturing a cell transformed with a DNA sequence chosen
from SEQ ID NO: 1 and recovering and purifying from the culture
medium a protein characterized by an amino acid sequence set forth
in SEQ ID NO: 2, which is substantially free from other
proteinaceous materials with which it is co-produced. For
production in mammalian cells, the DNA sequence further comprises a
DNA sequence encoding a suitable propeptide 5' to and linked in
frame to the nucleotide sequence encoding an aggrecanase
enzyme.
[0045] Human aggrecanase proteins produced by methods of the
invention are characterized by having the ability to cleave
aggrecan and having an amino acid sequence chosen from SEQ ID NO:
2, variants of the amino acid sequence of SEQ ID NO: 2, including
naturally occurring mutant proteins spliced products, and other
variants, in which the proteins retain the ability to cleave
aggrecan which is characteristic of aggrecanase proteins. These
proteins may include a protein which is at least about 30%
identical, about 35% identical, about 40% identical, about 45%
identical, about 50% identical, about 55% identical, about 60%
identical, about 65% identical, about 70% identical, about 75%
identical, about 80% identical, about 85% identical, about 90%
identical, about 92% identical, about 94% identical, about 95%
identical, about 96% identical, about 97% identical, about 98%
identical or about 99% identical, to the amino acid sequence shown
in SEQ ID NO: 2. Finally, proteins including variations of the
sequence depicted in SEQ ID NO: 2, including amino acid changes
induced by mutagenesis, chemical alteration, or by alteration of
DNA sequence used to produce the protein, whereby the peptide
sequence still has aggrecanase activity, are also included in the
present invention. The present invention also includes fragments of
the amino acid sequence of SEQ ID NO: 2 which retain the activity
of aggrecanase protein, and variants of the fragments as well.
[0046] III. Identification of Aggrecanase Proteins and DNA
Molecules Encoding Them, and Variants Thereof.
[0047] It is expected that there are additional human sequences
that encode for aggrecanases or related proteins with aggrecanase
activity and that other species also have DNA sequences encoding
proteins that are variants of human aggrecanase enzymes. The
invention, therefore, includes methods for obtaining DNA sequences
encoding aggrecanase proteins and variants thereof, DNA sequences
obtained by those methods, and proteins or polypeptides encoded by
the DNA sequences. One such method entails utilizing a nucleotide
sequence of the invention or portions thereof to design probes for
screening libraries for the corresponding nucleotide sequence from
other species or coding sequences or fragments thereof using
standard techniques. Thus, the present invention may include DNA
sequences from other species, which encode aggrecanse or
aggrecanase-like polypeptides or proteins , which can be obtained
using the human aggrecanase nucleotide sequence. The present
invention may also include functional fragments of the aggrecanase
protein, and DNA sequences encoding such functional fragments, as
well as functional fragments of related proteins with aggrecanase
or aggrecanase-like activity. The ability of such a fragment to
function like an aggrecanase is determinable by using the
polypeptide or protein in one of many biological assays described
for detecting activity of the aggrecanase protein.
[0048] For example, SEQ ID NO: 1, set forth in FIGS. 1A and 1B, was
used as a query against GenBank and GenSeq to find similar
nucleotide sequences from humans. Several sequences were identified
as being similar either to the full-length or partial nucleic acid
sequence of SEQ ID NO: 1. The published sequences were identified
by the following accession numbers: AJ311903; Ax319854 (sequence 18
from WO 01/183782); AC025284; AC010548; AC009139; AQ407949;
AQ309991; AQ543125; AQ052241; Abn89277 (disclosed in WO 02/250258);
G65591; G53009; BD040395; Abn 89277; Aas97176; Aad16756; Aad16759;
Abq79948; Aas65280; Aad16771; Aad16774; Aas75293; Aas65278;
Aac16650; Aah36077; Aba11592; Aba15654; Aba15653; and Aba15655.
[0049] In addition, SEQ ID NO: 1 was used to search a database
BLASTX which includes translations of the genes in the Genbank
database and the protein components of the GeneSeq database. The
search revealed several human protein sequences which include
sequences identified by the following accession numbers:
GENESEQP:ABB81460 (disclosed in WO 02/250,258); Genbank:CAC83612;
GENESEQP:AAU72893; GENESEQP:AAE09696; GENESEQP:AAE09699;
GENESEQP:ABB82162; GENESEQP:AAE09711; GENESEQP:ABG11106;
GENESEQP:AAB08954; and GENESEQP:AAB08913.
[0050] It is expected that similar sequences exist in non-human
species that are likely to encode aggrecanases or aggrecanase-like
proteins. Various non-human variants of the aggrecanase protein
were identified by searching the BLASTX database using the
nucleotide sequence set forth in SEQ ID NO: 1. These include, for
example, BAC35556.sub.--1 (mouse); AAH34739.sub.--1 (mouse);
BAC29190.sub.--1 (mouse); AAO17380.sub.--1 (mouse);
BAC33391.sub.--1 (mouse); AAG29823.sub.--1 (rat); AAD34012.sub.--1
(rat); BAA11088.sub.--1 (mouse); BAA24501.sub.--1 (mouse);
AAH40382.sub.--1 (mouse); CAA65253.sub.--1 (Bos. tauruas);
CAA93287.sub.--1 (C. elegans); AAF46065.sub.--2 (D. melanogaster);
AAN17331.sub.--1 (Equus caballus); AAM50192.sub.--1 (D.
melanogaster); AAF55199.sub.--2 (D. melanogaster); AAF25805.sub.--1
(mouse); AAG37995.sub.--1 (D. melanogaster); AAG41980.sub.--1
(mouse); AAD56356.sub.--1 (mouse); AAF56794.sub.--3 (D.
melanogaster); AAF56795.sub.--3; GENESEQP:ABB71150 (D.
melanogaster); GENESEQP:AAB72280 (mouse); GENESEQP:ABB62044 (D.
melanogaster); GENESEQP:AAB72284 (mouse); GENESEQP:AAB21265
(mouse); GENESEQP:AAY53899 (mouse);. GENESEQP:AAY53900 (bovine);
GENESEQP:ABB60410 (D. melanogaster); GENESEQP:AAB50004 (bovine);
GENESEQP:AAY53898 (C. elegans); GENESEQP:AAW47030 (bovine);
GENESEQP:AAB72287(mouse); NR:25053113 (mouse); NR:20888361 (mouse);
NR:23634336 (mouse); NR27721019 (rat); NR27688211 (rat);
NR:27712734; NR: 20898418 (mouse); NR:27681743 (mouse); NR:21288693
(Anopheles gambiae); NR:27705982 (rat); NR:27693936 (rat);
NR:27664306 (rat); NR:20861058 (mouse); NR:27681747 (rat);
NR:27719839 (rat); NR:25056874 (mouse); and NR:25052431
(mouse).
[0051] Several ESTs similar to the nucleotide sequence of SEQ ID
NO: 1 are also published in Genbank, including the following
accession numbers: AW295437; BF224279; BE674425; BF512077;
AA057097; AA057097; AA057408; AV730422; BM696215; BM664487;
BG396090; BE253544; AA442575; and AA436819.
[0052] It is contemplated, based on the results of the BLAST
searches described that the EST18 mRNA is expressed at least in
carcinoid tissue, retinoblastoma, retina, testis, hypothalamus,
kidney and the brain. Additionally, the gene for EST18 is
speculated to be located on chromosome 16 in humans.
[0053] The full-length EST18 sequence, set forth in SEQ NO: 1, was
further used to search a genomic sequence database provided by
Celera for spliced variants of the EST18 mRNA, including, for
example, both 5' and 3' spliced variants. Some of the putative
spliced variants are identified by accession numbers:
Geneseq:aac16650; Geneseq:aah36077; Geneseq:aas65278;
Geneseq:aas65279; Geneseq:aas65280; Geneseq:aas97176;
Genbank:AJ311903; and Genbank:AX319854. Sequence alignments of
these sequences with the EST18 nucleotide sequence suggests that
majority of the spliced variants described herein have differences
at the 3' ends.
[0054] The Celera single nucleotide polymorphism database was
searched with the sequence set forth in SEQ ID NO: 1. The table
below summares the results of such a search, which lists the
genetic variations found within the EST18 sequence, for example,
across different races and ethnicities in humans. TABLE-US-00002
TABLE 2 SNP name Source Allele Protein Variation Location
hCV3284477 Celera T/C Intron hCV3284476 Celera G/A
Cys(TGC)1057Cys(TGT) Silent Mutation hCV11516846 Celera A/-- Intron
hCV3284474 Celera A/T Intron hCV3284473 Celera A/G Intron
hCV3284472 Celera T/G Intron hCV9478412 dbSNP A/C Intron hCV3284471
Celera C/G Intron hCV3284470 Celera T/A Intron hCV3284469 Celera
T/C Intron hCV3284468 Celera C/T Intron hCV3284467 Celera A/G
Intron hCV3284466 Celera T/C Val(GTA)986Val(GTG) Silent Mutation
hCV3284465 Celera C/A Ala(GCC)955Ser(TCC) Mis-sense Mutation
hCV3284464 Celera A/G Intron hCV3284463 Celera G/C Intron
hCV3284462 Celera T/C Intron hCV11516852 Celera --/T Intron
hCV3284461 Celera T/C Intron hCV3284460 Celera C/T Intron
hCV16210086 dbSNP G/A Intron hCV11937057 dbSNP C/T Intron
hCV11937062 dbSNP C/T Intron hCV9602010 dbSNP A/G Intron hCV9602009
dbSNP A/G Intron hCV9602008 dbSNP T/C Intron hCV9602001 dbSNP T/G
T/G T/G Intron hCV11937070 dbSNP T/C Intron hCV2852198 Celera C/A
Intron hCV2852197 Celera A/G Intron hCV2828126 Celera C/A Intron
hCV2828125 Celera T/C Intron hCV2828124 Celera G/C Intron
hCV2828123 Celera T/C Intron hCV7606027 dbSNP T/C Intron hCV7606023
dbSNP G/A Intron hCV7606022 dbSNP T/C Intron hCV2828122 Celera T/--
Intron hCV2828121 Celera C/T Intron hCV11935339 dbSNP G/A Intron
hCV16018212 dbSNP T/G Intron hCV2828119 dbSNP Celera G/A A/G G/A
Intron hCV2828118 dbSNP Celera A/T T/A T/A T/A Intron hCV2381371
dbSNP A/G G/A G/A G/A Intron hCV2828117 dbSNP G/A G/A G/A Intron
hCV2381370 dbSNP A/G A/G G/A Intron hCV11669939 Celera T/-- Intron
hCV2381369 dbSNP G/A A/G A/G Intron hCV2828115 Celera T/G Intron
hCV7606016 dbSNP G/A Intron hCV7606010 dbSNP Celera C/T C/T Intron
hCV11669940 dbSNP Celera G/A A/G Intron hCV9478393 dbSNP C/T Intron
hCV2828114 Celera C/G Intron hCV11439282 dbSNP C/T Intron
hCV2828113 dbSNP Celera C/G G/C Intron hCV2828112 Celera G/A Intron
hCV11439283 dbSNP C/G Intron hCV7606009 dbSNP T/C Intron
hCV16139205 dbSNP C/T Intron hCV11669941 Celera A/-- Intron
hCV11669944 Celera A/-- Intron hCV11439286 dbSNP A/G Intron
hCV16271258 dbSNP A/G Intron hCV16271259 dbSNP C/T Intron
hCV2828109 dbSNP Celera T/C C/T Intron hCV2828108 dbSNP Celera C/T
C/T Intron hCV9478420 dbSNP A/C A/C A/C A/C Intron hCV2828107 dbSNP
Celera T/C T/C Intron hCV2828106 dbSNP Celera C/T C/T Intron
hCV2828105 dbSNP Celera C/T T/C Intron hCV2828104 Celera G/A Intron
hCV16271260 dbSNP A/G Intron hCV3284520 Celera C/A Intron
hCV3284521 dbSNP Celera G/A A/G G/A Intron hCV11669953 Celera T/G
Intron hCV11669954 Celera T/A Intron hCV11669955 Celera C/A Intron
hCV16271264 dbSNP C/T Intron hCV11439287 dbSNP T/C Intron
hCV2828103 dbSNP Celera A/G A/G Intron hCV2828102 dbSNP Celera T/A
A/T Intron hCV2828101 Celera T/A Intron hCV2828100 Celera A/G
Intron hCV2828099 Celera C/T Intron hCV11439288 dbSNP A/G G/A A/G
A/G Intron hCV11439289 dbSNP G/C C/G G/C C/G Intron HGBASE C/G
hCV2828097 Celera C/A Intron hCV2828096 Celera C/A Intron
hCV2828095 Celera C/T Intron hCV11669963 Celera C/G Intron
hCV2828094 Celera C/T Intron hCV11669964 Celera G/A Intron
hCV11669965 Celera A/G Intron hCV11669967 Celera A/G Intron
hCV11669968 Celera A/G Intron hCV11439290 dbSNP G/T Intron
hCV11439291 dbSNP A/G Intron hCV9478400 dbSNP C/T Intron hCV7606003
dbSNP G/C Intron hCV16210093 dbSNP T/C Intron hCV2381366 dbSNP C/T
T/C C/T C/T Intron hCV2828091 dbSNP Celera C/T T/C C/T C/T Intron
C/T hCV11439294 dbSNP C/G Intron hCV2828090 Celera G/C Intron
hCV2828089 dbSNP Celera A/T A/T Intron hCV2828088 Celera A/G Intron
hCV2828087 Celera T/C Intron hCV2828086 dbSNP Celera A/C C/A Intron
hCV16271265 dbSNP A/G Intron hCV2828084 Celera T/C Intron
hCV11669971 Celera A/-- Intron hCV2828082 Celera T/G Intron
hCV2828081 Celera C/T Intron hCV16261553 dbSNP C/T Intron
hCV7605998 dbSNP G/A A/G Intron hCV9478310 dbSNP G/C C/G Intron
hCV16261554 dbSNP A/G Intron hCV15845773 dbSNP C/G Intron
hCV7605997 dbSNP C/A A/C Intron hCV2381364 dbSNP T/C C/T C/T C/T
Intron C/T C/T hCV7605993 dbSNP A/G G/A Intron hCV7605992 dbSNP A/G
Intron hCV11669973 Celera --/A Intron hCV7605991 dbSNP T/C Intron
hCV7605987 dbSNP C/T Intron hCV15816829 dbSNP T/C Intron hCV2381363
dbSNP T/G G/T T/G Intron hCV7605980 dbSNP C/A Intron hCV7605979
dbSNP A/G Intron hCV2828079 dbSNP Celera T/C C/T Intron hCV11669974
Celera --/A Intron hCV11439309 dbSNP T/C C/T C/T C/T Intron
hCV7605972 dbSNP Celera T/C C/T Intron hCV7605971 dbSNP T/A Intron
hCV2828078 Celera C/G Intron hCV11669976 Celera T/C Intron
hCV2828077 Celera C/T Intron hCV11669977 Celera G/T Intron
hCV2381361 dbSNP C/T T/C T/C Intron hCV2381360 dbSNP A/T T/A A/T
Intron hCV11439314 dbSNP T/C Intron hCV2828076 dbSNP Celera T/A T/A
Intron hCV2828074 Celera T/A Intron hCV7605963 dbSNP Celera C/G C/G
Intron hCV7605957 dbSNP A/C Intron hCV2828072 Celera C/T Intron
hCV2828071 Celera A/G Intron hCV16016767 dbSNP G/A Intron
hCV7605956 dbSNP G/T G/T Intron hCV7605955 dbSNP C/A A/C Intron
hCV2828070 dbSNP Celera T/C C/T T/C Intron hCV2828069 dbSNP Celera
T/C T/C Intron hCV2828068 dbSNP Celera G/A G/A G/A Intron
hCV16261555 dbSNP G/A Intron hCV16271253 dbSNP A/G Intron
hCV16261562 dbSNP T/C Intron hCV7605948 dbSNP T/C C/T Intron
hCV7605947 dbSNP C/G C/G Intron hCV16271271 dbSNP C/G Intron
hCV11669982 Celera G/-- Intron hCV11669983 Celera A/C Intron
hCV11669985 Celera --/A Intron hCV15784638 dbSNP AAAA/-- Intron
hCV2828065 dbSNP Celera C/T C/T C/T Intron hCV2828064 dbSNP Celera
A/G G/A Intron hCV2828063 dbSNP Celera C/G C/G Intron hCV9478268
dbSNP C/T Intron hCV2828062 dbSNP Celera G/A A/G Intron hCV16261563
dbSNP A/G Intron hCV16261564 dbSNP A/G Intron hCV16271266 dbSNP C/T
Intron hCV11669986 Celera --/A Intron hCV2828060 dbSNP Celera C/A
A/C A/C Intron hCV2828059 dbSNP Celera T/C T/C T/C Intron
hCV2828058 dbSNP Celera C/G C/G C/G Intron hCV2828057 dbSNP Celera
C/T C/T Intron hCV2828056 dbSNP Celera C/T C/T Intron hCV2828055
dbSNP Celera C/A A/C Intron hCV2828054 dbSNP Celera A/T A/T Intron
hCV16271272 dbSNP T/C Intron hCV16261571 dbSNP G/A G/A Intron
hCV16261572 dbSNP G/A Intron hCV16261573 dbSNP G/C Intron
hCV15784665 dbSNP --/CTA Intron hCV16016733 dbSNP A/G Intron
hCV11669989 dbSNP Celera T/C C/T T/C Intron hCV11669990 dbSNP
Celera T/C T/C C/T Intron hCV16261580 dbSNP A/T Intron hCV16271273
dbSNP A/G Intron hCV16261582 dbSNP G/C Intron hCV11669992 Celera
G/T Intron hCV15845774 dbSNP T/C T/C Intron hCV16016736 dbSNP C/T
Intron hCV2828045 Celera C/T Intron hCV2828044 Celera A/G
His(CAC)244Tyr(TAC) Mis-sense Mutation hCV2828043 dbSNP Celera T/G
G/T Intron hCV2828042 Celera C/T Intron hCV2828041 Celera G/A
Intron hCV11439320 dbSNP A/G A/G Intron hCV2828040 dbSNP Celera G/A
A/G Intron hCV11669993 Celera T/A Intron hCV2828039 Celera A/C
Intron hCV16018201 dbSNP G/A Intron hCV11669994 Celera G/A Intron
hCV2828038 Celera G/A Intron hCV2828037 Celera A/G Intron
hCV2828036 dbSNP Celera G/A A/G Intron hCV2828035 dbSNP Celera T/C
T/C T/C Intron hCV11669995 dbSNP Celera A/G G/A Intron hCV11439321
dbSNP G/C G/C Intron hCV11439324 dbSNP C/G C/G Intron hCV7605946
dbSNP T/C T/C C/T C/T Intron hCV2828033 Celera C/G Intron
hCV2828032 Celera A/G Intron hCV2381355 dbSNP G/C C/G G/C C/G
Intron hCV2381354 dbSNP A/G G/A G/A A/G Intron hCV16016737 dbSNP
G/A Intron hCV16016738 dbSNP A/G Intron hCV2381353 dbSNP C/T C/T
C/T T/C Intron hCV16018237 dbSNP T/C Intron hCV2381352 dbSNP C/T
C/T T/C C/T Intron hCV2381351 dbSNP T/C C/T C/T T/C Intron
hCV15864249 dbSNP A/C Intron hCV11439333 dbSNP C/A Intron
hCV11439334 dbSNP A/C A/C Intron hCV2381349 dbSNP T/C T/C T/C T/C
Intron hCV2828031 dbSNP Celera C/T T/C T/C T/C Intron T/C
hCV2828030 dbSNP Celera C/T C/T C/T C/T Intron hCV2828029 Celera
C/T Intron hCV2381348 dbSNP C/T C/T C/T Intron hCV2381347 dbSNP A/T
A/T T/A Intron hCV2828028 Celera C/G Intron hCV16018247 dbSNP T/A
Intron hCV16018248 dbSNP G/C Intron
hCV2828027 Celera A/G Intron hCV16016748 dbSNP A/T Intron
hCV16016749 dbSNP A/G Intron hCV16018249 dbSNP C/T Intron
hCV9606709 dbSNP C/T C/T C/T C/T Intron C/T hCV2828026 dbSNP Celera
C/T C/T Intron hCV16016750 dbSNP G/C Intron hCV9606713 dbSNP G/A
G/A Intron hCV16016754 dbSNP G/C Intron hCV2828025 Celera G/A
Intron hCV9606714 dbSNP T/C Intron hCV2828024 Celera G/A Intron
hCV2381346 dbSNP C/T T/C T/C T/C Intron hCV2381345 dbSNP G/A A/G
A/G G/A Intron hCV2828023 Celera T/A Intron hCV2828022 Celera T/A
Intron hCV2381344 dbSNP Celera A/T A/T A/T T/A Intron A/T
hCV2381343 dbSNP C/T C/T C/T C/T Intron hCV2381342 dbSNP C/G C/G
C/G C/G Intron hCV16018211 dbSNP C/T Intron hCV2381341 dbSNP C/G
G/C C/G G/C Intron G/C hCV11669997 Celera --/A Intron hCV2828020
Celera G/A Intron hCV11439337 dbSNP A/T Intron hCV2828019 Celera
A/G Intron hCV11669998 Celera A/-- Intron hCV2828017 Celera C/A
Intron hCV2828016 Celera C/G Intron hCV2828015 Celera C/G Intron
hCV2828014 Celera G/A Intron hCV2828013 Celera C/T Intron
hCV2828012 Celera T/C Intron hCV15944296 dbSNP T/G Intron
hCV9605371 dbSNP C/T Intron hCV2381340 dbSNP C/T C/T C/T T/C Intron
C/T hCV2828011 Celera G/T Intron hCV2828010 Celera A/G Intron
hCV2828009 Celera C/T Intron hCV2828008 Celera A/G Intron
hCV11670003 Celera C/G Intron hCV7605903 dbSNP C/A Intron
hCV7605890 dbSNP C/T Intron hCV2828002 Celera A/G Intron hCV7605889
dbSNP C/G Intron hCV2828001 Celera C/T Intron hCV2828000 Celera G/A
Intron hCV2827999 Celera A/G Intron hCV2827998 Celera T/C Intron
hCV2827997 Celera G/C Intron hCV2827996 Celera C/G Intron
hCV2827995 Celera --/G Intron hCV11670006 Celera --/G Intron
hCV2827993 Celera C/G Intron hCV2827992 Celera A/C Intron
hCV2827991 Celera A/G Intron hCV2827990 Celera G/A Intron
hCV2827989 Celera G/A Intron hCV16080952 dbSNP A/G Intron
hCV2827988 dbSNP Celera G/A A/G Intron hCV2827987 Celera G/A Intron
hCV11670008 dbSNP Celera T/G T/G Intron hCV11670009 Celera T/--
Intron hCV2827984 Celera G/T Intron hCV2827983 Celera G/A Intron
hCV11670011 Celera C/T Intron hCV11670012 Celera T/A Intron
hCV11670013 Celera A/G Intron hCV2827979 Celera A/G Intron
hCV11670014 Celera C/T Intron hCV2827977 Celera A/T Intron
hCV2827976 Celera G/A Intron hCV2827975 Celera T/A Intron
hCV2827974 Celera T/A Intron hCV2827973 Celera C/G Intron
hCV2827972 Celera A/G Intron hCV2827971 Celera C/A Intron
hCV11439338 dbSNP A/G Intron hCV2381339 dbSNP C/T C/T T/C C/T
Intron hCV2827970 Celera T/C Intron hCV2827969 Celera T/A Intron
hCV7605880 dbSNP T/C T/C Intron hCV7605879 dbSNP A/G G/A Intron
hCV2827968 Celera T/C Intron hCV2827967 Celera G/C Intron
hCV2827966 Celera C/G Intron hCV2381338 dbSNP A/G G/A A/G Intron
hCV2827964 Celera A/C Intron hCV2827963 dbSNP Celera C/T C/T Intron
hCV11439341 dbSNP C/T Intron hCV2827962 Celera A/G Intron
hCV2827961 dbSNP Celera C/T T/C Intron hCV11670022 Celera --/A
Intron hCV2827959 Celera G/A Intron hCV2827958 Celera T/C Intron
hCV2827957 Celera C/G Intron hCV2827956 Celera T/G Intron
hCV2827955 Celera G/C Intron hCV2827954 Celera T/C Intron
hCV2827953 Celera G/C Intron hCV15815639 dbSNP C/A Intron
hCV16142119 dbSNP T/A Intron hCV2827952 Celera C/T Intron
hCV15816830 dbSNP T/C Intron hCV1004253 dbSNP T/G T/G Intron
hCV9606740 dbSNP C/T Intron hCV3189734 dbSNP Celera C/T T/C Intron
hCV9606733 dbSNP A/G Intron hCV3189733 Celera C/G Intron hCV3189732
dbSNP Celera T/A T/A T/A T/A Intron A/T hCV1004252 dbSNP C/A A/C
A/C C/A Intron C/A hCV1004251 dbSNP A/T A/T T/A T/A Intron A/T T/A
hCV11670025 Celera G/A Intron hCV3189731 Celera T/C Intron
hCV11670028 Celera --/A Intron hCV3189730 Celera G/T Intron
hCV8560814 dbSNP Celera A/G G/A Intron hCV11670031 Celera A/G
Intron hCV11670032 Celera G/A Intron hCV11439346 dbSNP C/T Intron
hCV3189728 Celera G/C Intron hCV9606725 dbSNP C/G Intron hCV3189727
Celera C/A Intron hCV9606724 dbSNP C/A Intron hCV9606723 dbSNP T/C
Intron hCV9606719 dbSNP T/G Intron hCV16142120 dbSNP G/C Intron
hCV16142127 dbSNP T/A Intron hCV3189726 Celera T/C Intron
hCV3189725 Celera C/T Intron hCV9606718 dbSNP C/G Intron hCV3189724
dbSNP Celera C/T T/C Intron hCV2950480 Celera G/T Intron
hCV11670036 Celera --/A Intron hCV3189723 Celera T/A Intron
hCV2950479 Celera C/T Intron hCV7605776 dbSNP C/T Intron hCV3189722
Celera C/T Intron hCV2950478 Celera C/G Intron
[0055] The aggrecanase molecules provided also include factors
encoded by sequences similar to those of SEQ ID NO: 1, but which
include modifications or deletions that are naturally occurring,
for example, allelic variations in the nucleotide sequence which
may result in amino acid changes in the protein or artificially
engineered proteins. For example, synthetic proteins may wholly or
partially duplicate continuous sequences of the amino acid residues
of SEQ ID NO: 2. These sequences, by virtue of sharing primary,
secondary, or tertiary structural and conformational
characteristics with aggrecanase proteins may possess biological
properties in common therewith. It is known, for example that
numerous conservative amino acid substitutions are possible without
significantly modifying the structure and conformation of a
protein, thus maintaining the biological properties of the protein.
For example, it is recognized that conservative amino acid
substitutions may be made among amino acids with basic side chains,
such as lysine (Lys or K), arginine (Arg or R) and histidine (His
or H); amino acids with acidic side chains, such as aspartic acid
(Asp or D) and glutamic acid (Glu or E); amino acids with uncharged
polar side chains, such as asparagine (Asn or N), glutamine (Gln or
Q), serine (Ser or S), threonine (Thr or T), and tyrosine (Tyr or
Y); and amino acids with nonpolar side chains, such as alanine (Ala
or A), glycine (Gly or G), valine (Val or V), leucine (Leu or L),
isoleucine (lle or l), proline (Pro or P), phenylalanine (Phe or
F), methionine (Met or M), tryptophan (Trp or W) and cysteine (Cys
or C). Thus, these modifications and deletions of the native
aggrecanase may be employed as biologically active substitutes for
naturally-occurring aggrecanase and in the development of
inhibitors or other proteins for therapeutic purposes. It can be
readily determined whether a given variant of aggrecanase maintains
the biological activity of aggrecanase by subjecting both
aggrecanase and the variant of aggrecanase, as well as inhibitors
thereof, to the assays described in the examples.
[0056] Desired amino acid substitutions (whether conservative or
non-conservative) can be determined by those skilled in the art at
the time such substitutions are desired. For example, amino acid
substitutions can be used to identify important amino acid residues
of the proteins or polypeptides of the invention, or to increase or
decrease the activity of the aggrecanases of the invention
described. Exemplary amino acid substitutions are set forth in
Table 3. TABLE-US-00003 TABLE 3 Amino Acid Substitutions More
Original Exemplary Conservative Residues Substitutions
Substitutions Ala (A) Val, Leu, Ile Val Arg (R) Lys, Gln, Asn Lys
Asn (N) Gln Gln Asp (D) Glu Glu Cys (C) Ser, Ala Ser Gln (Q) Asn
Asn Gly (G) Pro, Ala Ala His (H) Asn, Gln, Lys, Arg Arg Ile (I)
Leu, Val, Met, Ala, Phe, Norleucine Leu Leu (L) Norleucine, Ile,
Val, Met, Ala, Phe Ile Lys (K) Arg, 1,4 Diamino-butyric Acid, Gln,
Asn Arg Met (M) Leu, Phe, Ile Leu Phe (F) Leu, Val, Ile, Ala, Tyr
Leu Pro (P) Ala Gly Ser (S) Thr, Ala, Cys Thr Thr (T) Ser Ser Trp
(W) Tyr, Phe Tyr Tyr (Y) Trp, Phe, Thr, Ser Phe Val (V) Ile, Met,
Leu, Phe, Ala, Norleucine Leu
[0057] In certain embodiments, conservative amino acid
substitutions also encompass non-naturally occurring amino acid
residues which are typically incorporated by chemical peptide
synthesis rather than by synthesis in biological systems.
[0058] Other specific mutations of the sequences of aggrecanase
proteins described include modifications of glycosylation sites.
These modifications may involve O-linked or N-linked glycosylation
sites. For instance, the absence of glycosylation or presence of
only partial glycosylation can result from amino acid substitutions
or deletions at asparagine-linked glycosylation recognition sites.
Asparagine-linked glycosylation recognition sites comprise
tripeptide sequences which are recognized specifically by
appropriate cellular glycosylation enzymes. These tripeptide
sequences usually are either asparagine-X-threonine or
asparagine-X-serine, where X can be any amino acid. A variety of
amino acid substitutions or deletions at one or both of the first
or third amino acid positions of a glycosylation recognition site
(and/or amino acid deletion at the second position) results in
non-glycosylation at the modified tripeptide sequence.
Additionally, bacterial expression of aggrecanase-related proteins
will also result in production of a non-glycosylated protein, even
if the glycosylation sites are left unmodified.
[0059] IV. Novel Aggrecanase Nucleotide Sequences
[0060] Nucleic acid sequences within the scope of the invention
include isolated DNA and RNA sequences that hybridize to the native
aggrecanase DNA sequences disclosed under conditions of moderate to
high stringency. Stringent conditions or conditions of high
stringency generally refer to hybridization and washing conditions
that employ higher temperature and lower salt concentrations.
Additionally, inclusion of formamide also increases stringency. For
example, hybridization conditions at 60-65.degree. C. in the
absence of formamide or at 42.degree. C. with 50% formamide, are
both high stringency conditions.
[0061] Still a further aspect of the invention are DNA sequences
encoding aggrecanase proteins having aggrecanase proteolytic
activity or other disclosed or yet undiscovered activities of
aggrecanase. Such sequences include nucleotide sequence illustrated
in SEQ ID NO: 1, and DNA sequences which, but for the degeneracy of
the genetic code, are identical to the DNA sequence of SEQ ID NO: 1
and encode an aggrecanase protein, for example, including the amino
acid sequence of SEQ ID NO: 2, or a variant thereof.
[0062] Further included in the present invention are DNA sequences
which hybridize under high to moderate stringent conditions with
the DNA sequence of SEQ ID NO: .1 and encode a protein having the
ability to cleave aggrecan. In one embodiment, DNA sequences
include those which hybridize under high stringent conditions (see
Maniatis et aL, Molecular Cloning (A Laboratory Manual), Cold
Spring Harbor Laboratory, at 387-389 (1982)). Such stringent
conditions comprise, for example, 0.1.times.SSC, 0.1% SDS, at
65.degree. C. DNA sequences identified by hybridization include,
for example, DNA sequences that encode a protein which is at least
about 80% identical, at least about 90% identical, or at least
about 95% identical to the sequence set forth in SEQ ID NO: 2. DNAs
that are equivalents to the DNA of SEQ ID NO: 1 will also hybridize
under moderately stringent conditions to the DNA sequence encoding
the peptide sequence of SEQ ID NO: 2.
[0063] Conditions of moderate stringency are known in the art, and
are defined by Sambrook et al. Molecular Cloning: A Laboratory
Manual, 2 ed. Vol. 1, Cold Spring Harbor Press. (1989). In one
embodiment, for example, conditions of moderate stringency include
use of a prewashing solution of 5.times.SSC/0.5% SDS, 1.0 mM EDTA
(pH 8.0) and hybridization conditions of about 55.degree.
C.-60.degree. C. temperature and washing overnight in 5.times.SSC
overnight at about 55.degree. C. The skilled artisan will recognize
that the conditions may be adjusted as necessary according to
factors such as the length and composition of the nucleic acid
sequences.
[0064] Finally, allelic or other variations of the sequences of SEQ
ID NO: 1. encoding the amino acid sequence of SEQ ID NO: 2, or
peptide sequence variants of SEQ ID NO: 2, that have aggrecanase
activity, are also included in the present invention. Additionally,
the present invention includes fragments of the DNA sequence shown
in SEQ ID NO: 1 and variants of SEQ ID NO: 1, encoding a protein
with aggrecanase activity.
[0065] Similarly, DNA sequences which encode aggrecanase proteins
comprising the sequence set forth in SEQ ID NO: 2 but which differ
from SEQ ID NO: 1 in codon usage because of the degeneracies of the
genetic code or because of allelic variations (naturally-occurring
base changes in the species population which may or may not result
in an amino acid change) also encode the novel factors described.
Variations in the DNA sequence of SEQ ID NO: 1 which are caused by
point mutations or by induced modifications (including insertion,
deletion, and substitution) to enhance the activity, half-life or
production of the proteins encoded by them are also encompassed by
the invention. The DNA sequences of the present invention are
useful, for example, as probes for the detection of mRNA encoding
aggrecanase in a given cell population. Thus, the present invention
includes methods of detecting or diagnosing diseases and genetic
disorders involving aggrecanase proteins, or disorders involving
cellular, organ or tissue disorders in which aggrecanase is
irregularly transcribed or expressed. Antisense DNA sequences may
also be used for preparing vectors for gene therapy applications.
Antisense DNA sequences are also useful in in vivo methods
involving a cell or an organism, for example, introducing an
antisense DNA sequence for aggrecanase into a cell in order to
study the interaction of the antisense DNA with the endogenous
aggrecanase sequences, and further in order to test the capacity of
a promoter operatively linked to the antisense DNA sequence in a
vector as a measure of how much antisense DNA is produced in a
cell.
[0066] A further aspect of the invention includes vectors
comprising a DNA sequence as described above in operative
association with an expression control sequence therefor. These
vectors may be employed in a novel process for producing an
aggrecanase protein of the invention in which a cell line
transformed with a DNA sequence encoding an aggrecanase protein in
operative association with an expression control sequence therefor,
is cultured in a suitable culture medium and an aggrecanase protein
is recovered and isolated therefrom. This process may employ a
number of known cells both prokaryotic and eukaryotic as host cells
for expression of the protein. The vectors may be used in gene
therapy applications. In such use, the vectors may be transfected
into cells of a patient ex vivo, and the cells may be reintroduced
into a patient. Alternatively, the vectors may be introduced into a
patient in vivo through targeted transfection.
[0067] V. Production of Aggrecanase Proteins
[0068] Another aspect of the present invention provides methods for
producing novel aggrecanase proteins. In one embodiment, a method
of the present invention involves culturing a suitable cell line,
which has been transformed with a DNA sequence, for example, the
sequence set forth in SEQ ID NO: 1, and translating the DNA into an
aggrecanase protein of the invention, set forth in SEQ ID NO: 2,
under the control of known regulatory sequences. The transformed
host cells are cultured and the aggrecanase proteins recovered and
isolated from the culture medium. The isolated expressed proteins
are substantially free from other proteins with which they are
co-produced as well as from other contaminants. The recovered
isolated protein is contemplated to exhibit proteolytic aggrecanase
activity comprising aggrecan cleavage. Thus, the proteins of the
invention may be further characterized by the ability to
demonstrate aggrecanase proteolytic activity in an assay which
determines the presence of an aggrecan-degrading molecule. These
assays or the development thereof is within the knowledge of one
skilled in the art. Such assays may involve contacting an aggrecan
substrate with an aggrecanase molecule and monitoring the
production of aggrecan fragments (see for example, Hughes et al.,
Biochem J 305: 799-804 (1995); Mercuri et aL., J Biol. Chem
274:32387-32395 (1999)). Suitable cells or cell lines may be
mammalian cells, such as Chinese hamster ovary cells (CHO). The
selection of suitable mammalian host cells and methods for
transformation, culturing, amplification, screening, product
production and purification are known in the art. (See, e.g.,
Gething and Sambrook, Nature, 293:620-625 (1981); Kaufman et al.,
Mol Cell Biol, 5(7):1750-1759 (1985); Howley et al., U.S. Pat. No.
4,419,446.)) Another suitable mammalian cell line, which is
described in the accompanying examples, is the monkey kidney COS-1
cell line. The mammalian CV-1 cells may also be used.
[0069] Bacterial cells may also be used as suitable hosts for
expression of the proteins or polypeptides of the invention. For
example, the various strains of E. coli (e.g., HB101, MC1061) are
well-known as host cells in the field of biotechnology. Various
strains of B. subtilis, Pseudomonas, other bacilli and the like may
also be employed in the methods of the invention. For expression of
the protein in bacterial cells, DNA encoding the propeptide of an
aggrecanase is generally not necessary.
[0070] Many strains of yeast cells known to those skilled in the
art may also be available as host cells for expression of the
proteins or polypeptides of the present invention. Additionally,
where desired, insect cells may be utilized as host cells in the
method of the present invention. See, e.g., Miller et al., Genetic
Engineering, 8:277-298 (Plenum Press 1986).
[0071] Another aspect of the present invention provides vectors for
use in a method of expression of these novel aggrecanase proteins.
In one embodiment, vectors of the invention contain full length DNA
sequences described which encode the novel factors of the
invention. Additionally, the vectors contain appropriate expression
control sequences permitting expression of the aggrecanase protein
sequences. Alternatively, vectors incorporating modified sequences
as described above are also embodiments of the present invention.
Additionally, the sequence of SEQ ID NO: 1 or other sequences
encoding aggrecanase proteins could be manipulated to express
composite aggrecanase proteins. Thus, the present invention
includes chimeric DNA molecules that encode a recombinant protein
including an aggrecanase protein comprising a fragment of SEQ ID
NO: 2 linked to a different aggrecanase protein. Such a recombinant
or fusion protein can be produced by linking the DNA encoding a
fragment of the aggrecanase molecule set forth in SEQ ID NO: 2 in
frame with the DNA encoding a different aggrecanase protein. The
DNA encoding the aggrecanase protein set forth in SEQ ID NO: 2 or a
fragment or variant thereof can be linked either 3' or 5' to the
DNA encoding a different aggrecanase. Vectors used for the
expression of aggrecanase molecules of the invention may be
employed in a method of transforming cell lines and usually contain
selected regulatory sequences capable of directing the replication
and expression of aggrecanase molecules in operative association
with DNA sequences of the invention. Regulatory sequences for such
vectors are known to those skilled in the art and may be selected
depending upon the host cells. Such selection is routine and does
not form part of the present invention.
[0072] One skilled in the art can construct mammalian expression
vectors by employing a sequence comprising, for example, SEQ ID NO:
1 or other DNA sequences encoding aggrecanase-related proteins or
other modified sequences and known vectors, such as, for example,
pCD (Okayama et aL, Mol Cell Biol, 2:161-170 (1982)), pJL3, pJL4
(Gough et al., EMBO J, 4:645-653 (1985)) and pMT2 CXM. In addition,
one skilled in the art can employ a suitable expression vector for
expressing a recombinant form of the aggrecanase protein, for
example, rA18FS, in an expression system of choice.
[0073] The construction of vectors may involve modification of the
aggrecanase-related DNA sequences. For instance, aggrecanase cDNA
can be modified by removing the non-coding nucleotides on the 5'
and 3' ends of the coding region. The deleted non-coding
nucleotides may or may not be replaced by other sequences known to
be beneficial for expression. These vectors are transformed into
appropriate host cells for expression of aggrecanase or
aggrecanase-related proteins. Additionallv, the sequence of SEQ ID
NO: 1 or other sequences encoding aggrecanases or
aggrecanase-related proteins can be manipulated to express a mature
aggrecanase or aggrecanase-related protein by deleting aggrecanase
encoding propeptide sequences and replacing them with sequences
encoding complete propeptides of other aggrecanase proteins.
[0074] One skilled in the art can manipulate the sequence of SEQ ID
NO: 1 by eliminating or replacing the mammalian regulatory
sequences flanking the coding sequence with bacterial sequences to
create bacterial vectors for intracellular or extracellular
expression by bacterial cells. For example, the coding sequences
could be further manipulated (e.g., ligated to other known linkers
or modified by deleting non-coding sequences therefrom or altering
nucleotides therein by other known techniques). The modified
aggrecanase-related coding sequence could then be inserted into a
known bacterial vector using procedures such as described in
Taniguchi et al., Proc. Natl. Acad. Sci. USA, 77:5230-5233 (1980).
This exemplary bacterial vector could then be transformed into
bacterial host cells and an aggrecanase-related protein expressed
thereby. For a strategy for producing extracellular expression of
aggrecanase-related proteins in bacterial cells, see, e.g.,
European patent application EPA 177,343.
[0075] Similar manipulations can be performed for the construction
of an insect vector (see, e.g. procedures described in published
European patent application EPA 155,476) for expression in insect
cells. A yeast vector could also be constructed employing yeast
regulatory sequences for intracellular or extracellular expression
of the factors of the present invention by yeast cells. (See, e.g.,
procedures described in published PCT application WO 86/00639 and
European patent application EPA 123,289.)
[0076] A method for producing high levels of a aggrecanase-related
protein of the invention in mammalian, bacterial, yeast or insect
host cell systems may involve the construction of cells containing
multiple copies of the heterologous aggrecanase-related gene. The
heterologous gene is linked to an amplifiable marker, e.g., the
dihydrofolate reductase (DHFR) gene for which cells containing
increased gene copies can be selected for propagation in increasing
concentrations of methotrexate (MTX) according to the procedures of
Kaufman and Sharp, J Mol Biol, 159:601-629 (1982). This approach
can be employed with a number of different cell types.
[0077] For example, a plasmid containing a DNA sequence for an
aggrecanase-related protein of the invention in operative
association with other plasmid sequences enabling expression
thereof and the DHFR expression plasmid pAdA26SV(A)3 (Kaufman and
Sharp, Mol Cell Biol 2:1304 (1982)) can be co-introduced into
DHFR-deficient CHO cells, DUKX-BII, by various methods including
calcium phosphate coprecipitation and transfection, electroporation
or protoplast fusion. DHFR expressing transformants are selected
for growth in alpha media with dialyzed fetal calf serum, and
subsequently selected for amplification by growth in increasing
concentrations of MTX (e.g. sequential steps in 0.02, 0.2,1.0 and 5
.mu.M MTX) as described in Kaufman et al., Mol Cell Biol., 5:1750
(1983). Transformants are cloned, and biologically active
aggrecanase expression is monitored by the assays described above.
Aggrecanase protein expression should increase with increasing
levels of MTX resistance. Aggrecanase proteins are characterized
using standard techniques known in the art such as pulse labeling
with .sup.35S methionine or cysteine and polyacrylamide gel
electrophoresis. Similar procedures can be followed to produce
other related aggrecanase-related proteins.
[0078] Aggrecanase proteins of the invention can also be expressed
as fusion proteins comprising the protein sequence, for example,
the sequence set forth in SEQ ID NO: 2 or a fragment or a variant
thereof, and for example, a tag, i.e., a second protein or one or
more amino acids, from about 2 to 50 amino acids, or from about 50
to about 100 amino acids, which are added to the amino terminus of,
the carboxy terminus of, or any point within the amino acid
sequence of an aggrecanase protein, or a fragment or variant
thereof. Typically, such amino acid tags are made to stabilize the
resulting fusion protein or to simplify purification of an
expressed recombinant form of the corresponding aggrecanase protein
or a fragment or a variant of such protein, including for example,
a truncated form of an aggrecanase protein of the invention. Such
tags are known in the art. Representative examples of such tags
include sequences which encode a series of histidine residues, the
epitope tag FLAG, the Herpes simplex glycoprotein D,
beta-galactosidase, maltose binding protein, streptavidin tag or
glutathione S-transferase.
[0079] VI. Generation of Antibodies
[0080] The isolated proteins of the present inventions may be used
to generate antibodies, either monoclonal or polyclonal, to
aggrecanase and/or other aggrecanase-related proteins, using
methods of antibody production that are generally known in the art.
Thus, the present invention also includes antibodies to aggrecanase
or other related proteins. The antibodies include both antibodies
that block aggrecanase activity and antibodies that do not. The
antibodies may be useful for detection and/or purification of
aggrecanase or related proteins, or for inhibiting or preventing
the effects of aggrecanase. Aggrecanases of the invention or
portions thereof may be utilized to prepare antibodies that
specifically bind to aggrecanase.
[0081] Antibodies can be made, for example, via traditional
hybridoma techniques (Kohler and Milstein, Nature 256:495499
(1975)), recombinant DNA methods (for example, U.S. Pat. No.
4,816,567), or phage display techniques using antibody libraries
(Clackson et al., Nature 352: 624-628 (1991); Marks et aL, J. Mol.
Biol. 222:581-597 (1991)). For various antibody production
techniques, see Antibodies: A Laboratory Manual, eds. Harlow et
al., Cold Spring Harbor Laboratory (1988).
[0082] Proteins are known to have certain biochemical properties
including sections which are hydrophobic and sections which are
hydrophilic. The hydrophobic sections are most likely to be located
in the interior of the structure of the folded protein while the
hydrophilic sections are most likely to be located in the exterior
of the structure of the folded protein. It is believed that the
hydrophilic regions of a protein correspond to antigenic epitopes
on the protein. The hydrophobicity of the protein set forth in SEQ
ID NO: 2 was determined using the GCG program called plotstructure.
The results, as depicted in FIG. 9, indicated that the protein of
SEQ ID NO: 2 has several regions that are hydrophilic and
therefore, expected to be on the surface of the folded protein. For
example, between amino acids 50 and 100, there is a region that is
predicted to be hydrophilic as well as antigenic. Such antigenic
regions can be employed for the generation of antibodies.
[0083] Antibodies of the invention may be used in the treatment of
the diseases described below. Antibodies can also be used in the
assays and methods of detection described.
[0084] VII. Development of Inhibitors
[0085] Various conditions such as osteoarthritis are known to be
characterized by degradation of aggrecan. Therefore, an aggrecanase
protein of the present invention which cleaves aggrecan may be
useful for the development of inhibitors of aggrecanase. The
invention therefore provides compositions comprising an.
aggrecanase inhibitor. The inhibitors may be developed using an
aggrecanase molecule in screening assays involving a mixture of
aggrecan substrate with an inhibitor of aggrecanase activity
followed by exposure to aggrecan. Inhibitors can be screened using
high throughput processes, such as by screening a library of
inhibitors. Inhibitors can also be made using three-dimensional
structural analysis and/or computer aided drug design. The method
may entail determination of binding sites for inhibitors based on
the three dimensional structure of aggrecanase and aggrecan and
developing molecules reactive with a binding site on aggrecanase or
aggrecan. Candidate molecules are assayed for inhibitory activity.
Additional standard methods for developing inhibitors of
aggrecanase molecules are known to those skilled in the art. Assays
for the inhibitors involve contacting a mixture of aggrecan and an
inhibitor with an aggrecanase molecule followed by measurement of
the degree of aggrecanase inhibition, for instance by detection and
measurement of aggrecan fragments produced by cleavage at an
aggrecanase susceptible site. Inhibitors may be proteins,
antibodies or small molecules.
[0086] VIII. Disease Treatment and Diagnosis
[0087] Inhibitors of aggrecanase activity may be used in the
treatment of diseases described below. Inhibitors can also be used
in the assays and methods of detection described. Various diseases
that are contemplated as being treatable by using inhibitors of
aggrecanases of the invention include, but are not limited to,
osteoarthritis, cancer, inflammatory joint disease, rheumatoid
arthritis, septic arthritis, periodontal diseases, corneal
ulceration, proteinuria, coronary thrombosis from atherosclerotic
plaque rupture, aneurysmal aortic disease, inflammatory bowel
disease, Crohn's disease, emphysema, acute respiratory distress
syndrome, asthma, chronic obstructive pulmonary disease,
Alzheimer's disease, brain and hematopoietic malignancies,
osteoporesis, Parkinson's disease, migraine, depression, peripheral
neuropathy, Huntington's disease, multiple sclerosis, ocular
angiogenesis, macular degeneration, aortic aneurysm, myocardial
infarction, autoimmune disorders, degenerative cartilage loss
following traumatic joint injury, head trauma, dystrophobic
epidermolysis bullosa, spinal cord injury, acute and chronic
neurodegenerative diseases, osteopenias, tempero mandibular joint
disease, demyelating diseases of the nervous system, organ
transplant toxicity and rejection, cachexia, allergy, tissue
ulcerations, restenosis, and other diseases characterized by
altered aggrecanase activity or altered aggrecanase level.
[0088] It is contemplated that inhibitors and antibodies of the
invention that inhibit activity of aggrecanases and/or compounds
that may lower expression of aggrecanases may be used in the
treatment of any disease in a mammal that involves degradation of
the extracellular matrix proteins, such as aggrecan, by
aggrecanases and aggrecanase-related proteins.
[0089] IX. Administration
[0090] Another aspect of the invention provides pharmaceutical
compositions containing a therapeutically effective amount of at
least one of aggrecanase antibodies and inhibitors, in a
pharmaceutically acceptable vehicle. Aggrecanase-mediated
degradation of aggrecan in cartilage has been implicated in
osteoarthritis and other inflammatory diseases. Therefore, these
compositions of the invention may be used in the treatment of
diseases characterized by the degradation of aggrecan and/or an up
regulation of aggrecanase activity or level of aggrecanases.
[0091] The invention includes methods for treating patients
suffering from conditions characterized by a degradation of
aggrecan. These methods, according to the invention, entail
administering to a patient needing such treatment, an effective
amount of a composition comprising an aggrecanase antibody or
inhibitor which inhibits the proteolytic activity of an aggrecanase
enzyme.
[0092] Antibodies and inhibitors of the present invention are
useful to diagnose or treat various medical disorders in humans or
animals. In one embodiment, the antibodies of the invention can be
used to inhibit or reduce one or more activities associated with an
aggrecanase protein, relative to an aggrecanase protein not bound
by the same antibody. In one embodiment, antibodies and inhibitors
of the invention can inhibit or reduce one or more of the
activities of an aggrecanase molecule relative to the aggrecanase
that is not bound by an antibody. In certain embodiments, an
activity of an aggrecanase, when bound by one or more of the
presently disclosed antibodies, is inhibited at least 50%, may be
inhibited at least 60, 62, 64, 66, 68, 70, 72, 72, 76, 78, 80, 82,
84, 86, or 88%, may be inhibited at least 90, 91, 92, 93, or 94%,
or may be inhibited at least 95% to 100% relative to the
aggrecanase protein that is not bound by one or more of the
presently disclosed antibodies.
[0093] Generally, compositions of the present are administered to a
patient so that antibodies or their binding fragments are
administered at a dose ranging from about 1 .mu.g/kg to about 20
mg/kg, about 1 .mu.g/kg to about 10 mg/kg, about 1 .mu.g/kg to
about 1 mg/kg, about 10 .mu.g/kg to about 1 mg/kg, about 10
.mu.g/kg to about 100 .mu.g/kg, about 100 .mu.g to about 1 mg/kg,
or about 500 .mu.g/kg to about 1 mg/kg. Antibodies are administered
as a bolus dose, to maximize the interval of time that the
antibodies can circulate in the patient's body following their
administration to the patient. Continuous infusion may also be used
after an initial bolus dose.
[0094] In another embodiment, the invention is directed to
administration of inhibitors of aggrecanases, such as proteins and
small molecules. The effective amount of an inhibitor is a dosage
which is useful for reducing activity of aggrecanases to achieve a
desired biological outcome. Generally, appropriate therapeutic
dosages for administering an inhibitor may range, for example, from
about 5 mg to about 100 mg, from about 15 mg to about 85 mg, from
about 30 mg to about 70 mg, or from about 40 mg to about 60 mg.
Inhibitors can be administered in one dose, or at intervals such as
once daily, once weekly, or once monthly. Dosage schedules for
administration of an aggrecanase inhibitor can be adjusted based
on, for example, the affinity of the inhibitor for its aggrecanase
target, the half-life of the inhibitor, and the severity of the
patient's condition. Generally, inhibitors are administered as a
bolus dose, to maximize their circulating levels. Continuous
infusions may also be used after the bolus dose.
[0095] Toxicity and therapeutic efficacy of such compounds can be
determined by standard pharmaceutical procedures in cell culture or
experimental animal models, e.g., for determining the LD.sub.50
(the dose lethal to 50% of the population) and the ED.sub.50 (the
dose therapeutically effective in 50% of the population). The dose
ratio between toxic and therapeutic effects is the therapeutic
index and it can be expressed as the ratio LD.sub.50/ED.sub.50.
Antibodies and inhibitors, which exhibit large therapeutic indices,
are generally preferred.
[0096] The data obtained from cell culture assays and animal
studies can be used in formulating a range of dosages for use in
humans. The dosage of such compounds may lie within a range of
circulating concentrations that exhibit an ED.sub.50 with little or
no toxicity. The dosage may vary within this range depending upon
the dosage form employed and the route of administration utilized.
For any antibody or inhibitor used according to the present
invention, a therapeutically effective dose can be estimated
initially from cell culture assays. A dose may be formulated in
animal models to achieve a circulating plasma concentration range
that exhibits an IC.sub.50 (i.e., the concentration of the test
antibody which achieves a half-maximal inhibition of symptoms) as
determined by cell culture assays. Levels in plasma may be
measured, for example, by high performance liquid chromatography.
The effects of any particular dosage can be monitored by suitable
bioassays. Examples of suitable bioassays include DNA replication
assays, transcrption-based assays, GDF protein/receptor binding
assays, creatine kinase assays, assays based on the differentiation
of pre-adipocytes, assays based on glucose uptake in adipocytes,
and immunological assays.
[0097] Therapeutic methods of the invention include administering
the aggrecanase inhibitor compositions topically, systemically, or
locally as an implant or a device. The dosage regimen will be
determined by the attending physician based on various factors
which modify the action of the aggrecanase protein, the site of
pathology, the severity of disease, the patient's age, sex, and
diet, the severity of any inflammation, time of administration and
other clinical factors. Generally, systemic or injectable
administration will be initiated at a dose which is minimally
effective, and the dose will be increased over a preselected time
course until a positive effect is observed. Subsequently,
incremental increases in dosage will be made limiting to levels
that produce a corresponding increase in effect, while taking into
account any adverse affects that may appear. The addition of other
known factors, to a final composition, may also affect the
dosage.
[0098] Progress can be monitored by periodic assessment of disease
progression. The progress can be monitored, for example, by X-rays,
MRI or other imaging modalities, synovial fluid analysis, patient
response, and/or clinical examination.
[0099] X. Assays and Methods of Detection
[0100] The inhibitors and antibodies of the invention can be used
in assays and methods of detection to determine the presence or
absence of, or quantify aggrecanase in a sample. The inhibitors and
antibodies of the present invention may be used to detect
aggrecanase proteins, in vivo or in vitro. By correlating the
presence or level of these proteins with a disease, one of skill in
the art can diagnose the associated disease or determine its
severity. Diseases that may be diagnosed by the presently disclosed
inhibitors and antibodies are set forth above.
[0101] Detection methods for use with antibodies are well known in
the art and include ELISA, radioimmunoassay, immunoblot, western
blot, immunofluorescence, immuno-precipitation, and other
comparable techniques. The antibodies may further be provided in a
diagnostic kit that incorporates one or more of these techniques to
detect a protein (e.g., an aggrecanase protein). Such a kit may
contain other components, packaging, instructions, or other
material to aid the detection of an aggrecanase protein, and
instructions regarding use of the kit. When protein inhibitors are
used in such diagnostic assays, protein-protein interaction assays
can be employed .
[0102] Where antibodies and inhibitors are intended for diagnostic
purposes, it may be desirable to modify them, for example, with a
ligand group (such as biotin) or a detectable marker group (such as
a fluorescent group, a radioisotope or an enzyme). If desired, the
antibodies (whether polyclonal or monoclonal) may be labeled using
conventional techniques. Suitable labels include fluorophores,
chromophores, radioactive atoms, electron-dense reagents, enzymes,
and ligands having specific binding partners. Enzymes are typically
detected by their activity. For example, horseradish peroxidase can
be detected by its ability to convert tetramethylbenzidine (TMB) to
a blue pigment, quantifiable with a spectrophotometer. Other
suitable binding partners include biotin and avidin or
streptavidin, IgG and protein A, and the numerous receptor-ligand
couples known in the art.
EXAMPLES
Example 1
Isolation of DNA
[0103] Potential novel aggrecanase family members were identified
using a database screening approach. Aggrecanase-1 (Science
284:1664-1666 (1999)) has at least six domains: signal, propeptide,
catalytic domain, disintegrin, tsp (thrombospondin), and
c-terminal. The catalytic domain contains a zinc binding signature
region, TAAHELGHVKF (SEQ. ID NO: 6) and a "MET turn" which are
responsible for protease activity. Substitutions within the zinc
binding region in the number of the positions still allow protease
activity, but the histidine (H) and glutamic acid (E) residues must
be present. The thrombospondin domain of Aggrecanase-1 is also a
critical domain for substrate recognition and cleavage. It is these
two domains that determine our classification of a novel
aggrecanase family member. The coding region of the aggrecanase-1
DNA sequence was used to query against the GeneBank ESTs focusing
on human ESTs using TBLASTN. The resulting sequences were the
starting point in an effort to identify a sequence for potential
family members. A particular nucleotide sequence of the aggrecanase
of the present invention, referred to as ADAMTS-18 or EST18, is
depicted in FIGS. 1A and 1B (SEQ ID NO: 1).
[0104] The virtual EST18 sequence is set forth in FIGS. 5A and 5B
(SEQ ID NO: 5). Based on the initial virtual sequence, a set of PCR
primers was designed to amplify approximately 1200 base pairs
spanning the pro and catalytic domain of EST18. This primer set was
used to screen cDNA molecules from different types of tissue to
identify tissue sources for aggrecanase molecules. Once the tissue
sources were identified, two overlapping fragments of EST18 were
amplified by PCR using the cDNA molecule and the amplified
fragments were cloned into vectors for sequencing. Cloned sequences
differed from the predicted sequence therefore, multiple replicas
of each reaction were cloned and sequenced from three independent
tissue sources. Based on sequence analysis of all the clones, a
consensus open reading frame (ORF) of 3219 base pairs was
determined (SEQ ID NO: 3). It is contemplated that this 3219 bp ORF
frame does not represent the full-length gene, as further described
below. The obtained sequence may be utilized to screen for and
isolate the full length sequence Since the PCR conditions use to
amplify the EST18 sequence promoted the introduction of errors, the
3219 bp ORF had to be constructed by amplifying multiple
overlapping fragments, digesting them with specific restriction
enzymes, followed by final ligation into the mammalian expression
vector called pED.
[0105] Specifically, marathon-ready.TM. cDNA, brain, stomach, and
thymus (Clontech, Palo Alto, Calif.) was used as a template in all
PCR cloning reactions. All the PCR reactions were carried out in a
Perkin-Elmer 9600 thermocycler (Wellesley, Mass.) utilizing the
following cycling parameters: 94.degree. C. for 30 sec, 5 cycles of
94.degree. C. for 5 sec, 72.degree. C.for 4 min, 5 cycles of
94.degree. C.for 5 sec, 70.degree. C.for 4 min, 30 cycles of
94.degree. C. for 5 sec, 68.degree. C. 4 min. Clontech's
Advantage.TM. GC2 polymerase was used with a final concentration of
0.5 M GC-melt according to the manufacturer's recommendations
(Clontech, Palo Alto, Calif.). The various primer sets used for
amplifying each fragment of the putative full-length nucleotide for
EST18 are depicted in FIG. 6A as the sequences set forth in SEQ ID
NOs.: 9, 10, 11 and 12.
[0106] PCR products were digested with different enzymes, as shown
in FIG. 6B, and then fractionated on a 1 or 1.5% agarose gel. DNA
bands corresponding to the indicated digested sizes were recovered
from the gel. Ligation reaction included equal molar ratios of the
digested DNA fragments and the vector pED pre-digested with EcoRI
and Sall. A particular CDNA construction using various
amplification fragments was confirmed by DNA sequencing and is set
forth in FIG. 3. (SEQ ID NO: 3)
[0107] The predicted amino acid sequence (SEQ ID NO: 4) of the
aggrecanase of the present invention is set forth in FIG. 4. The
cloned sequence appears to have 3 TSP sub-motifs. A TSP sub-motif
is described as about 50 amino acids, it starts with signature
WXXXXW and contains six cysteine residues. The third sub-motif in
the sequence set forth in FIG. 4 consists of 41 amino acids, starts
with WXXXXW and contains 4 cysteins. It is therefore contemplated
that there are at least 10 additional amino acids, assuming that
there are no additional TSP submotifs. The majority of aggrecanase
of the invention is found in the three tissue sources: brain,
stomach, and thymus.
[0108] An aggrecanase molecule according to the invention as set
forth in FIG. 4 may be characterized as follows: The pre-pro region
signal-sequence, TABLE-US-00004 (SEQ ID NO: 13) LLQALQLCCLCCA- (SEQ
ID NO: 14) SVAAALASDSSSGASGLNDDYVFVTPVEVDSAGSYISHDILHNGRKKRSA |
(signal) | (mature peptide) 5 18
contains three conserved cysteine residues and a furin site. The
catalytic domain is characterized by a typical zinc binding motif.
It contains 5 conserved cysteine residues upstream of the zinc
binding sequence and three residues downstream of the zinc binding
sequence. It also contains a conserved methionine "Met-turn"
downstream of the zinc binding sequence. The Disintegrin-like
domain contains eight conserved cysteine residues. The TSP module
contains a heparin binding domain (WXXWXXW); a CD36-binding motif
(CSRTCGG) (SEQ ID NO: 15); and six conserved cysteine residues. The
cysteine-rich domain is characterized as containing ten conserved
cysteines. The spacer domain is characterized by TSP-repeats
wherein two and one half have been cloned. The N-terminal portion
of the aggrecanases can be cloned using the sequences described.
The TSP sub-motifs start with signature WXXXXW and contain six
cysteins. The third motif in FIG. 4 has 4 cysteines.
[0109] The ADAMTS-18 nucleotide sequence was extended beyond the
original sequence by 5' and 3' RACE. Thymus Marathon-Ready.TM. cDNA
was purchased from Clontech (Palo Alto, Calif.) for use as a
template in PCR cloning reactions. The antisense primer 5'
TGGTATGATTCACGACGGAGAAGGG (SEQ ID NO: 16) was used in a first round
5' RACE reaction and the sense primer 5.degree.
CGGGTCACCATCCTCACGTACTGTA (SEQ ID NO: 17) was used in the first
round 3' RACE reaction, both in combination with the AP-1 end
primers specific to the Marathon cDNAs. Clontech Advantage.TM. GC2
polymerase reagents (Clontech, Palo Alto, Calif.) were used
according to the manufacturer's recommendations. All amplifications
were carried out in a Perkin-Elmer 9600 thermocycler (Perkin Elmer,
Wellesley, Mass.). Cycling parameters were 94.degree. C. for 30
sec., 5 cycles of 94.degree. C. for 5 sec., 72.degree. C. for 4
mins., 5 cycles of 94.degree. C. for 5 sec, 70.degree. C. for 4
mins., 30 cycles of 94.degree. C. for 5 sec, 68.degree. C. for 4
min. The first round reactions were diluted 10 fold in TE, and 5
.mu.l of the reaction mixture was used as a template for a second
round of PCR. The antisense primer 5' AACCCTCGTGGTGGCAGACAAG (SEQ
ID NO: 18) was used for second round 5' RACE and the sense primer
5' TCATTCCAGCTGGCGCCCGAAGCAT (SEQ ID NO: 19) was used for second
round 3' RACE utilizing the identical parameters as described for
the first round, except with the AP-2 end primers specific to the
Marathon cDNAs. Aliquots of each reaction were fractionated on a 1%
agarose gel and then transfer to nitrocellulose for Southern
analysis. The nitrocellulose membrane was prehybridized in Clontech
ExpressHyb.TM. (Clontech, Palo Alto, Calif.) for 30 min. at
37.degree. C.according to the manufacture recommendations. The
membrane was then incubated with 1.times.106 CPM of .alpha.-ATP
end-labeled oligos 5' CTGCCTCTGCTGTGCGTCGGTCGC (SEQ ID NO: 11) (5'
RACE) or 5' GATAACTTTCCCAGAGCGAAGATGC (SEQ ID NO: 20) (3' RACE) at
37.degree. C.for 1 hour. Unbound probe was removed by two washes at
room temperature with 2.times.SSC/0.05% SDS followed by two
additional washes at room temperature with 0.1.times.SSC/0.1% SDS.
Duplicate agarose gels were un and the PCR products that
corresponded with positive signals on the autoradiographs were
excised out of the agarose gel and DNA was recovered from the gel
matrix via BioRad's Prep-A-Gene DNA purification System. (Biorad,
Hercules, Calif.). The recovered DNA was ligated into Stratagene's
PCR-Script.TM. Amp Cloning (Stratagene, La Jolla, Calif.) according
to the manufacturer's instructions.
[0110] An aliquot of the ligation mixtures were transformed into
Gibco, Technologies Electromax DH10B cells according to the
manufacturer's instructions. (Carlsbad, Calif.). Plasmid DNA was
subsequently isolated from the resulting recombinant bacteria and
the DNA was sequenced. In one experiment, the 5' RACE reactions
yielded a total of 1065 bases, 156 bases of the 5' UTR, followed by
a methionine that initiated the 909 base pairs of an open reading
frame ending in the sequence that is described as the second round
antisense primer (SEQ ID NO: 18). The 3' RACE reactions produced a
total of 2368 bases, 1358 bases of coding sequence beginning with
the sequence described as the second round sense primer (SEQ ID NO:
19), ending with a translational stop codon followed by 1007 base
pairs of 3' UTR.
Example 2
EST18 Tissue Expression
[0111] A Clontech human multiple tissue expression array MTE.TM.
(Clontech Catalog #: 7776-1) was probed with a 533 base pair
.alpha.-.sup.32P dCTP-labeled CDNA probe according to the
manufacturer's guidelines. Probe labeling and hybridization were
performed as follows: 5 .mu.g of Al 18FS plasmid (described below)
was digested with EcoRI enzyme in its optimal buffer according to
the vendor's recommendations. The restriction digest was
fractionated on a 1% agarose gel and a 533 base pair fragment
encoding EST18 protein sequence including amino acid #1
(methionine) through amino acid #174 (asparagine) of SEQ ID NO: 2
was recovered from the agarose gel as outlined above. An
.alpha.-.sup.32P dCTP-labeled probe was made utilizing Amersham
Pharmacia's Ready-To-Go kit (Catalog #: 27-9240-01, Pharmacia, ).
Briefly, 30 ng of heat-denatured DNA was incubated at 37.degree.
C.for 15 minutes with 50 .mu.Ci of .alpha.-.sup.32P dCTP and one
labeling bead. Following the incubation, the reaction mix was
applied to a pre-equilibrated Pharmacia NICK column (Catalog #:
17-0855-02) to remove unincorporated .alpha.-.sup.32P dCTP from the
labeled probe. The desalted probe was assayed and 15.times.10.sup.6
cpm was added to 5 ml of pre-warmed ExpressHyb. The hybridization
mix was then transferred to a prehybridized MTE. Hybridization was
allowed to proceed overnight with agitation at 65.degree. C.
[0112] Probe detection: Following hybridization, the MTE was washed
in a series of buffers accordingly to the manufacturer's
guidelines. The MTE was then placed in a X-ray cassette with Kodak
BioMax MS film (Kodak) and one intensifying screen. The cassette
was then stored at -70.degree. C. Individual films were developed
after either 20 or 76 hours. The results after either exposure were
identical. Expression was restricted to left and right cerebellum,
corpus callosum and placenta.
Example 3
Expression of a Truncated form the Aggrecanase Protein
[0113] A truncated form of protein encoded by the EST18 nucleotide
sequence was expressed as a fusion protein. One such truncated
protein, A18FS, refers to the first 650 amino acids, from amino
acid #1 (methionine) to amino acid #650 (phenylalanine) encoded by
the EST18 nucleotide sequence. The expression construct was
generated in two steps. First, the 5' end of EST18 nucleotide
sequence was modified to include the additional coding nucleotide
sequence identified by 5' RACE. Second, the construct had an open
reading frame, such that it ended at the codon for phenylalanine. A
Streptavidin-Tag sequence was added to aid in purification of the
recombinant protein.
[0114] Modification of the 5' end: The six synthetic
oligonucleotides listed below were designed to anneal together to
form a DNA sequence flanked by an EcoRI site on the 5' end and a
Sacl site on the 3' end. The cloned EST18 sequence was digested
with EcoRI and SacI enzymes. The digested vector was fractionated
on a 1% agarose gel and the recovered DNA was ligated with the
synthetic oligonucleotides. The oligonucleotides are depicted
below: TABLE-US-00005 (SEQ ID NO: 21) 5'
AATTCCCACCATGGAGTGCGCCCTCCTGCTCGCGTGTGCCT 3'; (SEQ ID NO: 22) 5'
CCCACCATGGAGTGCGCCCTCCTGCTCGCGTGTGCCTTCCCGGCTGC G 3'; (SEQ ID NO:
23) 5' TCCCGGCTGCGGGTTCGGGCCCGCCGAGGGGCCTGGCGGGACTGGGG CGCGTGGCCAAG
3'; (SEQ ID NO: 24) 5'
GGTTCGGGCCCGCCGAGGGGCCTGGCGGGACTGGGGCGCGTGGCCAA GGCGCTCCAGCT 3';
(SEQ ID NO: 25) 5' GCGCTCCAGCTGTGCTGCCTCTGCTGTGCGTCGGTCGCCGC 3';
and (SEQ ID NO: 26) 5' GTGCTGCCTCTGCTGTGCGTCGGTCGCC 3'.
[0115]
An aliquot of the ligation mix was transformed into Gibco Life
Technologies ElectroMax DH10B cells and the sequence of the
recombinant plasmid was confirmed by sequencing.
[0116] A18FS truncation and Streptavidin-Tagging: A18FS was PCR
amplified using the following primer pair TABLE-US-00006 Forward
primer (SEQ ID NO: 27) 5' CTCGCGGTTGAGGACAAACTCTTCG 3' and Reverse
primer (SEQ ID NO: 28) 5'
CCCTTGCAATGAAAATAGCTTGGATTTTGGAAGCGCTTGGAGCCACC
CGCAGTTCGAAAAATAAGGCGGCCGCCGCAAA 3'
and the EST18 nucleotide sequence as template. The forward primer
contained the unique restriction site BgIII and the reverse primer
contained the unique restriction sites NotI to allow for
directional cloning into the pre-digested expression vector. The
reverse primer also included the resulting protein sequence
GSAWSHPQFEK (SEQ ID NO: 29) that functions as an epitope tag.
[0117] PCR amplification was preformed in a 50 .mu.l volume
reaction containing: 5 .mu.l10.times. PCR reaction buffer; 1 .mu.l
dNTP mix up to the final concentration of 0.2 mM; 10 pmoles of the
forward primer (SEQ ID NO: 27; 10 pmoles of the reverse primer
((SEQ ID NO: 28); 1 ng of the EST18 full-length nucleotide template
as depicted in SEQ ID NO: 1; 2.5 units of the Stratagene Pfu Turbo
Hotstart polymerase (Catalog # 600320); and distilled H.sub.2O up
to 50 .mu.l. Amplification reaction conditions were 94.degree.
C.for 2 mins; 94.degree. C.for 15 secs; amplification at 70.degree.
C.for 3 mins for a total of 22 cycles; and extension at 72.degree.
C.for 5 mins followed by chilling at 4.degree. C. The nucleotide
sequence encoding the truncated form of aggrecanase protein
including a Streptavidin tag is disclosed in SEQ ID NO: 7.
Example 4
Expression of Aggrecanase in CHO cells
[0118] In order to produce murine, human or other mammalian
aggrecanase-related proteins, the DNA encoding an aggrecanase
protein is cloned into an appropriate expression vector and
introduced into mammalian cells or other preferred eukaryotic or
prokaryotic hosts, including insect host cell culture systems,
using conventional genetic engineering techniques. Expression
systems for biologically active recombinant human aggrecanase are
contemplated to include stably transformed mammalian, insect, yeast
or bacterial cells.
[0119] The mammalian expression vector pMT2 CXM is a derivative of
p91023(b) (Wong et al., Science 228:810-815 (1985)) and differs
from the latter in that it contains an ampicillin resistance gene
in place of a tetracycline resistance gene and further contains a
Xhol site for insertion of cDNA molecules into the vector. The
functional elements of pMT2 CXM have been described (Kaufman, Proc.
Natl. Acad. Sci. USA 82:689-693 (1985)) and include adenovirus VA
genes, the SV40 origin of replication including the 72 bp enhancer,
the adenovirus major late promoter including a 5' splice site and
majority of the adenovirus tripartite leader sequence present on
adenovirus late mRNAs, a 3' splice acceptor site, a DHFR insert,
the SV40 early polyadenylation site (SV40), and pBR322 sequences
needed for propagation in E. coli.
[0120] Plasmid pMT2 CXM was obtained by EcoRI digestion of
pMT2-VWF, which has been deposited with the American Type Culture
Collection (ATCC), Rockville, Md. (USA) under accession number ATCC
67122. EcoRI digestion excises the cDNA insert present in pMT2-VWF,
yielding pMT2 in linear form which can be ligated and used to
transform E. coli HB 101 or DH-5 which are then resistant to
ampicillin. Plasmid pMT2 DNA can be prepared by conventional
methods. pMT2 CXM is then constructed using loopout/in mutagenesis
technique (Morinaga, et al., Biotechnology 84: 636 (1984)). This
removes bases 1075 to 1145 relative to the Hind IlIl site near the
SV40 origin of replication and enhancer sequences of pMT2. In
addition it inserts the following sequence: 5.degree.
CATGGGCAGCTCGAG 3' (SEQ. ID NO: 30 ) at nucleotide 1145. This
sequence contains the recognition site for the restriction
endonuclease Xho I. A derivative of pMT2CXM, termed pMT23, contains
recognition sites for the restriction endonucleases Pstl, Eco RI,
Sall and Xhol. Plasmid pMT2 CXM and pMT23 DNA may be prepared by
conventional methods.
[0121] pEMC2.beta.1 derived from pMT21 may also be suitable in
practice of the invention. pMT21 was derived from pMT2 which is
derived from pMT2-VWF. As described above, EcoRI digestion excises
the cDNA insert present in pMT-VWF, yielding pMT2 in linear form
which subsequently can be ligated and used to transform E. Coli HB
101 or DH-5 resulting in ampicillin resistance. Plasmid pMT2 DNA
can be prepared by conventional methods.
[0122] pMT21 was derived from pMT2 through the following two
modifications. First, 76 bp of the 5' untranslated region of the
DHFR cDNA, including a stretch of 19 G residues from G/C tailing
for cDNA cloning, is deleted. In this process, a Xhol site was
inserted to obtain the following sequence immediately upstream from
DHFR: TABLE-US-00007 (SEQ. ID NO: 31) 5'
CTGCAGGCGAGCCTGAATTCCTCGAGCCATCATG 3' PstI Eco RI XhoI
[0123] Second, a unique Clal site was introduced by digestion with
EcoRV and Xbal, treatment with Klenow fragment of DNA polymerase I,
and ligation to a Clal linker (CATCGATG). This deletes a 250 bp
segment from the adenovirus associated RNA (VAI) region but does
not interfere with VAI RNA gene expression or function. pMT21 was
digested with EcoRI and Xhol, and used to derive the vector
pEMC2B1.
[0124] A portion of the EMCV leader was obtained from pMT2-ECAT1
(S.K. Jung, et al., J. Virol 63:1651-1660 (1989)) by digestion with
Eco RI and Pstl, resulting in a 2752 bp fragment. This fragment was
digested with Taql yielding an Eco RI-Taql fragment of 508 bp which
was isolated by electrophoresis on low melting agarose gel. A 68 bp
adapter and its complementary strand were synthesized with a 5'
Taql protruding end and a 3' Xhol protruding end which has the
following sequence: TABLE-US-00008 (SEQ. ID NO: 32) 5
CGAGGTTAAAAAACGTCTAGGCCCCCCGAACCACGGGGACGTGGTTTT TaqI
CCTTTGAAAAACACGATTGC 3' XhoI
[0125] This sequence matches the EMC virus leader sequence from
nucleotide 763 to 827. It also changes the ATG at position 10
within the EMC virus leader to an ATT and was followed by a Xhol
site. A three way ligation of the pMT21 Eco RI-Xhol fragment, the
EMC virus EcoRI-Taql fragment, and the 68 bp oligonucleotide
adapter Taql-Xhol adapter resulting in the vector pEMC2.beta.1.
[0126] This vector contains the SV40 origin of replication and
enhancer, the adenovirus major late promoter, a cDNA copy of the
majority of the adenovirus tripartite leader sequence, a small
hybrid intervening sequence, an SV40 polyadenylation signal and the
adenovirus VA I gene, DHFR and .beta.-lactamase markers and an EMC
sequence, in appropriate relationships to direct the high level
expression of the desired cDNA in mammalian cells.
[0127] In one example, the aggrecanase nucleotide sequence of the
present invention set forth in SEQ ID NO: 1 may be cloned into the
expression vector pED6 (Kaufman etal., Nucleic Acid Res
19:44885-4490 (1991)). COS and CHO DUKX B11 cells were transiently
transfected with the aggrecanase sequence of the invention
(+/-co-transfection of PACE on a separate pED6 plasmid) by
lipofection (LF2000, Invitrogen, Carlsbad, Calif.)). Duplicate
transfections were performed for each gene of interest: (a) one for
harvesting conditioned media for activity assay and (b) one for
.sup.35S methionine/cysteine metabolic labeling.
[0128] On day one, media was changed to DME(COS)or alpha(CHO)
media+1% heat-inactivated fetal calf serum+/-100 .mu.g/ml heparin
for one set of transfections (a) to be harvested for activity
assay. After 48 h (day 4), conditioned media was harvested for
activity assays.
[0129] On day 3, the medium for cells of the duplicate set of
transfections (b) was changed to MEM (methionine-free/cysteine
free) media+1% heat-inactivated fetal calf serum+100 .mu.g/ml
heparin+100 .mu.Ci/ml 35S-methioine/cysteine (Redivue.TM. Pro mix,
Amersham, Piscataway, N.J.). Following a 6 h incubation at
37.degree. C. conditioned media was harvested and run on SDS-PAGE
gels under reducing conditions. Proteins were visualized by
autoradiography.
[0130] In another example, the aggrecanase nucleotide sequence of
the present invention set forth in SEQ ID NO: 1 may be cloned into
expression vector pHTop, a derivative of pED (Kaufman et al., 1991
NAR 19:4485-4490) in which the majority of the adenomajor late
promoter was replaced by six repeats of the tet operator (described
in Gossen et al., 1992, Proc. Natl. Acad. Sci. USA 89:5547-5551).
This vector contains the dihydrofolate reductase gene and when
introduced in the cell line CHO/A2 (see description below)
functions very efficiently and high expressors can be selected by
isolating cells surviving in high methotrexate concentrations.
[0131] Similarly, the recombinant aggrecanase protein set forth in
SEQ ID NO: 8 and as expressed using a method described can be
cloned into a pHTop vector.
[0132] Establishment of CHO stable cell lines: The CHO/A2 cell line
was derived from CHO DUKX B11 (Urlaub and Chasin, 1980, Proc. Natl.
Acad. Sci. USA 77:4216-4220) by stably integrating a
transcriptional activator (tTA), a fusion protein between the Tet
repressor and the herpes virus VP16 transcriptional domain (Gossen
et aL., 1992, Proc. Natl. Acad. Sci. USA 89: 5547-5551). A CHO cell
line expressing extracellular ADAMTS-18 was established by
transfecting (lipofection) pHTopADAMTS8-Streptavidin tagged DNA
into CHO/A2 cells and selecting clones in 0.02, 0.05 and 0.01 .mu.M
methotrexate.
[0133] Screening of CHO stable cell lines: Multiple clones were
screened by Western Blot using a streptavidin HRP antibody. The
best clone was determined by virtue of its high expression and was
one which resulted from 0.02 .mu.M MTX selection and was chosen to
be scaled up for roller bottle conditioned media production (4
Liters). The cell line was sent for large scale production.
Example 5
Biological Activity of Expressed Aggrecanase
[0134] To measure the biological activity of the expressed
aggrecanase-related proteins, for example, proteins obtained in
Example 4 above, the proteins are recovered from the cell culture
and purified by isolating the aggrecanase-related proteins from
other proteinaceous materials with which they are co-produced as
well as from other contaminants. Purification is carried out using
standard techniques known to those skilled in the art. The isolated
protein may be assayed in accordance with the following assays:
[0135] Assays specifically to determine if the protein is an enzyme
capable of cleaving aggrecan at the aggrecanase cleavage site:
[0136] 1: Fluorescent peptide assay: Expressed protein is incubated
with a synthetic peptide which encompasses amino acids at the
aggrecanase cleavage site of aggrecan. Either the N-terminus or the
C-terminus of the synthetic peptide is labeled with a flourophore
and the other terminus includes a quencher. Cleavage of the peptide
separates the flourophore and quencher and elicits flourescence.
From this assay it is determined that the expressed aggrecanase
protein can cleave aggrecan at the aggrecanase site , and relative
fluorescence is a determination the relative activity of the
expressed protein.
[0137] 2. Neoepitope western: Expressed aggrecanase protein is
incubated with intact aggrecan. After several biochemical
manipulations of the resulting sample (dialysis, chondroitinase
treatment, lyophilization and reconstitution) the sample is run on
an SDS PAGE gel. The gel is incubated with an antibody that is
specific to a site on aggrecan which is only exposed after
aggrecanase cleavage. The gel is transferred onto nitrocellulose
paper and developed using a secondary antibody (called a western
assay) which subsequently results in a banding pattern indicative
of products with a molecular weight consistent with aggrecanase
generated cleavage products of aggrecan. This assay results in the
finding that the expressed aggrecanase protein cleaved native
aggrecan at the aggrecanase cleavage site, and also gives the
molecular weight of the cleavage products. Relative density of the
bands can give an indication of relative aggrecanase activity.
[0138] Assay to determine if an expressed protein can cleave
aggrecan anywhere in the protein (not specific to the aggrecanase
site):
[0139] 3. Aggrecan ELISA: Expressed protein is incubated with
intact aggrecan which had been previously adhered to plastic wells.
The wells are washed and then incubated with an antibody that
detects aggrecan. The wells are developed with a secondary
antibody. If the original amount of aggrecan remains in the wells,
the antibody staining is dense. Whereas, if aggrecan was digested
by aggrecanase activity of the expressed aggrecanase protein, the
aggrecan comes off the plate and the subsequent staining of the
aggrecan coated wells by the antibody is reduced. This assay tells
whether an expressed protein is capable of cleaving aggrecan
(anywhere in the protein, not only at the aggrecanase site) and can
further determine relative aggrecan cleavage.
[0140] Protein analysis of the isolated proteins is conducted using
standard techniques such as SDS-PAGE acrylamide (Laemmli, Nature
227:680 (1970)) stained with silver (Oakley, et al., Anal Biochem.
105:361 (1980)) and by immunoblot (Towbin, et al., Proc. Natl.
Acad. Sci. USA 76:4350 (1979)). Using the above described assays,
expressed aggrecanase-related proteins are evaluated for their
activity and useful aggrecanase-related molecules are
identified.
Example 6
Aggrecanase Activity of ADAMTS-18
[0141] Bovine articular cartilage was incubated with isolated
ADAMTS-18 for 16 h at 37.degree. C.in 50 mM Tris, pH 7.3,
containing 100 mM NaCl and 5 mM CaCl.sub.2. Digestion products were
deglycosylated by incubation for 2 h at 37.degree. C.in the
presence of chondroitinase ABC (Seikagaku America, Falmouth, MASS.,
1 mU/.mu.g aggrecan), keratinase (Seikagaku, 1 mU/.mu.g aggrecan)
and keratanase 11 (Seikagaku; 0.02 mU/.mu.g aggrecan). After
separation by SDS-PAGE, digestion products were transferred to
nitrocellulose and detected by Western immunoblotting with the
neoepitope (monoclonal) antibody AGG-C1 which recognizes the
C-terminal neoepitope sequence-NITEGE.sup.373 (SEQ ID NO: 33)
generated by cleavage of the aggrecanase-susceptible
E.sup.373-A.sup.374 peptide bond located between the G1 and G2
domains of aggrecan. (FIG. 10).
Example 7
Preparation of Antibodies
[0142] An antibody against a novel aggrecanase molecule is
prepared. To develop an antibody capable of inhibiting aggrecanase
activity, a group of mice are immunized every two weeks with a
novel aggrecanase protein mixed in Freunds complete adjuvant for
the first two immunizations, and incomplete Freunds adjuvant
thereafter. Throughout the immunization period, blood is sampled
and tested for the presence of circulating antibodies. At week 9,
an animal with circulating antibodies is selected, immunized for
three consecutive days, and sacrificed. The spleen is removed and
homogenized into cells. The spleen cells are fused to a myeloma
fusion partner (cell line P3-x63-Ag8.653-]) using 50% PEG 1500 by
an established procedure (Oi & Herzenberg, Selected Methods in
Cellular Immunology, W. J. Freeman Co., San Francisco, Calif., at
351 (1980)). The fused cells are plated into 96-well microtiter
plates at a density of 2.times.10.sup.5 cells/well. After 24 hours,
the cells are subjected to HAT selection (Littlefield, Science,
145: 709 (1964)) effectively killing any unfused and unproductively
fused myeloma cells.
[0143] Successfully fused hybridoma cells secreting
anti-aggrecanase antibodies are identified by solid and solution
phase ELISAs. Novel aggrecanase protein is prepared from CHO cells
as described above and coated on polystyrene (for solid phase
assays) or biotinylated plates (for a solution based assay).
Neutralizing assays are also employed where aggrecan is coated on a
polystyrene plate and biotin aggrecanase activity is inhibited by
the addition of hybridoma supernatant. Results identify hybridomas
expressing aggrecanase antibodies. These positive clones are
cultured and expanded for further study. These cultures remain
stable when expanded and cell lines are cloned by limiting dilution
techniques and subsequently cryopreserved.
[0144] From these cell cultures, a panel of antibodies is developed
that specifically recognize aggrecanase proteins. Isotype of the
antibodies is determined using a mouse immunoglobulin isotyping kit
(Zymed.TM. Laboratories, Inc., San. Francisco, Calif.).
Example 8
Method of Detecting Level of Aggrecanase
[0145] An anti-aggrecanase antibody prepared according to the
invention as described, can be used to detect level of aggrecanases
in a sample. An antibody can be used in an ELISA, for example, to
identify the presence or absence, or quantify the amount of, an
aggrecanase in a sample, to which the antibody binds. The antibody
can be labeled with a fluorescent tag. In general, the level of
aggrecanase in a sample can be determined using any of the assays
disclosed.
Example 9
Method of Treating a Patient
[0146] Antibodies developed according to methods disclosed can be
administered to patients suffering from a disease or disorder
related to the loss of aggrecan, or an increase in aggrecanase
activity. Patients may need to take a composition of the invention
as a once time administration or at intervals, such as once daily,
until the symptoms and signs of their disease or disorder improve.
For example, subsequent to the administration of a composition of
the invention to a patient, loss of aggrecan decreases or ceases
and degradation of articular cartilage decreases or ceases. It is
expected that symptoms of osteoarthritis would be reduced or
eliminated. This would show that compositions of the invention
would be useful for the treatment of diseases or disorders related
to the loss of aggrecan, or an increase in the levels and/or
activity of aggrecanases. Antibodies can also be used with patients
that are susceptible to osteoarthritis, such as those who have a
family history or markers of the disease, but are asymptomatic. The
following results would be expected for treatment of patients.
TABLE-US-00009 Route of Patient's Condition Administration Dosage
Frequency Predicted Results Osteoarthritis Subcutaneous 500
.mu.g/kg Daily Decrease symptoms '' '' 1 mg/kg Weekly Decrease in
symptoms '' Intramuscular 500 .mu.g/kg Daily Decrease in symptoms
'' '' 1 mg/kg Weekly Decrease in symptoms '' Intravenous 500
.mu.g/kg Daily Decrease in symptoms '' '' 1 mg/kg Weekly Decrease
in symptoms Family History of Subcutaneous 500 .mu.g/kg Daily
Prevention Osteoarthritis of condition Family History of
Intramuscular 500 .mu.g/kg Daily Prevention Osteoarthritis of
condition Family History of Intravenous 500 .mu.g/kg Daily
Prevention Osteoarthritis of condition
[0147] The foregoing descriptions detail presently preferred
embodiments of the present invention. Numerous modifications and
variations in practice thereof are expected to occur to those
skilled in the art upon consideration of these descriptions. Those
modifications and variations are believed to be encompassed within
the claims appended hereto. All of the documents cited in this
application are incorporated by reference in their entirety.
Additionally, all sequences cited in databases and all references
disclosed are incorporated by reference in their entirety.
Sequence CWU 1
1
32 1 3663 DNA Homo sapiens 1 atggagtgcg ccctcctgct cgcgtgtgcc
ttcccggctg cgggttcggg cccgccgagg 60 ggcctggcgg gactggggcg
cgtggccaag gcgctccagc tgtgctgcct ctgctgtgcg 120 tcggtcgccg
cggccttagc cagtgacagc agcagcggcg ccagcggatt aaatgatgat 180
tacgtctttg tcacgccagt agaagtagac tcagccgggt catatatttc acacgacatt
240 ttgcacaacg gcaggaaaaa gcgatcggcg cagaatgcca gaagctccct
gcactaccga 300 ttttcagcat ttggacagga actgcactta gaacttaagc
cctcggcgat tttgagcagt 360 cactttattg tccaggtact tggaaaagat
ggtgcttcag agactcagaa acccgaggtg 420 cagcaatgct tctatcaggg
atttatcaga aatgacagct cctcctctgt cgctgtgtct 480 acgtgtgctg
gcttgtcagg tttaataagg acacgaaaaa atgaattcct catctcgcca 540
ttacctcagc ttctggccca ggaacacaac cacagctccc ctgcgggtca ccatcctcac
600 gtactgtaca aaaggacagc agaggagaag atccagcggt accgtggcta
ccccggctct 660 ggccggaatt atcctggtta ctccccaagt cacattcccc
atgcatctca gagtcgagag 720 acagagtatc accatcgaag gttgcaaaag
cagcattttt gtggacgacg caagaaatat 780 gctcccaagc ctcccacaga
ggacacctat ctaaggtttg atgaatatgg gagctctggg 840 cgacccagaa
gatcagctgg aaaatcacaa aagggcctca atgtggaaac cctcgtggtg 900
gcagacaaga aaatggtgga aaagcatggc aagggaaatg tcaccacata cattctcaca
960 gtaatgaaca tggtttctgg cctatttaaa gatgggacta ttggaagtga
cataaacgtg 1020 gttgtggtga gcctaattct tctggaacaa gaacctggag
gattattgat caaccatcat 1080 gcagaccagt ctctgaatag tttttgtcaa
tggcagtctg ccctcattgg aaagaatggc 1140 aagagacatg atcatgccat
cttactaaca ggatttgata tttgttcttg gaagaatgaa 1200 ccatgtgaca
ctctagggtt tgcccccatc agtggaatgt gctctaagta ccgaagttgt 1260
accatcaatg aggacacagg acttggcctt gccttcacca tcgctcatga gtcagggcac
1320 aactttggta tgattcacga cggagaaggg aatccctgca gaaaggctga
aggcaatatc 1380 atgtctccca cactgaccgg aaacaatgga gtgttttcat
ggtcttcttg cagccgccag 1440 tatctcaaga aattcctcag cacacctcag
gcggggtgtc tagtggatga gcccaagcaa 1500 gcaggacagt ataaatatcc
ggacaaacta ccaggacaga tttatgatgc tgacacacag 1560 tgtaaatggc
aatttggagc aaaagccaag ttatgcagcc ttggttttgt gaaggatatt 1620
tgcaaatcac tttggtgcca ccgagtaggc cacaggtgtg agaccaagtt tatgcccgca
1680 gcagaaggga ccgtttgtgg cttgagtatg tggtgtcggc aaggccagtg
cgtaaagttt 1740 ggggagctcg ggccccggcc catccacggc cagtggtccg
cctggtcgaa gtggtcagaa 1800 tgttcccgga catgtggtgg aggagtcaag
ttccaggaga gacactgcaa taaccccaag 1860 cctcagtatg gtggcatatt
ctgtccaggt tctagccgta tttatcagct gtgcaatatt 1920 aacccttgca
atgaaaatag cttggatttt cgggcccaac agtgtgcaga atataacagc 1980
aaacctttcc gtggatggtt ctaccagtgg aaaccctata caaaagtgga agaggaagat
2040 cgatgcaaac tgtactgcaa ggctgagaac tttgaatttt tttttgcaat
gtccggcaaa 2100 gtgaaagatg gaactccctg ctccccaaac agaaatgatg
tttgtattga cggggtttgt 2160 gaactagtgg gatgtgatca tgaactaggc
tctaaagcag tttcagatgc ttgtggcgtt 2220 tgcaaaggtg ataattcaac
ttgcaagttt tataaaggcc tgtacctcaa ccagcataaa 2280 gcaaatgaat
attatccggt ggtcatcatt ccagctggcg cccgaagcat cgaaatccag 2340
gagctgcagg tttcctccag ttacctcgca gttcgaagcc tcagtcaaaa gtattacctc
2400 accgggggct ggagcatcga ctggcctggg gagttcccct tcgctgggac
cacgtttgaa 2460 taccagcgct ctttcaaccg cccggaacgt ctgtacgcgc
cagggcccac aaatgagacg 2520 ctggtctttg aaattctgat gcaaggcaaa
aatccaggga tagcttggaa gtatgcactt 2580 cccaaggtca tgaatggaac
tccaccagcc acaaaaagac ctgcctatac ctggagtatc 2640 gtgcagtcag
agtgctccgt ctcctgtggt ggaggttaca taaatgtaaa ggccatttgc 2700
ttgcgagatc aaaatactca agtcaattcc tcattctgca gtgcaaaaac caagccagta
2760 actgagccca aaatctgcaa cgctttctcc tgcccggctt actggatgcc
aggtgaatgg 2820 agtacatgta gcaaggcctg tgctggaggc cagcagagcc
gaaagatcca gtgtgtgcaa 2880 aagaagccct tccaaaagga ggaagcagtg
ttgcattctc tctgtccagt gagcacaccc 2940 actcaggtcc aagcctgcaa
cagccatgcc tgtcctccac aatggagcct tggaccctgg 3000 tctcagtgtt
ccaagacctg tggacgaggg gtgaggaagc gtgaactcct ctgcaagggc 3060
tctgccgcag aaaccctccc cgagagccag tgtaccagtc tccccagacc tgagctgcag
3120 gagggctgtg tgcttggacg atgccccaag aacagccggc tacagtgggt
cgcttcttcg 3180 tggagcgagt gttctgcaac ctgtggtttg ggtgtgagga
agagggagat gaagtgcagc 3240 gagaagggct tccagggaaa gctgataact
ttcccagagc gaagatgccg taatattaag 3300 aaaccaaatc tggacttgga
agagacctgc aaccgacggg cttgcccagc ccatccagtg 3360 tacaacatgg
tagctggatg gtattcattg ccgtggcagc agtgcacagt cacctgtggg 3420
ggaggggtcc agacccggtc agtccactgt gttcagcaag gccggccttc ctcaagttgt
3480 ctgctccatc agaaacctcc ggtgctacga gcctgtaata caaacttctg
tccagctcct 3540 gaaaagagag aggatccatc ctgcgtagat ttcttcaact
ggtgtcacct agttcctcag 3600 catggtgtct gcaaccacaa gttttacgga
aaacaatgct gcaagtcatg cacaaggaag 3660 atc 3663 2 1221 PRT Homo
sapiens 2 Met Glu Cys Ala Leu Leu Leu Ala Cys Ala Phe Pro Ala Ala
Gly Ser 1 5 10 15 Gly Pro Pro Arg Gly Leu Ala Gly Leu Gly Arg Val
Ala Lys Ala Leu 20 25 30 Gln Leu Cys Cys Leu Cys Cys Ala Ser Val
Ala Ala Ala Leu Ala Ser 35 40 45 Asp Ser Ser Ser Gly Ala Ser Gly
Leu Asn Asp Asp Tyr Val Phe Val 50 55 60 Thr Pro Val Glu Val Asp
Ser Ala Gly Ser Tyr Ile Ser His Asp Ile 65 70 75 80 Leu His Asn Gly
Arg Lys Lys Arg Ser Ala Gln Asn Ala Arg Ser Ser 85 90 95 Leu His
Tyr Arg Phe Ser Ala Phe Gly Gln Glu Leu His Leu Glu Leu 100 105 110
Lys Pro Ser Ala Ile Leu Ser Ser His Phe Ile Val Gln Val Leu Gly 115
120 125 Lys Asp Gly Ala Ser Glu Thr Gln Lys Pro Glu Val Gln Gln Cys
Phe 130 135 140 Tyr Gln Gly Phe Ile Arg Asn Asp Ser Ser Ser Ser Val
Ala Val Ser 145 150 155 160 Thr Cys Ala Gly Leu Ser Gly Leu Ile Arg
Thr Arg Lys Asn Glu Phe 165 170 175 Leu Ile Ser Pro Leu Pro Gln Leu
Leu Ala Gln Glu His Asn His Ser 180 185 190 Ser Pro Ala Gly His His
Pro His Val Leu Tyr Lys Arg Thr Ala Glu 195 200 205 Glu Lys Ile Gln
Arg Tyr Arg Gly Tyr Pro Gly Ser Gly Arg Asn Tyr 210 215 220 Pro Gly
Tyr Ser Pro Ser His Ile Pro His Ala Ser Gln Ser Arg Glu 225 230 235
240 Thr Glu Tyr His His Arg Arg Leu Gln Lys Gln His Phe Cys Gly Arg
245 250 255 Arg Lys Lys Tyr Ala Pro Lys Pro Pro Thr Glu Asp Thr Tyr
Leu Arg 260 265 270 Phe Asp Glu Tyr Gly Ser Ser Gly Arg Pro Arg Arg
Ser Ala Gly Lys 275 280 285 Ser Gln Lys Gly Leu Asn Val Glu Thr Leu
Val Val Ala Asp Lys Lys 290 295 300 Met Val Glu Lys His Gly Lys Gly
Asn Val Thr Thr Tyr Ile Leu Thr 305 310 315 320 Val Met Asn Met Val
Ser Gly Leu Phe Lys Asp Gly Thr Ile Gly Ser 325 330 335 Asp Ile Asn
Val Val Val Val Ser Leu Ile Leu Leu Glu Gln Glu Pro 340 345 350 Gly
Gly Leu Leu Ile Asn His His Ala Asp Gln Ser Leu Asn Ser Phe 355 360
365 Cys Gln Trp Gln Ser Ala Leu Ile Gly Lys Asn Gly Lys Arg His Asp
370 375 380 His Ala Ile Leu Leu Thr Gly Phe Asp Ile Cys Ser Trp Lys
Asn Glu 385 390 395 400 Pro Cys Asp Thr Leu Gly Phe Ala Pro Ile Ser
Gly Met Cys Ser Lys 405 410 415 Tyr Arg Ser Cys Thr Ile Asn Glu Asp
Thr Gly Leu Gly Leu Ala Phe 420 425 430 Thr Ile Ala His Glu Ser Gly
His Asn Phe Gly Met Ile His Asp Gly 435 440 445 Glu Gly Asn Pro Cys
Arg Lys Ala Glu Gly Asn Ile Met Ser Pro Thr 450 455 460 Leu Thr Gly
Asn Asn Gly Val Phe Ser Trp Ser Ser Cys Ser Arg Gln 465 470 475 480
Tyr Leu Lys Lys Phe Leu Ser Thr Pro Gln Ala Gly Cys Leu Val Asp 485
490 495 Glu Pro Lys Gln Ala Gly Gln Tyr Lys Tyr Pro Asp Lys Leu Pro
Gly 500 505 510 Gln Ile Tyr Asp Ala Asp Thr Gln Cys Lys Trp Gln Phe
Gly Ala Lys 515 520 525 Ala Lys Leu Cys Ser Leu Gly Phe Val Lys Asp
Ile Cys Lys Ser Leu 530 535 540 Trp Cys His Arg Val Gly His Arg Cys
Glu Thr Lys Phe Met Pro Ala 545 550 555 560 Ala Glu Gly Thr Val Cys
Gly Leu Ser Met Trp Cys Arg Gln Gly Gln 565 570 575 Cys Val Lys Phe
Gly Glu Leu Gly Pro Arg Pro Ile His Gly Gln Trp 580 585 590 Ser Ala
Trp Ser Lys Trp Ser Glu Cys Ser Arg Thr Cys Gly Gly Gly 595 600 605
Val Lys Phe Gln Glu Arg His Cys Asn Asn Pro Lys Pro Gln Tyr Gly 610
615 620 Gly Ile Phe Cys Pro Gly Ser Ser Arg Ile Tyr Gln Leu Cys Asn
Ile 625 630 635 640 Asn Pro Cys Asn Glu Asn Ser Leu Asp Phe Arg Ala
Gln Gln Cys Ala 645 650 655 Glu Tyr Asn Ser Lys Pro Phe Arg Gly Trp
Phe Tyr Gln Trp Lys Pro 660 665 670 Tyr Thr Lys Val Glu Glu Glu Asp
Arg Cys Lys Leu Tyr Cys Lys Ala 675 680 685 Glu Asn Phe Glu Phe Phe
Phe Ala Met Ser Gly Lys Val Lys Asp Gly 690 695 700 Thr Pro Cys Ser
Pro Asn Arg Asn Asp Val Cys Ile Asp Gly Val Cys 705 710 715 720 Glu
Leu Val Gly Cys Asp His Glu Leu Gly Ser Lys Ala Val Ser Asp 725 730
735 Ala Cys Gly Val Cys Lys Gly Asp Asn Ser Thr Cys Lys Phe Tyr Lys
740 745 750 Gly Leu Tyr Leu Asn Gln His Lys Ala Asn Glu Tyr Tyr Pro
Val Val 755 760 765 Ile Ile Pro Ala Gly Ala Arg Ser Ile Glu Ile Gln
Glu Leu Gln Val 770 775 780 Ser Ser Ser Tyr Leu Ala Val Arg Ser Leu
Ser Gln Lys Tyr Tyr Leu 785 790 795 800 Thr Gly Gly Trp Ser Ile Asp
Trp Pro Gly Glu Phe Pro Phe Ala Gly 805 810 815 Thr Thr Phe Glu Tyr
Gln Arg Ser Phe Asn Arg Pro Glu Arg Leu Tyr 820 825 830 Ala Pro Gly
Pro Thr Asn Glu Thr Leu Val Phe Glu Ile Leu Met Gln 835 840 845 Gly
Lys Asn Pro Gly Ile Ala Trp Lys Tyr Ala Leu Pro Lys Val Met 850 855
860 Asn Gly Thr Pro Pro Ala Thr Lys Arg Pro Ala Tyr Thr Trp Ser Ile
865 870 875 880 Val Gln Ser Glu Cys Ser Val Ser Cys Gly Gly Gly Tyr
Ile Asn Val 885 890 895 Lys Ala Ile Cys Leu Arg Asp Gln Asn Thr Gln
Val Asn Ser Ser Phe 900 905 910 Cys Ser Ala Lys Thr Lys Pro Val Thr
Glu Pro Lys Ile Cys Asn Ala 915 920 925 Phe Ser Cys Pro Ala Tyr Trp
Met Pro Gly Glu Trp Ser Thr Cys Ser 930 935 940 Lys Ala Cys Ala Gly
Gly Gln Gln Ser Arg Lys Ile Gln Cys Val Gln 945 950 955 960 Lys Lys
Pro Phe Gln Lys Glu Glu Ala Val Leu His Ser Leu Cys Pro 965 970 975
Val Ser Thr Pro Thr Gln Val Gln Ala Cys Asn Ser His Ala Cys Pro 980
985 990 Pro Gln Trp Ser Leu Gly Pro Trp Ser Gln Cys Ser Lys Thr Cys
Gly 995 1000 1005 Arg Gly Val Arg Lys Arg Glu Leu Leu Cys Lys Gly
Ser Ala Ala Glu 1010 1015 1020 Thr Leu Pro Glu Ser Gln Cys Thr Ser
Leu Pro Arg Pro Glu Leu Gln 1025 1030 1035 1040 Glu Gly Cys Val Leu
Gly Arg Cys Pro Lys Asn Ser Arg Leu Gln Trp 1045 1050 1055 Val Ala
Ser Ser Trp Ser Glu Cys Ser Ala Thr Cys Gly Leu Gly Val 1060 1065
1070 Arg Lys Arg Glu Met Lys Cys Ser Glu Lys Gly Phe Gln Gly Lys
Leu 1075 1080 1085 Ile Thr Phe Pro Glu Arg Arg Cys Arg Asn Ile Lys
Lys Pro Asn Leu 1090 1095 1100 Asp Leu Glu Glu Thr Cys Asn Arg Arg
Ala Cys Pro Ala His Pro Val 1105 1110 1115 1120 Tyr Asn Met Val Ala
Gly Trp Tyr Ser Leu Pro Trp Gln Gln Cys Thr 1125 1130 1135 Val Thr
Cys Gly Gly Gly Val Gln Thr Arg Ser Val His Cys Val Gln 1140 1145
1150 Gln Gly Arg Pro Ser Ser Ser Cys Leu Leu His Gln Lys Pro Pro
Val 1155 1160 1165 Leu Arg Ala Cys Asn Thr Asn Phe Cys Pro Ala Pro
Glu Lys Arg Glu 1170 1175 1180 Asp Pro Ser Cys Val Asp Phe Phe Asn
Trp Cys His Leu Val Pro Gln 1185 1190 1195 1200 His Gly Val Cys Asn
His Lys Phe Tyr Gly Lys Gln Cys Cys Lys Ser 1205 1210 1215 Cys Thr
Arg Lys Ile 1220 3 3219 DNA Homo sapiens 3 atgtcacctt ttctcttgca
ggcgctccag ctgtgctgcc tctgctgtgc gtcggtcgcc 60 gcggccttag
ccagtgacag cagcagcggc gccagcggat taaatgatga ttacgtcttt 120
gtcacgccag tagaagtaga ctcagccggg tcatatattt cacacgacat tttgcacaac
180 ggcaggaaaa agcgatcggc gcagaatgcc agaagctccc tgcactaccg
attttcagca 240 tttggacagg aactgcactt agaacttaag ccctcggcga
ttttgagcag tcactttatt 300 gtccaggtac ttggaaaaga tggtgcttca
gagactcaga aacccgaggt gcagcaatgc 360 ttctatcagg gatttatcag
aaatgacagc tcctcctctg tcgctgtgtc tacgtgtgct 420 ggcttgtcag
gtttaataag gacacgaaaa aatgaattcc tcatctcgcc attacctcag 480
cttctggccc aggaacacaa ccacagctcc cctgcgggtc accatcctca cgtactgtac
540 aaaaggacag cagaggagaa gatccagcgg taccgtggct accccggctc
tggccggaat 600 tatcctggtt actccccaag tcacattccc catgcatctc
agagtcgaga gacagagtat 660 caccatcgaa ggttgcaaaa gcagcatttt
tgtggacgac gcaagaaata tgctcccaag 720 cctcccacag aggacaccta
tctaaggttt gatgaatatg ggagctctgg gcgacccaga 780 agatcagctg
gaaaatcaca aaagggcctc aatgtggaaa ccctcgtggt ggcagacaag 840
aaaatggtgg aaaagcatgg caagggaaat gtcaccacat acattctcac agtaatgaac
900 atggtttctg gcctatttaa agatgggact attggaagtg acataaacgt
ggttgtggtg 960 agcctaattc ttctggaaca agaacctgga ggattattga
tcaaccatca tgcagaccag 1020 tctctgaata gtttttgtca atggcagtct
gccctcattg gaaagaatgg caagagacat 1080 gatcatgcca tcttactaac
aggatttgat atttgttctt ggaagaatga accatgtgac 1140 actctagggt
ttgcccccat cagtggaatg tgctctaagt accgaagttg taccatcaat 1200
gaggacacag gacttggcct tgccttcacc atcgctcatg agtcagggca caactttggt
1260 atgattcacg acggagaagg gaatccctgc agaaaggctg aaggcaatat
catgtctccc 1320 acactgaccg gaaacaatgg agtgttttca tggtcttctt
gcagccgcca gtatctcaag 1380 aaattcctca gcacacctca ggcggggtgt
ctagtggatg agcccaagca agcaggacag 1440 tataaatatc cggacaaact
accaggacag atttatgatg ctgacacaca gtgtaaatgg 1500 caatttggag
caaaagccaa gttatgcagc cttggttttg tgaaggatat ttgcaaatca 1560
ctttggtgcc accgagtagg ccacaggtgt gagaccaagt ttatgcccgc agcagaaggg
1620 accgtttgtg gcttgagtat gtggtgtcgg caaggccagt gcgtaaagtt
tggggagctc 1680 gggccccggc ccatccacgg ccagtggtcc gcctggtcga
agtggtcaga atgttcccgg 1740 acatgtggtg gaggagtcaa gttccaggag
agacactgca ataaccccaa gcctcagtat 1800 ggtggcatat tctgtccagg
ttctagccgt atttatcagc tgtgcaatat taacccttgc 1860 aatgaaaata
gcttggattt tcgggcccaa cagtgtgcag aatataacag caaacctttc 1920
cgtggatggt tctaccagtg gaaaccctat acaaaagtgg aagaggaaga tcgatgcaaa
1980 ctgtactgca aggctgagaa ctttgaattt ttttttgcaa tgtccggcaa
agtgaaagat 2040 ggaactccct gctccccaaa cagaaatgat gtttgtattg
acggggtttg tgaactagtg 2100 ggatgtgatc atgaactagg ctctaaagca
gtttcagatg cttgtggcgt ttgcaaaggt 2160 gataattcaa cttgcaagtt
ttataaaggc ctgtacctca accagcataa agcaaatgaa 2220 tattatccgg
tggtcatcat tccagctggc gcccgaagca tcgaaatcca ggagctgcag 2280
gtttcctcca gttacctcgc agttcgaagc ctcagtcaaa agtattacct caccgggggc
2340 tggagcatcg actggcctgg ggagttcccc ttcgctggga ccacgtttga
ataccagcgc 2400 tctttcaacc gcccggaacg tctgtacgcg ccagggccca
caaatgagac gctggtcttt 2460 gaaattctga tgcaaggcaa aaatccaggg
atagcttgga agtatgcact tcccaaggtc 2520 atgaatggaa ctccaccagc
cacaaaaaga cctgcctata cctggagtat cgtgcagtca 2580 gagtgctccg
tctcctgtgg tggaggttac ataaatgtaa aggccatttg cttgcgagat 2640
caaaatactc aagtcaattc ctcattctgc agtgcaaaaa ccaagccagt aactgagccc
2700 aaaatctgca acgctttctc ctgcccggct tactggatgc caggtgaatg
gagtacatgt 2760 agcaaggcct gtgctggagg ccagcagagc cgaaagatcc
agtgtgtgca aaagaagccc 2820 ttccaaaagg aggaagcagt gttgcattct
ctctgtccag tgagcacacc cactcaggtc 2880 caagcctgca acagccatgc
ctgtcctcca caatggagcc ttggaccctg gtctcagtgt 2940 tccaagacct
gtggacgagg ggtgaggaag cgtgaactcc tctgcaaggg ctctgccgca 3000
gaaaccctcc ccgagagcca gtgtaccagt ctccccagac ctgagctgca ggagggctgt
3060 gtgcttggac gatgccccaa gaacagccgg ctacagtggg tcgcttcttc
gtggagcgag 3120 tgttctgcaa cctgtggttt gggtgtgagg aagagggaga
tgaagtgcag cgagaagggc 3180 ttccagggaa agctgataac tttcccagag
cgaagatgc 3219 4 1071 PRT Homo sapiens 4 Met Ser Pro Phe Leu Leu
Gln Ala Leu Gln Leu Cys Cys Leu Cys Cys 1 5 10 15 Ala Ser Val Ala
Ala Ala Leu Ala Ser Asp Ser Ser Ser Gly Ala Ser 20 25 30 Gly Leu
Asn Asp Asp Tyr Val Phe Val Thr Pro Val Glu Val Asp Ser 35 40 45
Ala Gly Ser Tyr Ile Ser His Asp Ile Leu His Asn Gly Arg Lys Lys 50
55 60 Arg Ser Ala Gln Asn Ala Arg Ser Ser Leu His Tyr Arg Phe Ser
Ala 65 70 75 80 Phe Gly
Gln Glu Leu His Leu Glu Leu Lys Pro Ser Ala Ile Leu Ser 85 90 95
Ser His Phe Ile Val Gln Val Leu Gly Lys Asp Gly Ala Ser Glu Thr 100
105 110 Gln Lys Pro Glu Val Gln Gln Cys Phe Tyr Gln Gly Phe Ile Arg
Asn 115 120 125 Asp Ser Ser Ser Ser Val Ala Val Ser Thr Cys Ala Gly
Leu Ser Gly 130 135 140 Leu Ile Arg Thr Arg Lys Asn Glu Phe Leu Ile
Ser Pro Leu Pro Gln 145 150 155 160 Leu Leu Ala Gln Glu His Asn His
Ser Ser Pro Ala Gly His His Pro 165 170 175 His Val Leu Tyr Lys Arg
Thr Ala Glu Glu Lys Ile Gln Arg Tyr Arg 180 185 190 Gly Tyr Pro Gly
Ser Gly Arg Asn Tyr Pro Gly Tyr Ser Pro Ser His 195 200 205 Ile Pro
His Ala Ser Gln Ser Arg Glu Thr Glu Tyr His His Arg Arg 210 215 220
Leu Gln Lys Gln His Phe Cys Gly Arg Arg Lys Lys Tyr Ala Pro Lys 225
230 235 240 Pro Pro Thr Glu Asp Thr Tyr Leu Arg Phe Asp Glu Tyr Gly
Ser Ser 245 250 255 Gly Arg Pro Arg Arg Ser Ala Gly Lys Ser Gln Lys
Gly Leu Asn Val 260 265 270 Glu Thr Leu Val Val Ala Asp Lys Lys Met
Val Glu Lys His Gly Lys 275 280 285 Gly Asn Val Thr Thr Tyr Ile Leu
Thr Val Met Asn Met Val Ser Gly 290 295 300 Leu Phe Lys Asp Gly Thr
Ile Gly Ser Asp Ile Asn Val Val Val Val 305 310 315 320 Ser Leu Ile
Leu Leu Glu Gln Glu Pro Gly Gly Leu Leu Ile Asn His 325 330 335 His
Ala Asp Gln Ser Leu Asn Ser Phe Cys Gln Trp Gln Ser Ala Leu 340 345
350 Ile Gly Lys Asn Gly Lys Arg His Asp His Ala Ile Leu Leu Thr Gly
355 360 365 Phe Asp Ile Cys Ser Trp Lys Asn Glu Pro Cys Asp Thr Leu
Gly Phe 370 375 380 Ala Pro Ile Ser Gly Met Cys Ser Lys Tyr Arg Ser
Cys Thr Ile Asn 385 390 395 400 Glu Asp Thr Gly Leu Gly Leu Ala Phe
Thr Ile Ala His Glu Ser Gly 405 410 415 His Asn Phe Gly Met Ile His
Asp Gly Glu Gly Asn Pro Cys Arg Lys 420 425 430 Ala Glu Gly Asn Ile
Met Ser Pro Thr Leu Thr Gly Asn Asn Gly Val 435 440 445 Phe Ser Trp
Ser Ser Cys Ser Arg Gln Tyr Leu Lys Lys Phe Leu Ser 450 455 460 Thr
Pro Gln Ala Gly Cys Leu Val Asp Glu Pro Lys Gln Ala Gly Gln 465 470
475 480 Tyr Lys Tyr Pro Asp Lys Leu Pro Gly Gln Ile Tyr Asp Ala Asp
Thr 485 490 495 Gln Cys Lys Trp Gln Phe Gly Ala Lys Ala Lys Leu Cys
Ser Leu Gly 500 505 510 Phe Val Lys Asp Ile Cys Lys Ser Leu Trp Cys
His Arg Val Gly His 515 520 525 Arg Cys Glu Thr Lys Phe Met Pro Ala
Ala Glu Gly Thr Val Cys Gly 530 535 540 Leu Ser Met Trp Cys Arg Gln
Gly Gln Cys Val Lys Phe Gly Leu Gly 545 550 555 560 Pro Arg Pro Ile
His Gly Gln Trp Ser Ala Trp Ser Lys Trp Ser Glu 565 570 575 Cys Ser
Arg Thr Cys Gly Gly Gly Val Lys Phe Gln Glu Arg His Cys 580 585 590
Asn Asn Pro Lys Pro Gln Tyr Gly Gly Ile Phe Cys Pro Gly Ser Ser 595
600 605 Arg Ile Tyr Gln Leu Cys Asn Ile Asn Pro Cys Asn Glu Asn Ser
Leu 610 615 620 Asp Phe Arg Ala Gln Gln Cys Ala Glu Tyr Asn Ser Lys
Pro Phe Arg 625 630 635 640 Gly Trp Phe Tyr Gln Trp Lys Pro Tyr Thr
Lys Val Glu Glu Glu Asp 645 650 655 Arg Cys Lys Leu Tyr Cys Lys Ala
Glu Asn Phe Glu Phe Phe Phe Ala 660 665 670 Met Ser Gly Lys Val Lys
Asp Gly Thr Pro Cys Ser Pro Asn Arg Asn 675 680 685 Asp Val Cys Ile
Asp Gly Val Cys Glu Leu Val Gly Cys Asp His Glu 690 695 700 Leu Gly
Ser Lys Ala Val Ser Asp Ala Cys Gly Val Cys Gly Asp Asn 705 710 715
720 Ser Thr Cys Lys Phe Tyr Lys Gly Leu Tyr Leu Asn Gln His Lys Ala
725 730 735 Asn Glu Tyr Tyr Pro Val Val Ile Ile Pro Ala Gly Ala Arg
Ser Ile 740 745 750 Glu Ile Gln Glu Leu Gln Val Ser Ser Ser Tyr Leu
Ala Val Arg Ser 755 760 765 Leu Ser Gln Lys Tyr Tyr Leu Thr Gly Gly
Trp Ser Ile Asp Trp Pro 770 775 780 Gly Glu Phe Pro Phe Ala Gly Thr
Thr Phe Glu Tyr Gln Arg Ser Phe 785 790 795 800 Asn Arg Pro Glu Arg
Leu Tyr Ala Pro Gly Pro Thr Asn Glu Thr Leu 805 810 815 Val Phe Glu
Ile Leu Met Gln Gly Lys Asn Pro Gly Ile Ala Trp Lys 820 825 830 Tyr
Ala Leu Pro Lys Val Met Asn Gly Thr Pro Pro Ala Thr Lys Arg 835 840
845 Pro Ala Tyr Thr Trp Ser Ile Val Gln Ser Glu Cys Ser Val Ser Cys
850 855 860 Gly Gly Gly Tyr Ile Asn Val Lys Ala Ile Cys Leu Arg Asp
Gln Asn 865 870 875 880 Thr Gln Val Asn Ser Ser Phe Cys Ser Ala Lys
Thr Lys Pro Val Thr 885 890 895 Glu Pro Lys Ile Cys Asn Ala Phe Ser
Cys Pro Ala Tyr Trp Met Pro 900 905 910 Gly Glu Trp Ser Thr Cys Ser
Lys Ala Cys Ala Gly Gly Gln Gln Ser 915 920 925 Arg Lys Ile Gln Cys
Val Gln Lys Lys Pro Phe Gln Lys Glu Glu Ala 930 935 940 Val Leu His
Ser Leu Cys Pro Val Ser Thr Pro Thr Gln Val Gln Ala 945 950 955 960
Cys Asn Ser His Ala Cys Pro Pro Gln Trp Ser Leu Gly Pro Trp Ser 965
970 975 Gln Cys Ser Lys Thr Cys Gly Arg Gly Val Arg Lys Arg Glu Leu
Leu 980 985 990 Cys Lys Gly Ser Ala Ala Glu Thr Leu Pro Glu Ser Gln
Cys Thr Ser 995 1000 1005 Leu Pro Arg Pro Glu Leu Gln Glu Gly Cys
Val Leu Gly Arg Cys Pro 1010 1015 1020 Lys Asn Ser Arg Leu Gln Trp
Val Ala Ser Ser Trp Ser Glu Cys Ser 1025 1030 1035 1040 Ala Thr Cys
Gly Leu Gly Val Arg Lys Arg Glu Met Lys Cys Ser Glu 1045 1050 1055
Lys Gly Phe Gln Gly Lys Leu Ile Thr Phe Pro Glu Arg Arg Cys 1060
1065 1070 5 3954 DNA Homo sapiens 5 atgtcacctt ttctcttgca
ggcgctccag ctgtgctgcc tctgctgtgc gtcggtcgcc 60 gcggccttag
ccagtgacag cagcagcggc gccagcggat taaatgatgg ttcgtatttg 120
ccccccatcc ccaagaaggg cctttcgcag cactttgacc cttccttccc ccaaagagag
180 aaaagatgga aaagcgcacc ccctaacctg gcagattacg tctttgtcac
gccagtagaa 240 gtagactcag ccgggtcata tatttcacac gacattttgc
acaacggcag gaaaaagcga 300 tcggcgcaga atgccagaag ctccctgcac
taccgatttt cagcatttgg acaggaactg 360 cacttagaac ttaagccctc
ggcgattttg agcagtcact ttattgtcca ggtacttgga 420 aaagatggtg
cttcagagac tcagaaaccc gaggtgcagc aatgcttcta tcagggattt 480
atcagaaatg acagctcctc ctctgtcgct gtgtctacgt gtgctggctt gatgatcccc
540 aaggaaatta acttgatgga tgccattcgc tttgtaatgt cccgggagac
caggcattct 600 ataaatctaa caagcttcat gcgtctacat ggctttgaaa
tgggaaaact gtatttcaat 660 gcgaaattgc attcagcagc actgtttaat
aaaggaaaga aaagcttcac ctatggggga 720 ctcagagtca ttgtcctcaa
ggtgtctgaa caggaccttc agtggaaacg agactgcctg 780 aacctctctg
ggagagttgt ttttgctttg tggaatgcat cacaccatct catggcttta 840
catatgaatt cctcatctcg ccattacctc agcttctggc ccaggaacac aactacagct
900 cccctgcggg tcaccatcct cacgtactgt acaaaaggac agcagaggag
aagatccagc 960 ggtaccgtgg ctaccccggc tctggccgga attatcctgg
ttactcccca agtcacattc 1020 cccatgcatc tcagagtcga gagacagagt
atcaccatcg aaggttgcaa aagcagcatt 1080 tttgtggacg acgcaagaaa
tgtattttct ctctcaactg tcttatccag atattctcta 1140 atatcccttc
caaatgctct tctgttcatc gtagatgctc ccaagcctcc cacagaggac 1200
acctatctaa ggtttgatga atatgggagc tctgggcgac ccagaagatc agctggaaaa
1260 tcacaaaagg gcctcaatgt ggaaaccctc gtggtggcag acaagaaaat
ggtggaaaag 1320 catggcaagg gaaatgtcac cacatacatt ctcacagtaa
tgaacatggt ttctggccta 1380 tttaaagatg ggactattgg aagtgacata
aacgtggttg tggtgagcct aattcttctg 1440 gaacaagaac ctggaggatt
attgatcaac catcatgcag accagtctct gaatagtttt 1500 tgtcaatggc
agtctgccct cattggaaag aatggcaaga gacatgatca tgccatctta 1560
ctaacaggat ttgatatttg ttcttggaag aatgaaccat gtgacactct agggtttgcc
1620 cccatcagtg gaatgtgctc taagtaccga agttgtacca tcaatgagga
cacaggactt 1680 ggccttgcct tcaccatcgc tcatgagtca gggcacaact
ttggtatgat tcacgacgga 1740 gaagggaatc cctgcagaaa ggctgaaggc
aatatcatgt ctcccacact gaccggaaac 1800 aatggagtgt tttcatggtc
ttcctgcagc cgccagtatc tcaagaaatt cctcagcaca 1860 cctcaggcgg
ggtgtctagt ggatgagccc aagcaagcag gacagtataa atatccggac 1920
aaactaccag gacagattta tgatgctgac acacagtgta aatggcaatt tggagcaaaa
1980 gccaagttat gcagccttgg ttttgtgaag tggtgtcggc aaggccagtg
cgtaaagttt 2040 ggggagctcg ggccccggcc catccacggc cagtggtccg
cctggtcgaa gtggtcagaa 2100 tgttcccgga catgtggtgg aggagtcaag
ttccaggaga gacactgcaa taaccccaat 2160 aacaatcaac cagagtttta
ctgtttgcat ataaagtcca tgtgcaccga gggaaggtat 2220 ggtgggcaga
aaccaaaaca cagcagagga gtcattctct acgggactgt gatgatccag 2280
cctcagtatg gtggcttatt ctgtccaggt tctagccgta tttatcagct gtgcaatatt
2340 aacccttgca atgaaaatag cttggatttt cgggctcaac agtgtgcaga
atataacagc 2400 aaacctttcc gtggatggtt ctaccagtgg aaaccctata
caaaagtgga agaggaagat 2460 cgatgcaaac tgtactgcaa ggctgagaac
tttgaatttt tttttgcaat gtccggcaaa 2520 gtgaaagatg gaactccctg
ctccccaaac aaaaatgatg tttgtattga cggggtttgt 2580 gaactagtgg
gatgtgatca tgaactaggc tctaaagcag tttcagatgc ttgtggcgtt 2640
tgcaaaggtg ataattcaac ttgcaagttt tataaaggcc tgtacctcaa ccagcataaa
2700 gcaaatgaat attatccggt ggtcctcatt ccagctggcg cccgaagcat
cgaaatccag 2760 gagctgcagg tttcctccag ttacctcgca gttcgaagcc
tcagtcaaaa gtattacctc 2820 accgggggct ggagcatcga ctggcctggg
gagttcccct tcgctgggac cacgtttgaa 2880 taccagcgct ctttcaaccg
cccggaacgt ctgtacgcgc cagggcccac aaatgagacg 2940 ctggtctttg
aagtaagccc cttctgtgta ttcagttctc agtgcttctt gctacattta 3000
tatcgtatgg atatcccctc aggggtaagg tcagcaaagg ttctctcact agaggaatgg
3060 attaaatctg agacaaccct tgcaaggaag gaacaacagc aaccatctac
tggctggatg 3120 ccaggtgaat ggagtacatg cagcaagtcc tgtgctggag
gccagcagag ccgaaagatc 3180 cagtgtgtgc aaaagaagcc cttccaaaag
gaggaagcag tgttgcattc tctctgtcca 3240 gtaagcacac ccactcaggt
ccaagcctgc aacagccatg cctgccctcc acaatggagc 3300 cttggaccct
ggtctcagtg ttccaagacc tgtggacgag gggtgaggaa gcgtgaactc 3360
ctctgcaagg gctctgccgc agaaaccctc cccgagagcc agtgtaccag tctccccaga
3420 cctgagctgc aggagggctg tgtgcttgga cgatgcccca agaacagccg
gctacagtgg 3480 gtcgcttctt cgtggagcga gtgttctgca acctgtggtt
tgggtgtgag gaagagggag 3540 atgaagtgca gcgagaaggg cttccaggga
aagctgataa ctttcccaga gcgaagatgc 3600 cgtaatatta agaaaccaaa
tctggacttg gaagagacct gcaaccgacg ggcttgccca 3660 gcccatccag
tgtacaacat ggtagctgga tggtattcat tgccgtggca gcagtgcaca 3720
gtcacctgtg ggggaggggt ccagacccgg tcagtccact gtgttcagca aggccggcct
3780 tcctcaagtt gtctgctcca tcagaaacct ccggtgctac gagcctgtaa
tacaaacttc 3840 tgtccagctc ctgaaaagag agatcttaat tccttgaata
cctctatggt ctccactggt 3900 gctgagggtc aacacctaag acggttttcg
tcagtcaccc ctggatctgg gtga 3954 6 11 PRT Artificial Sequence
Description of Artificial Sequence Synthetic zinc binding signature
peptide sequence 6 Thr Ala Ala His Glu Leu Gly His Val Lys Phe 1 5
10 7 1986 DNA Homo sapiens 7 atggagtgcg ccctcctgct cgcgtgtgcc
ttcccggctg cgggttcggg cccgccgagg 60 ggcctggcgg gactggggcg
cgtggccaag gcgctccagc tgtgctgcct ctgctgtgcg 120 tcggtcgccg
cggccttagc cagtgacagc agcagcggcg ccagcggatt aaatgatgat 180
tacgtctttg tcacgccagt agaagtagac tcagccgggt catatatttc acacgacatt
240 ttgcacaacg gcaggaaaaa gcgatcggcg cagaatgcca gaagctccct
gcactaccga 300 ttttcagcat ttggacagga actgcactta gaacttaagc
cctcggcgat tttgagcagt 360 cactttattg tccaggtact tggaaaagat
ggtgcttcag agactcagaa acccgaggtg 420 cagcaatgct tctatcaggg
atttatcaga aatgacagct cctcctctgt cgctgtgtct 480 acgtgtgctg
gcttgtcagg tttaataagg acacgaaaaa atgaattcct catctcgcca 540
ttacctcagc ttctggccca ggaacacaac cacagctccc ctgcgggtca ccatcctcac
600 gtactgtaca aaaggacagc agaggagaag atccagcggt accgtggcta
ccccggctct 660 ggccggaatt atcctggtta ctccccaagt cacattcccc
atgcatctca gagtcgagag 720 acagagtatc accatcgaag gttgcaaaag
cagcattttt gtggacgacg caagaaatat 780 gctcccaagc ctcccacaga
ggacacctat ctaaggtttg atgaatatgg gagctctggg 840 cgacccagaa
gatcagctgg aaaatcacaa aagggcctca atgtggaaac cctcgtggtg 900
gcagacaaga aaatggtgga aaagcatggc aagggaaatg tcaccacata cattctcaca
960 gtaatgaaca tggtttctgg cctatttaaa gatgggacta ttggaagtga
cataaacgtg 1020 gttgtggtga gcctaattct tctggaacaa gaacctggag
gattattgat caaccatcat 1080 gcagaccagt ctctgaatag tttttgtcaa
tggcagtctg ccctcattgg aaagaatggc 1140 aagagacatg atcatgccat
cttactaaca ggatttgata tttgttcttg gaagaatgaa 1200 ccatgtgaca
ctctagggtt tgcccccatc agtggaatgt gctctaagta ccgaagttgt 1260
accatcaatg aggacacagg acttggcctt gccttcacca tcgctcatga gtcagggcac
1320 aactttggta tgattcacga cggagaaggg aatccctgca gaaaggctga
aggcaatatc 1380 atgtctccca cactgaccgg aaacaatgga gtgttttcat
ggtcttcttg cagccgccag 1440 tatctcaaga aattcctcag cacacctcag
gcggggtgtc tagtggatga gcccaagcaa 1500 gcaggacagt ataaatatcc
ggacaaacta ccaggacaga tttatgatgc tgacacacag 1560 tgtaaatggc
aatttggagc aaaagccaag ttatgcagcc ttggttttgt gaaggatatt 1620
tgcaaatcac tttggtgcca ccgagtaggc cacaggtgtg agaccaagtt tatgcccgca
1680 gcagaaggga ccgtttgtgg cttgagtatg tggtgtcggc aaggccagtg
cgtaaagttt 1740 ggggagctcg ggccccggcc catccacggc cagtggtccg
cctggtcgaa gtggtcagaa 1800 tgttcccgga catgtggtgg aggagtcaag
ttccaggaga gacactgcaa taaccccaag 1860 cctcagtatg gtggcatatt
ctgtccaggt tctagccgta tttatcagct gtgcaatatt 1920 aacccttgca
atgaaaatag cttggatttt ggaagcgctt ggagccaccc gcagttcgaa 1980 aaataa
1986 8 661 PRT Homo sapiens 8 Met Glu Cys Ala Leu Leu Leu Ala Cys
Ala Phe Pro Ala Ala Gly Ser 1 5 10 15 Gly Pro Pro Arg Gly Leu Ala
Gly Leu Gly Arg Val Ala Lys Ala Leu 20 25 30 Gln Leu Cys Cys Leu
Cys Cys Ala Ser Val Ala Ala Ala Leu Ala Ser 35 40 45 Asp Ser Ser
Ser Gly Ala Ser Gly Leu Asn Asp Asp Tyr Val Phe Val 50 55 60 Thr
Pro Val Glu Val Asp Ser Ala Gly Ser Tyr Ile Ser His Asp Ile 65 70
75 80 Leu His Asn Gly Arg Lys Lys Arg Ser Ala Gln Asn Ala Arg Ser
Ser 85 90 95 Leu His Tyr Arg Phe Ser Ala Phe Gly Gln Glu Leu His
Leu Glu Leu 100 105 110 Lys Pro Ser Ala Ile Leu Ser Ser His Phe Ile
Val Gln Val Leu Gly 115 120 125 Lys Asp Gly Ala Ser Glu Thr Gln Lys
Pro Glu Val Gln Gln Cys Phe 130 135 140 Tyr Gln Gly Phe Ile Arg Asn
Asp Ser Ser Ser Ser Val Ala Val Ser 145 150 155 160 Thr Cys Ala Gly
Leu Ser Gly Leu Ile Arg Thr Arg Lys Asn Glu Phe 165 170 175 Leu Ile
Ser Pro Leu Pro Gln Leu Leu Ala Gln Glu His Asn His Ser 180 185 190
Ser Pro Ala Gly His His Pro His Val Leu Tyr Lys Arg Thr Ala Glu 195
200 205 Glu Lys Ile Gln Arg Tyr Arg Gly Tyr Pro Gly Ser Gly Arg Asn
Tyr 210 215 220 Pro Gly Tyr Ser Pro Ser His Ile Pro His Ala Ser Gln
Ser Arg Glu 225 230 235 240 Thr Glu Tyr His His Arg Arg Leu Gln Lys
Gln His Phe Cys Gly Arg 245 250 255 Arg Lys Lys Tyr Ala Pro Lys Pro
Pro Thr Glu Asp Thr Tyr Leu Arg 260 265 270 Phe Asp Glu Tyr Gly Ser
Ser Gly Arg Pro Arg Arg Ser Ala Gly Lys 275 280 285 Ser Gln Lys Gly
Leu Asn Val Glu Thr Leu Val Val Ala Asp Lys Lys 290 295 300 Met Val
Glu Lys His Gly Lys Gly Asn Val Thr Thr Tyr Ile Leu Thr 305 310 315
320 Val Met Asn Met Val Ser Gly Leu Phe Lys Asp Gly Thr Ile Gly Ser
325 330 335 Asp Ile Asn Val Val Val Val Ser Leu Ile Leu Leu Glu Gln
Glu Pro 340 345 350 Gly Gly Leu Leu Ile Asn His His Ala Asp Gln Ser
Leu Asn Ser Phe 355 360 365 Cys Gln Trp Gln Ser Ala Leu Ile Gly Lys
Asn Gly Lys Arg His Asp 370 375 380 His Ala Ile Leu Leu Thr Gly Phe
Asp Ile Cys Ser Trp Lys Asn Glu 385 390 395 400 Pro Cys Asp Thr Leu
Gly Phe Ala Pro Ile Ser Gly Met Cys Ser Lys 405 410 415 Tyr Arg Ser
Cys Thr Ile Asn Glu Asp Thr Gly Leu Gly Leu Ala Phe 420 425 430 Thr
Ile Ala His Glu Ser Gly His Asn Phe Gly Met Ile His Asp Gly
435 440 445 Glu Gly Asn Pro Cys Arg Lys Ala Glu Gly Asn Ile Met Ser
Pro Thr 450 455 460 Leu Thr Gly Asn Asn Gly Val Phe Ser Trp Ser Ser
Cys Ser Arg Gln 465 470 475 480 Tyr Leu Lys Lys Phe Leu Ser Thr Pro
Gln Ala Gly Cys Leu Val Asp 485 490 495 Glu Pro Lys Gln Ala Gly Gln
Tyr Lys Tyr Pro Asp Lys Leu Pro Gly 500 505 510 Gln Ile Tyr Asp Ala
Asp Thr Gln Cys Lys Trp Gln Phe Gly Ala Lys 515 520 525 Ala Lys Leu
Cys Ser Leu Gly Phe Val Lys Asp Ile Cys Lys Ser Leu 530 535 540 Trp
Cys His Arg Val Gly His Arg Cys Glu Thr Lys Phe Met Pro Ala 545 550
555 560 Ala Glu Gly Thr Val Cys Gly Leu Ser Met Trp Cys Arg Gln Gly
Gln 565 570 575 Cys Val Lys Phe Gly Glu Leu Gly Pro Arg Pro Ile His
Gly Gln Trp 580 585 590 Ser Ala Trp Ser Lys Trp Ser Glu Cys Ser Arg
Thr Cys Gly Gly Gly 595 600 605 Val Lys Phe Gln Glu Arg His Cys Asn
Asn Pro Lys Pro Gln Tyr Gly 610 615 620 Gly Ile Phe Cys Pro Gly Ser
Ser Arg Ile Tyr Gln Leu Cys Asn Ile 625 630 635 640 Asn Pro Cys Asn
Glu Asn Ser Leu Asp Phe Gly Ser Ala Trp Ser His 645 650 655 Pro Gln
Phe Glu Lys 660 9 41 DNA Artificial Sequence Description of
Artificial Sequence Primer 9 taaatcgaat tcccaccatg tcaccttttc
tcttgcaggc g 41 10 25 DNA Artificial Sequence Description of
Artificial Sequence Primer 10 cagcttcacc agtcttacaa gggcc 25 11 24
DNA Artificial Sequence Description of Artificial Sequence Primer
11 ctgcctctgc tgtgcgtcgg tcgc 24 12 25 DNA Artificial Sequence
Description of Artificial Sequence Primer 12 ctattgaaag ggtctcgctt
ctacg 25 13 13 PRT Artificial Sequence Description of Artificial
Sequence Synthetic pre-pro signal peptide sequence 13 Leu Leu Gln
Ala Leu Gln Leu Cys Cys Leu Cys Cys Ala 1 5 10 14 50 PRT Artificial
Sequence Description of Artificial Sequence Synthetic pre-pro
signal peptide sequence 14 Ser Val Ala Ala Ala Leu Ala Ser Asp Ser
Ser Ser Gly Ala Ser Gly 1 5 10 15 Leu Asn Asp Asp Tyr Val Phe Val
Thr Pro Val Glu Val Asp Ser Ala 20 25 30 Gly Ser Tyr Ile Ser His
Asp Ile Leu His Asn Gly Arg Lys Lys Arg 35 40 45 Ser Ala 50 15 7
PRT Artificial Sequence Description of Artificial Sequence
Synthetic CD36-binding motif 15 Cys Ser Arg Thr Cys Gly Gly 1 5 16
25 DNA Artificial Sequence Description of Artificial Sequence
Primer 16 tggtatgatt cacgacggag aaggg 25 17 25 DNA Artificial
Sequence Description of Artificial Sequence Primer 17 cgggtcacca
tcctcacgta ctgta 25 18 22 DNA Artificial Sequence Description of
Artificial Sequence Primer 18 aaccctcgtg gtggcagaca ag 22 19 25 DNA
Artificial Sequence Description of Artificial Sequence Primer 19
tcattccagc tggcgcccga agcat 25 20 25 DNA Artificial Sequence
Description of Artificial Sequence Primer 20 gataactttc ccagagcgaa
gatgc 25 21 41 DNA Artificial Sequence Description of Artificial
Sequence Synthetic oligonucleotide 21 aattcccacc atggagtgcg
ccctcctgct cgcgtgtgcc t 41 22 48 DNA Artificial Sequence
Description of Artificial Sequence Synthetic oligonucleotide 22
cccaccatgg agtgcgccct cctgctcgcg tgtgccttcc cggctgcg 48 23 59 DNA
Artificial Sequence Description of Artificial Sequence Synthetic
oligonucleotide 23 tcccggctgc gggttcgggc ccgccgaggg gcctggcggg
actggggcgc gtggccaag 59 24 59 DNA Artificial Sequence Description
of Artificial Sequence Synthetic oligonucleotide 24 ggttcgggcc
cgccgagggg cctggcggga ctggggcgcg tggccaaggc gctccagct 59 25 41 DNA
Artificial Sequence Description of Artificial Sequence Synthetic
oligonucleotide 25 gcgctccagc tgtgctgcct ctgctgtgcg tcggtcgccg c 41
26 28 DNA Artificial Sequence Description of Artificial Sequence
Synthetic oligonucleotide 26 gtgctgcctc tgctgtgcgt cggtcgcc 28 27
25 DNA Artificial Sequence Description of Artificial Sequence
Primer 27 ctcgcggttg aggacaaact cttcg 25 28 79 DNA Artificial
Sequence Description of Artificial Sequence Primer 28 cccttgcaat
gaaaatagct tggattttgg aagcgcttgg agccacccgc agttcgaaaa 60
ataaggcggc cgccgcaaa 79 29 11 PRT Artificial Sequence Description
of Artificial Sequence Synthetic peptide sequence 29 Gly Ser Ala
Trp Ser His Pro Gln Phe Glu Lys 1 5 10 30 15 DNA Artificial
Sequence Description of Artificial Sequence Primer 30 catgggcagc
tcgag 15 31 34 DNA Artificial Sequence Description of Artificial
Sequence Primer 31 ctgcaggcga gcctgaattc ctcgagccat catg 34 32 68
DNA Artificial Sequence Description of Artificial Sequence Primer
32 cgaggttaaa aaacgtctag gccccccgaa ccacggggac gtggttttcc
tttgaaaaac 60 acgattgc 68
* * * * *