U.S. patent application number 11/531583 was filed with the patent office on 2007-01-18 for integrin binding motif containing peptides and methods of treating skeletal diseases.
This patent application is currently assigned to Acologix, Inc.. Invention is credited to Russell Wayne Blacher, Yoshinari Kumagai, Motoyoshi Nomizu, Toshiyuki Yoneda.
Application Number | 20070014742 11/531583 |
Document ID | / |
Family ID | 27093672 |
Filed Date | 2007-01-18 |
United States Patent
Application |
20070014742 |
Kind Code |
A1 |
Kumagai; Yoshinari ; et
al. |
January 18, 2007 |
INTEGRIN BINDING MOTIF CONTAINING PEPTIDES AND METHODS OF TREATING
SKELETAL DISEASES
Abstract
Peptide sequences comprising 10 to 50 amino acids are disclosed.
The sequences are characterized by containing at least one of an
integrin binding motif such as an RGD sequence, a glycosaminoglycan
binding motif, and a calcium binding motif, and the remainder of
amino acids contiguous with the RGD sequence in matrix
extracellular phosphoglycoprotein. The sequences may be formulated
for injection or dispersed in toothpaste or a mouthwash or gum
patch and administered to enhance bone/tooth growth and/or reduce
excessive urinary phosphate loss from the body.
Inventors: |
Kumagai; Yoshinari;
(Hayward, CA) ; Yoneda; Toshiyuki; (San Antonio,
TX) ; Blacher; Russell Wayne; (Hayward, CA) ;
Nomizu; Motoyoshi; (Tokyo, JP) |
Correspondence
Address: |
BOZICEVIC, FIELD & FRANCIS LLP
1900 UNIVERSITY AVENUE
SUITE 200
EAST PALO ALTO
CA
94303
US
|
Assignee: |
Acologix, Inc.
|
Family ID: |
27093672 |
Appl. No.: |
11/531583 |
Filed: |
September 13, 2006 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
11042492 |
Jan 24, 2005 |
|
|
|
11531583 |
Sep 13, 2006 |
|
|
|
09812485 |
Mar 19, 2001 |
6911425 |
|
|
11042492 |
Jan 24, 2005 |
|
|
|
09641034 |
Aug 16, 2000 |
|
|
|
09812485 |
Mar 19, 2001 |
|
|
|
Current U.S.
Class: |
424/50 ;
514/16.7; 514/19.1; 514/20.9 |
Current CPC
Class: |
A61K 8/64 20130101; A61P
19/10 20180101; C07K 14/78 20130101; A61K 38/06 20130101; A61Q
11/00 20130101; A61K 38/16 20130101; A61K 38/08 20130101; A61P
19/08 20180101; A61K 38/12 20130101; C07K 14/4728 20130101; C07K
14/4705 20130101; C07K 14/47 20130101; A61P 19/00 20180101; C07K
14/705 20130101; A61K 38/1709 20130101; A61P 3/12 20180101; A61P
3/00 20180101 |
Class at
Publication: |
424/050 ;
514/014; 514/018 |
International
Class: |
A61K 38/10 20070101
A61K038/10; A61K 38/06 20070101 A61K038/06; A61K 8/66 20060101
A61K008/66 |
Claims
1.-13. (canceled)
14. A formulation, comprising: a carrier; and a peptide compound
comprising at least 10 and not more than 50 naturally occurring
amino acids the peptide compound comprising an integrin binding
motif, a glycosaminoglycan binding motif, and a calcium binding
motif.
15. The peptide compound of claim 14, wherein the integrin binding
motif is an RGD sequence.
16. The peptide compound of claim 14, wherein the glycosaminoglycan
motif has the sequence SGDG.
17. The peptide compound of claim 14, wherein the calcium binding
motif has the sequence DXDXSXFXGXXQ, wherein X is any amino
acid.
18. The peptide compound of claim 17, wherein the calcium binding
motif has the sequence DNDISPFSGDGQ.
19. A multimer of the peptide of claim 14.
20. The formulation according to claim 14, wherein the carrier is a
saline solution and the formulation is injectable.
21. The formulation according to claim 14, wherein the carrier is a
paste and the formulation is a toothpaste.
22. The formulation according to claim 14, wherein the carrier is
an aqueous flavored solution and the formulation is a
mouthwash.
23. A patch for oral delivery of a compound, said patch comprising
a formulation according to claim 14
24. A method of reducing bone loss, comprising administering to an
individual an effective amount of a peptidic compound according to
claim 14.
25. A method of reducing renal phosphate excretion in an
individual, comprising administering to an individual an effective
amount of a peptidic compound according to claim 14.
26. The formulation of claim 14, wherein the peptide comprises an
amino acid sequence contiguous with a RGD sequence of naturally
occurring matrix extracellular phosphoglycoprotein.
Description
CROSS-REFERENCE
[0001] This application is a continuation-in-part application of
Ser. No. 09/641,034, filed Aug. 16, 2000, which is incorporated
herein by reference in its entirety and to which application we
claim priority under 35 USC .sctn. 120.
FIELD OF THE INVENTION
[0002] The invention relates generally to the field of peptides and
more particularly to peptides and formulations thereof useful in
treating skeletal diseases.
BACKGROUND OF THE INVENTION
[0003] It is well-documented that disorders of skeletal tissues and
mineral metabolism cause numerous significant health problems on
world-wide basis.
[0004] In humans, the maximum bone mass occurs between the age of
15 and 40 and is referred to as "peak bone mass." After such peak
bone mass age, bone mass begins declining gradually and the
mechanical strength of the bone is accordingly reduced.
Consequently, when mechanical strength declines to a certain level,
the individual is at greater risk of bone fracture. This natural
occurrence is called osteoporosis if severe enough to be
pathogenic.
[0005] The speed at which bone loss occurs differs among
individuals, and especially with respect to gender. In females, the
speed of bone loss accelerates immediately after menopause (See
FIG. 1) because of a significant decline in available estrogen, a
hormone which plays a critical role in maintaining healthy bone
metabolism. Postmenopausal osteoporosis constitutes an important
clinical problem because it afflicts significant numbers of women.
Notably, the ratio of female to male osteoporosis patients is
3:1.
[0006] The majority of bone diseases are characterized by loss of
bone minerals, weakening of bones and consequently, an increase of
the frequency and severity of bone fractures, which are called
"pathological fracture." In the elderly population, this has
significant social ramifications as well, as many of those with
bone fractures have difficulty with mobility, which often leads to
the deterioration of other mental and physical functions, resulting
in dementia, muscular weakness and/or fatigue. In addition,
morbidity and pain are significantly increased by thrombotic
events, such as pulmonary embolism which can occur as a result of
hip or pelvic fractures.
[0007] In the United States alone, it is said that 52 million women
over age of 45 will suffer from osteoporosis by 2000. Current
worldwide osteoporosis population is around 200 million. Annual
incidence of pathological fracture in the United States alone is
approximately 1.5 million. It is estimated that annual medical
costs for those osteoporosis patients in the United States and
world are $ 14 billion and $60 billion, respectively.
[0008] Renal failure is also a significant health problem related
to mineral metabolism and skeletal formation, and the number of its
patients is increasing rapidly. Renal function is declining
gradually over several to ten years period in these patients. When
the renal function becomes approximately a quarter (1/4) of the
healthy level, the patients are classified to chronic renal
failure. When it becomes approximately one sixth (1/6) thereof,
they need to start dialysis and are called end stage renal disease
(ESRD). In patients with chronic renal failure, serum levels of
important minerals such as calcium and phosphate lose their normal
homeostasis, which results in malformation of skeleton. It is
called renal osteodystrophy (ROD), which is a secondary
osteoporosis from renal failure. ROD can also cause pathological
fracture like osteoporosis. The prevalence of end stage renal
disease (ESRD) in the United States is rapidly increasing and about
to reach 300 thousand in 2000. ROD affects most ESRD patients.
[0009] There are several other diseases of skeletal tissues and
mineral metabolism such as Paget's Disease, rickets, osteopetrosis,
hyperparathyroidism, and so forth and a number of patients are
affected by these diseases.
[0010] Metabolically, bone is a highly active organ with bone
resorption and formation occurring continuously (remodeling). Bone
resorption is facilitated by osteoclasts which are differentiated
from monocyte/macrophage lineage cells. Osteoclasts adhere to the
surface of bone and degrade bone tissue by secreting acids and
enzymes. Osteoblasts facilitate bone formation by adhering to
degraded bone tissue and secreting bone matrix proteins, which are
mineralized mostly by calcium and phosphate. Osteoblasts
differentiate into bone cells (osteocytes), and become a part of
bone tissue.
[0011] Numerous experimental approaches have been attempted to
either accelerate bone formation or diminish bone resorption. For
example, growth factors such as BMPs (bone morphogenetic proteins),
TGF.beta. (transforming growth factor .beta.), IGF (insulin-like
growth factor), and fibroblast growth factor (FGF) are known to
have potent biological activities in bone formation. In particular,
a few subfamily molecules of BMP such as BMP-2 is regarded as one
of the most potent growth factors for hard tissue. However, these
factors have not been developed as therapeutic agents for systemic
bone diseases. It is because none of them can be delivered to the
bone selectively and some of these factors such as BMPs convert
soft tissue into hard tissue. It is called ectopic calcification
and is a critical adverse effect for them when they are used
systemically. Further, the processes of bone formation and
resorption are so closely connected and that makes selective
increase of bone formation or selective inhibition of bone
resorption extremely difficult.
[0012] Currently, there is a need for an effective treatment for
bone loss. Therapeutic agents such as estrogen, calcitonin, vitamin
D, fluoride, Ipriflavon, bisphosphonates, and a few others have
failed to provide a satisfactory means of treatment. (Gennari et
al., Dru Saf. (1994)11(3)179-95).
[0013] Estrogen and its analogues are frequently administered to
patients with postmenopausal osteoporosis. Estrogen replacement
therapy involves administration of estrogen just prior to or after
the onset of menopause. However, as is often the case with steroid
hormones, the long term use of estrogen has significant adverse
effects such as breast and other gynecological cancers (Schneider
et al., Int. J. Fertil. Menopausal Study (1995) 40(1):40-53).
[0014] Calcitonin, an endogenous hormone produced by the thyroid,
binds selectively to osteoclasts, via its receptor, and inactivates
them. Since the osteoclast is the only cell which can dissolve bone
tissue, calcitonin binding can block or slow down bone degradation
caused by the osteoclast. However, this biological mechanism is
very short-lived, as the osteoclasts become tolerant to this drug
relatively quickly. Therefore, the use of calcitonin does not
provide an effective therapeutic option.
[0015] Fluoride has been shown to increase bone mass when it is
administered to humans. However, while bone mass is increased,
mechanical strength is not. Therefore, despite the increase in
apparent bone mass, the risk of fracture remains (Fratzl et al., J.
Bone Mineral Res. (1994) 9(10):1541-1549). In addition, fluoride
administration has significant health risks.
[0016] Ipriflavon has been used to treat osteoporosis in limited
areas in the world. However, the actual efficacy of this compound
is questionable and it is not widely accepted as a useful
therapeutic agent for bone diseases.
[0017] Bisphosphonates are compounds derivatized from
pyrophosphate. Synthesis involves replacing an oxygen atom situated
between two phosphorus atoms with carbon and modifying the carbon
with various substituents. While bisphosphonates are known to
suppress bone resorption, they have little effect on bone
formation. Furthermore, bisphosphonates adhere to the bone surface
and remain there for very long time causing a long-term decrease in
bone tissue turnover. As bone tissue needs to be turned over
continuously, this decrease in turnover ultimately results in bone
deterioration (Lufkin et al., Osteoporos. Int. (1994) 4(6):320-322;
Chapparel et al., J. Bone Miner. Res. (1995) 10(1):112-118).
[0018] Another significant problem with the agents described above
is that with the exception of fluoride and ipriflavon, they are
unsuitable for oral administration, and thus, must be given
parenterally. Since bone disorders are often chronic and require
long-term therapy, it is desirable that therapeutic agents be
suitable for oral administration.
[0019] In summary, a significant need exists for a therapeutic
agent which can prevent or treat bone loss. In particular, a new
drug that can selectively increase bone formation and/or number of
osteoblast without affecting bone resorption or soft tissue is
highly desired.
[0020] Another major health problem relating to skeleton and
mineral metabolism is that with teeth. In the United States alone,
it is estimated that 67 million people are affected by periodontal
disease and that the annual cost of its treatment is approximately
$6.0 billion in 2000. It is said 90% of the entire population
experience dental caries in their lives. The annual cost to treat
them is over $50 billion per year in the United States alone.
[0021] Dental caries are a universal disease and affects children
and adults. Periodontal disease, on the other hand, affects mostly
adults, and in particular, the aged. In many cases, the patient's
gum is inflamed and destroyed, and the alveolar bone that supports
the teeth is deteriorated. Cement that composes the core of the
root is also damaged, and subsequently, teeth fall out. One of the
most common treatments for tooth loss involves the use of a dental
implant. An artificial implant (osseointegrated dental implants) is
placed in the space where the tooth was lost. In severe cases, an
entire denture is replaced by implants. However, implants
frequently loosen, or fall out because their fixation on the
alveolar bone is not always successful. Since alveolar bone is
somehow damaged in these patients, the implant cannot always be
supported well by alveolar bone. When alveolar bone is severely
damaged, autogenous bone grafting is performed. In this case, a
bone graft taken from another skeletal tissue of the same patient
is grafted in the damaged alveolar area so that the hard tissue is
regenerated and sinus is elevated there. Since these treatments
require expensive bio-compatible materials and/or highly skilled
techniques, the cost of treatment is usually very high.
[0022] It is believed that dental caries are caused by acidic
condition in the oral cavity. For instance, sugars are converted to
acid and dissolve the surface of the teeth. Although only enamel
and a part of dentin is affected in many cases, the damage can
reach the pulp cavity in severe cases that cause significant pain.
The most typical treatment is filling the caries lesion with
non-degradable materials such as metals or metal oxide. Treatment
of dental caries mostly depends upon those materials and the
techniques by the dentists, which is often expensive.
[0023] Although a few therapeutic agents have been developed and
used in dental area, they are generally only anti-inflammatory
drugs, analgesics, and antibiotics. No generally effective
therapeutic agent that directly improves periodontal hard tissues
has been developed.
[0024] Another major clinical problem in mineral metabolism is
excessive loss or waste of phosphate (PO.sub.4) out of the body
system. Phosphate plays variety of important roles in all living
creatures. In vertebrates, phosphate is a major component of their
skeleton. In all animals, phosphate is an essential component to
build polynucleotide chains and cell membranes; phosphorylation and
dephosphorylation of sugars and nucleotides are the most essential
reactions in energy generation and consumption; and phosphorylation
and dephosphorylation of proteins, sugars, and lipids are
indispensable reactions for signal transduction in the cells.
Therefore, a shortage of phosphate could even result in death.
[0025] In mammals, phosphate concentration in the body fluid is
controlled within a range that allows all normal biological
functions in the body. The kidney is the most important organ for
controlling phosphate levels in the body. Glomeruli in the kidney
filter phosphate constantly to the urine, and proximal tubules
usually reabsorb approximately 80% of this filtered phosphate. If
this reabsorbing function is damaged, excessive phosphate is lost
into the urine, resulting in various clinical problems.
[0026] For instance, it is well known that the majority of kidney
transplant patients experience excessive renal phosphate leakage,
because the transplanted kidneys only marginally reabsorb the
urinary phosphate to the circulation. The reasons for this poor
reabsorbing activity on the part of transplanted kidneys are
unknown. It frequently causes the patients malnutrition and
secondary osteoporosis. This problem cannot be treated by a simple
exogenous supplementation of phosphate. Similar renal phosphate
leakage with unknown pathology is often observed in pediatric
medicine, with outcomes such as malnutrition or growth
retardation.
[0027] Health problems associated with circulating phosphate
shortage is not limited to humans. Milking cows sometimes suffer
from hypophosphatemia (too low phosphate in the blood) by
overproduction of the milk. It not only deteriorates the
nutritional quality of the milk but also often make the cows
useless for milk production. It is as relatively common problem in
dairy farms.
[0028] Clearly, there is a significant demand for a therapeutic
agent that promotes regeneration of alveolar bone and/or teeth,
increases the number and activity of odontoblasts/osteoblasts that
help form dental tissues, and reduces renal phosphate
secretion.
SUMMARY OF THE INVENTION
[0029] A class of compounds is disclosed which are useful in
treating or preventing a condition associated with skeletal loss or
weakness and/or which reduce renal phosphate excretion. The
compounds are peptides or analogs thereof which comprise between 10
and 50 monomer (e.g. amino acids) units. The amino acid sequence
comprises one or more of the following motifs: an integrin binding
motif sequence; a glycosaminoglycan binding motif; and a
calcium-binding motif. The amino acids may be in the D- or
L-conformation. The remaining monomer units (the sequence other
than the aforementioned motifs) in the compound may be amino acid
analogs. Where the motif is an integrin binding motif, the
remaining monomer units are preferably naturally occurring amino
acids having a sequence which are substantially the same as an
amino acid sequence contiguous with the RGD sequence in the
naturally occurring protein, matrix extracellular
phosphoglycoprotein (Rowe et. al., Genomics (2000) 67:56-68).
[0030] An aspect of the invention is a set of peptides and/or
peptide analogs.
[0031] A feature of the invention is that a compound of the
invention comprises one or more of the following motifs: an
integrin binding motif sequence; a glycosaminoglycan-binding motif,
and a calcium-binding motif. The amino acids may be in the D- or
L-conformation.
[0032] An advantage of the invention is that a compound of the
invention enhances skeletal growth.
[0033] Another advantage of the invention is that a compound of the
invention enhances the number of osteoblast and possibly
odontoblast cells on the surface of new skeletal or tooth
growth.
[0034] Another advantage of the invention is that a compound of the
invention reduces phosphate (Pi) loss from the body, as indicated
by reduced urinary Pi leakage.
[0035] Another aspect of the invention is to provide a formulation
for therapeutic use which comprises a sufficient concentration of a
compound of the invention and can be administered to the pulp of
teeth, the space between the root of teeth and gum, or alveolar
bone to prevent the damage on teeth and/or alveolar bone or
regenerate the hard tissue in the damaged teeth and/or alveolar
bone.
[0036] Another aspect of the invention is to provide toothpaste
which comprises a sufficient concentration of a compound of the
invention to enhance tooth and/or alveolar bone growth on areas
where deterioration has occurred, or to prevent such
deterioration.
[0037] Yet another aspect of the invention is to provide a
mouthwash which comprises a sufficient concentration of a compound
of the invention to enhance tooth and/or alveolar bone growth on
areas where deterioration has occurred, or to prevent such
deterioration.
[0038] Still another aspect of the invention is a dental floss
having coated thereon and/or embedded therein a compound of the
invention in an amount such that repeated application to teeth
and/or alveolar bone results in enhanced tooth and/or alveolar bone
growth on areas where deterioration has occurred, or to prevent
such deterioration.
[0039] A further aspect of the invention is a small adhesive patch
for application on gum tissue of an individual, the patch
comprising a therapeutically effective amount of a compound of the
invention. The compound is slowly released from the patch into the
gum, so that the released compound penetrates into the root of the
teeth as well as the alveolar and/or jaw bones to prevent loss of
such bones and/or to regenerate such bones.
[0040] An object of the invention is to provide a method of
treating or preventing skeletal bone or dental bone loss by the
administration/application of any formulation/composition of the
invention.
[0041] These and other objects, advantages, and features of the
invention will become apparent to those persons skilled in the art
upon reading the details of the subject invention, as more fully
described below.
BRIEF DESCRIPTIONS OF THE DRAWINGS
[0042] FIG. 1 is a graph showing the relationship between bone mass
and age in humans.
[0043] FIG. 2 is a schematic drawing of a matrix extracellular
phosphoglycoprotein wherein the area designated as "A" includes
sequences which match peptides of the present invention and the
area designated as "B" is a highly homologous motif to a group of
bone-tooth matrix phosphoglycoproteins such as osteopontin (OPN),
dentin sialophosphoprotein (DSPP), dentin matrix protein 1 (DMP1),
and bone sialoprotein II (IBSP).
[0044] FIGS. 3A, 3B, 3C, and 3D are actual photographs of bone
cross-sections (from a seven day mouse calvaria organ culture
study) showing the effects of a control (FIG. 3A), fibroblast
growth factor-1 (FGF-1) (FIG. 3B), and two peptides of the
invention designated D-00004 and D-00006 (FIGS. 3C and 3D,
respectively).
[0045] FIG. 4 is a graph comparing the effects of different
compounds on calvaria.
[0046] FIG. 5 is a graph showing the in vivo effects of
D-00006.
[0047] FIG. 6 is a graph showing the effect of D-00006 on urinary
phosphate leakage.
DETAILED DESCRIPTION OF THE INVENTION
[0048] Before the peptides, analogs, formulations, and methodology
of the present invention are described, it is to be understood that
this invention is not limited to any particular embodiment
described, as such may, of course, vary. It is also to be
understood that the terminology used herein is with the purpose of
describing particular embodiments only, and is not intended to
limit the scope of the present invention which will be limited only
by the appended claims.
[0049] Where a range of values is provided, it is understood that
each intervening value, to the tenth of the unit of the lower limit
unless the context clearly dictates otherwise, between the upper
and lower limits of that range is also specifically disclosed. Each
smaller range between any stated value or intervening value in a
stated range and any other stated or intervening value in that
stated range is encompassed within the invention. The upper and
lower limits of these smaller ranges may independently be included
or excluded in the range, and each range where either, neither or
both limits are included in the smaller ranges is also encompassed
within the invention, subject to any specifically excluded limit in
the stated range. Where the stated range includes one or both of
the limits, ranges excluding either or both of those included
limits are also included in the invention.
[0050] Unless defined otherwise, all technical and scientific terms
used herein have the same meaning as commonly understood by one of
ordinary skill in the art to which this invention belongs. Although
any methods and materials similar or equivalent to those described
herein can be used in the practice or testing of the present
invention, the preferred methods and materials are now described.
All publications mentioned herein are incorporated herein by
reference to disclose and describe the methods and/or materials in
connection with which the publications are cited.
[0051] It must be noted that as used herein and in the appended
claims, the singular forms "a", "and", and "the" include plural
referents unless the context clearly dictates otherwise. Thus, for
example, reference to "a peptide" includes a plurality of such
peptides and reference to "the method" includes reference to one or
more methods and equivalents thereof known to those skilled in the
art, and so forth.
[0052] The publications discussed herein are provided solely for
their disclosure prior to the filing date of the present
application. Nothing herein is to be construed as an admission that
the present invention is not entitled to antedate such publication
by virtue of prior invention. Further, the dates of publication
provided may be different from the actual publication dates which
may need to be independently confirmed.
DEFINITIONS
[0053] The terms "peptide" and "peptidic compound" are used
interchangeably herein to refer to a polymeric form of amino acids
of from about 10 to about 50 amino acids, which can comprise coded
and non-coded amino acids, chemically or biochemically modified or
derivatized amino acids, L- or D-amino acids, peptides having
modified peptide backbones, and peptides comprising amino acid
analogs. The peptidic compounds may be polymers of: (a) naturally
occurring amino acid residues; (b) non-naturally occurring amino
acid residues, e.g. N-substituted glycines, amino acid substitutes,
etc.; or (c) both naturally occurring and non-naturally occurring
amino acid residues/substitutes. In other words, the subject
peptidic compounds may be peptides or peptoids. Peptoid compounds
and methods for their preparation are described in WO 91/19735, the
disclosure of which is herein incorporated by reference.
[0054] The terms "treat", "treating", "treatment" and the like are
used interchangeably herein and mean obtaining a desired
pharmacological and/or physiological effect. The effect may be
prophylactic in terms of completely or partially preventing a
disease or symptom thereof and/or may be therapeutic in terms of
partially or completely curing a disease and/or adverse effect
attributed the disease such as enhancing the effect of vitamin D.
"Treating" as used herein covers treating a disease in a vertebrate
and particularly a mammal and most particularly a human, and
includes:
[0055] (a) preventing the disease from occurring in a subject which
may be predisposed to the disease but has not yet been diagnosed as
having it;
[0056] (b) inhibiting the disease, i.e. arresting its development;
or
[0057] (c) relieving the disease, i.e. causing regression of the
disease.
[0058] The invention is particularly directed towards peptides
which make it possible to treat patient's which have experienced
bone loss or which would be expected to experience bone loss and
thus is particularly directed towards preventing, inhibiting, or
relieving the effects of bone loss. A subject is "treated" provided
the subject experiences a therapeutically detectable and beneficial
effect which may be measured based on a variety of different
criteria including increased bone growth, increased bone strength
or other characteristics generally understood by those skilled in
the art to be desirable with respect to the treatment of diseases
related to bone.
[0059] The term "antibody" is meant an immunoglobulin protein
capable of binding an antigen. The term "antibody" as used herein
is intended to include antibody fragments (e.g. F(ab').sub.2, Fab',
and Fab) capable of binding an antigen or antigenic fragment of
interest.
[0060] The term "binds specifically" is meant high avidity and/or
high affinity binding of an antibody to a specific
peptide--specifically a peptide of the invention. Antibody binding
to its specific target epitope is stronger than the binding of the
antibody to other epitopes on the peptide or to other epitopes on
other peptides. Antibodies which bind specifically to a peptide of
interest may be capable of binding to other peptides at a weak, yet
detectable level (e.g. 10% or less of the binding shown to the
peptide of interest). Such weak binding or background binding, is
readily discernable from the specific antibody binding to the
peptide of interest, e.g. by the use of appropriate controls.
[0061] The term "skeletal loss" refers to any situation in which
skeletal mass, substance or matrix or any component of the
skeleton, such as calcium and phosphate, is decreased or the bone
is weakened such as in terms of its ability to resist being
broken.
[0062] The term "skeleton" includes both bone and teeth. In the
same manner, the term "skeletal" means both bone and teeth.
[0063] The term "osteoporosis" is intended to refer to any
condition involving bone loss, i.e. involving a reduction in the
amount of bone mass or substance resulting from any cause. The term
particularly results in a bone loss resulting from demineralization
of the bone, post menopausal or peri-menopausal estrogen decrease
or nerve damage.
[0064] The terms "subject," "individual," "patient," and "host" are
used interchangeably herein and refer to any vertebrate,
particularly any mammal and most particularly including human
subjects, farm animals, and mammalian pets.
Peptidic Compounds
[0065] A peptidic compound of the invention is a peptide comprising
from 10 to 50 amino acids. The amino acids are preferably one of
the twenty naturally occurring L-amino acids. However, D-amino
acids may be present as may amino acid analogs. A peptide of the
invention will comprise one or more of the following amino acid
sequence motifs: an integrin binding motif such as RGD sequence; a
glycosaminoglycan binding motif; and a calcium binding motif.
Individual amino acids may be present in the peptides in either the
L or the D isoform, but preferably in the L form. A peptide of the
invention can be amidated or non-amidated on its C-terminus, or
carboxylated or non-carboxylated on its N-terminus. The peptide of
the invention may or may not contain a glycosaminoglycan binding
motif such as SGDG (SEQ ID NO:41) sequence in L- or D-isomer form.
A compound of the invention is still further characterized by
biological activity i.e. it enhances skeletal growth as well as the
growth or recruiting of osteoblast or odontoblast cells on surface
of the new skeletal growth.
[0066] A peptidic compound of the invention exhibit one or more of
the following properties when administered in an effective amount
to an individual: (1) reduce bone loss; (2) increase bone mass; (3)
increase bone strength; (4) reduce renal excretion of phosphate;
and (5) reduce loss of phosphate from an individual.
[0067] Specific examples of peptides of the invention comprise
seven to forty-seven amino acids on either side of the RGD sequence
of the naturally occurring sequence of matrix extracellular
phosphoglycoprotein. Thus, examples of peptides of the invention
comprising sequences taken from the following sequence and
including the RCD sequence shown in bold: TABLE-US-00001 (SEQ ID
NO: 1) DSQAQKSPVKSKSTHRIQHNIDYLKHLSKVKKIPSDFEGSGYTDLQERGD
NDISPFSGDGQPFKDIPGKGEATGPDLEGKDIQTGFAGPSEAESTHL
[0068] Specific examples of peptides of the invention which
comprise the RGD sequence as the terminal sequence include the
following: TABLE-US-00002 (SEQ ID NO: 2)
AQKSPVKSKSTHRIQHNIDYLKHLSKVKKIPSDFEGSGYTDLQERGD (SEQ ID NO: 3)
RGDAQKSPVKSKSTHRIQHNIDYLKHLSKVKKIPSDFEGSGYTDLQE (SEQ ID NO: 4)
DSQAQKSPVKSKSTKPIQHNIDYLKHLSKVKKIPSDFEGSGYTDRGD (SEQ ID NO: 5)
RGDSPVKSKSTHRIQHNIDYLKHLSKVKKIPSDFEGSGYTDLQE (SEQ ID NO: 6)
DSQAQKSPVKSKSTHRIQHNIDYLKHLSKVKKIPSDFEGSGRGD (SEQ ID NO: 7)
RGDTHRIQHNIDYLKHLSKVKKIPSDFEGSGYTDLQE (SEQ ID NO: 8)
DSQAQKSRVKSKSTHRIQHNIDYLKHLSKVKKIPSDFERGD (SEQ ID NO: 9)
RGDLKHLSKVKKIPSDFEGSGYTDLQE (SEQ ID NO: 10)
DSQAQKSPVKSKSTHRIQHNIDYLKHLSKVKKIPSRGD (SEQ ID NO: 11)
RGDLSKVKKIPSDFEGSGYTDLQE (SEQ ID NO: 12)
DSQAQKSPVKSKSTHRIQHNIDYLKHLSKRGD (SEQ ID NO: 13)
RGDVKKIPSDFEGSGYTDLQE (SEQ ID NO: 14) DSQAQKSPVKSKSTHRIQHNIDYLKRGD
(SEQ ID NO: 15) RGDIPSDFEGSGYTDLQE (SEQ ID NO: 16)
DSQAQKSPVKSKSTHRIQHNIDRGD (SEQ ID NO: 17) RGDDFEGSGYTDLQE (SEQ ID
NO: 18) DSQAQKSPVKSKSTHRRGD (SEQ ID NO: 19) RGDGSGYTDLQE (SEQ ID
NO: 20) DSQAQKSPVKRGD (SEQ ID NO: 21) RGDGYTDLQE (SEQ ID NO: 22)
DSQAQKSRGD (SEQ ID NO: 23)
RGDNDISPFSGDGQPFKDIPGKGEATGPDLEGKDIQTGFA
[0069] Specific examples of the peptides of the invention which
comprise the RGD internally include the following: TABLE-US-00003
(SEQ ID NO: 24) NDI RGDSPFSGDGQPFKDIPGKGEATGPDLBGKDIQTGFA (SEQ ID
NO: 25) NDISPF RGDSGDGQPFKDIPGKGEATGPDLEGKDI (SEQ ID NO: 26)
NDISPFSGD RGDGQPFKDIPGKGEATGPDL (SEQ ID NO: 27)
FSGDGQPFKDIPGKGEATGPDLEGKDIQTGFAGPSEAES RGDTHL (SEQ ID NO: 28)
IPGKGEATGPDLEGKPIQTGFAGPSE RGDAESTHL (SEQ ID NO: 29)
EATGPDLEGKDIQTGFAG RGDPSEAESTHL (SEQ ID NO: 30) NDISPFSGDGQPFKD
RGDIPGKGEATGPDLEGK (SEQ ID NO: 31) GKGEATGPDLEGKDI
RGDQTGFAGPSEAESTHL (SEQ ID NO: 32) ESGDGQPFKDIPGKGEATG
RGDPDLEGKDIQTGFAGPSEA (SEQ ID NO: 33) DGQPFKDIPGKGEATG
RGDPDLEGKDIQTGF (SEQ ID NO: 34) PFKDIPGKGEATG RGDPDLEGKDIQ (SEQ ID
NO: 35) DIPGKGEATG RGDPDLEGKDIQTGFAGP (SEQ ID NO: 36)
DGQPFKDIPGKGEATG RGDPDLEGKDIQTGF (SEQ ID NO: 37) GKGEATG
RGDPDLEGKDIQTGFAGPSEA (SEQ ID NO: 38) EATG RGDPDLEGKDIQTGF (SEQ ID
NO: 39) EATG RGDPDLEGK (SEQ ID NO: 40) EATG RGDPDL
[0070] In some embodiments, a peptide of the invention comprises a
glycosaminoglycan-binding motif A glycosaminoglycan binding motif
has the consensus sequence SGXG (SEQ ID NO:50), wherein X is any
amino acid. In some embodiments, a glycosaminoglycan binding motif
has the sequence SGDG (SEQ ID NO:41).
[0071] In other embodiments, a peptide of the invention comprises a
calcium binding motif. In some embodiments, a calcium binding motif
has the sequence DNDISPFSGDGQ (SEQ ID NO:42). Also included in the
term "calcium binding motif" are amino acid sequences that differ
from SEQ ID NO:42 by one, two, three, four, five, six, seven, or
eight amino acids. Of particular interest in many embodiments are
motifs that conserve amino acids 1, 3, 5, 7, 9, and 12 of SEQ ID
NO:42. Thus, in some embodiments, a peptide of the invention
comprises, as a calcium-binding motif, the sequence DXDXSXFXGXXQ
(SEQ ID NO:43), wherein X is any amino acid or amino acid
analog.
[0072] In other embodiments, a calcium binding motif has the
sequence
DX.sub.1X.sub.2X.sub.3X.sub.4X.sub.5X.sub.6X.sub.7X.sub.8X.sub.9X.sub.10X-
.sub.11X.sub.12, wherein:
X.sub.1 is any amino acid;
X.sub.2 is D, N, or S;
X.sub.3 is I, L, V, F, Y, or W;
X.sub.4 is D, E, N, S, T, or G;
X.sub.5 is D, N, Q, G, H, R, or K
X.sub.6 is G or P;
X.sub.7 is L, I, V, M, C;
X.sub.8 is D, E, N, Q, S, T, A, G, or C;
each of X.sub.9 and X.sub.10 is independently any amino acid;
X.sub.11 is D or E; and
X.sub.12 is L, I, V, M, F, Y, or W.
[0073] In other embodiments, a calcium binding motif has the
sequence
X.sub.1X.sub.2X.sub.3X.sub.4C(X.sub.5).sub.nC(X.sub.6).sub.mCX.sub.7X.sub-
.8X.sub.9X.sub.10X.sub.11X.sub.12X.sub.13X.sub.14C, wherein
each of X.sub.1, X.sub.3, and X.sub.4 is independently D, E, Q, or
N;
each of X.sub.2, X.sub.5, X.sub.6, X.sub.7, X.sub.9, X.sub.10,
X.sub.11, X.sub.12, and X.sub.14 is independently any amino
acid;
n is 3-14;
m is 3-7;
X.sub.8 is D or N; and
X.sub.13 is F or Y.
[0074] In other embodiments, a calcium binding motif has the
sequence
X.sub.1X.sub.2X.sub.3X.sub.4X.sub.5DX.sub.6X.sub.7X.sub.8X.sub.9X.sub.10X-
.sub.12X.sub.13X.sub.14X.sub.15X.sub.16X.sub.17X.sub.18X.sub.19X.sub.20X.s-
ub.21, wherein
each of X.sub.1 and X.sub.2 is independently L, I, V, M, F, Y, or
W;
each of X.sub.3, X.sub.4, X.sub.6, X.sub.7, X.sub.8, X.sub.10,
X.sub.11, X.sub.12, X.sub.15, X.sub.18, and X.sub.19 is
independently any amino acid;
X.sub.5 is L or K;
X.sub.9 is D or N;
X.sub.13 is D, N, S, or G;
X.sub.14 is F or Y;
X.sub.16 is E or S;
X.sub.17 is F, Y, V, or C;
X.sub.20 is L, I, V, M, F, or S;
and X.sub.21 is L, I, V, M, or F.
[0075] In other embodiments, a calcium binding motif has the
sequence
DX.sub.1X.sub.2X.sub.3X.sub.4X.sub.5X.sub.6GX.sub.7DX.sub.8X.sub.9X.sub.1-
0GGX.sub.11X.sub.12X.sub.13D, wherein
each of X.sub.1, X.sub.3, X.sub.4, X.sub.5, X.sub.6, X.sub.7,
X.sub.8, X.sub.10, X.sub.11, X.sub.12, and X.sub.13 is
independently any amino acid; and
each of X.sub.2 and X.sub.9 is independently L or I.
[0076] Calcium binding motifs are known in the art and have been
described amply. See, for example, Springer et al. (2000) Cell
102:275-277; Kawasaki and Kretsinger (1995) Protein Prof.
2:305-49.0; Moncrief et al. (1990) J. Mol. Evol. 30-522-562;
Chauvaux et al. (1990) Biochem. J. 265:261-265: Bairoch and Cox
(1990) FEBS Lett. 269:454-456; Davis (1990) New Biol. 2:410-419;
Schaefer et al. (1995) Genomics 25:638-643; and Economou et al.
(1990) EMBO J. 9 :349-354. Any known calcium binding motif can be
included in a peptidic compound of the invention.
[0077] A peptide of the invention may comprise one or more of an
integrin binding motif, a glycosaminoglycan binding motif, and a
calcium binding motif. The motifs may be present in the peptide in
any order relative to one another. The motifs may be separated from
one another by one, two, three, four, five, six, seven, eight,
nine, or ten amino acids, or more. Furthermore, a motif may overlap
with one or more other motifs. As one non-limiting example, a
peptide having the sequence TDLQERGDNDISPFSGDGQPFKD (SEQ ID NO:49)
comprises all three motifs, which overlap with one another.
[0078] All or any of the amino acids in the above sequences may be
in the D- or L-conformation and may be substituted with equivalent
analogs. The preferred embodiments comprise naturally occurring
amino acids in the L-conformation.
[0079] All or any of the above sequences may be amidated,
non-amidated, or otherwise modifed on their C-terminus, or
carboxylated, non-carboxylated, or otherwise modified on their
N-terminus.
[0080] In addition, multimers of any of the foregoing peptides are
provided. Multimers include dimers, trimers, tetramers, pentamers,
hexamers, etc. Thus, a peptide of the invention having a length of
from about 10 to about 50 amino acids can be multimerized,
optionally with an intervening linker, such that a subject peptide
occurs in tandem arrays of two, three, four, five, six, or more
copies. Furthermore, two or more different peptides of the
invention can be multimerized with one another, forming
"heteromultimers." Thus, e.g., a multimer may comprise a first and
a second peptide, linked together by peptide bonds, optionally with
a linker molecule such as one to ten glycine residues.
[0081] Peptidic compounds of the invention can be obtained using
any known method, including, e.g., solid phase peptide synthesis
techniques, where such techniques are known to those of skill in
the art. Methods for synthesizing peptides are well known in the
art and have been amply described in numerous publications,
including, e.g., "The Practice of Peptide Synthesis" M. Bodanszky
and A. Bodanszky, eds. (1994) Springer-Verlag; and Jones, The
Chemical Synthesis of Peptides (Clarendon Press, Oxford)(1994).
Generally, in such methods a peptide is produced through the
sequential additional of activated monomeric units to a solid phase
bound growing peptide chain. Also of interest is the use of
submonomers in solid phase synthesis, as described in WO 94/06451,
the disclosure of which is herein incorporated by reference.
[0082] Instead of solid phase synthesis, the subject peptidic
compounds of the subject invention may be prepared through
expression of an expression system comprising a polynucleotide
encoding the peptidic compound. Any convenient methodology may be
employed, where methodologies that may be employed typically
include preparation of a nucleic acid molecule comprising a
nucleotide sequence encoding the subject peptide, introduction of
the encoding region into a vector for expression, transformation of
a host cell with the vector, and expression and recovery of the
product. Protocols for accomplishing each of the above steps are
well known in art. See Sambrook, Fritsch & Maniatis, Molecular
Cloning, A Laboratory Manual (Cold Spring Harbor Press,
Inc.)(1989).
[0083] Matrix extracellular phosphoglycoprotein was cloned and
characterized from a human tumor that caused osteomalacia in the
patients. This extremely rare type of tumor called Oncogenic
Hypophosphatemic Osteomalacia (OHO) tumor has been known to cause
renal phosphate leak, hypophosphatemia (low serum phosphate
levels), low serum calcitriol (1,25-vitamin D3), and abnormalities
in skeletal mineralization (Osteomalacia). In the patients of OHO
tumor, resection of the tumors results in remission of all of the
above symptoms and it has been proposed that a circulating
phosphaturic factor secreted from OHO tumor plays a role in
osteomalacia. Matrix extracellular phosphoglycoprotein was proposed
as a candidate of this phosphaturic factor (Rowe et. al., Genomics
(2000) 67:56-68).
[0084] Phosphate plays a central role in many of the basic
processes essential to the cell and the mineralization of skeleton.
In particular, skeletal mineralization is dependent on the
regulation of phosphate and calcium in the body and any
disturbances in phosphate-calcium homeostasis can have severe
repercussions on the integrity of bone. In the kidney, phosphate is
lost passively into the glomerular filtrate and is actively
reabsorbed via a sodium (Na+) dependent phosphate cotransporter. In
the intestine, phosphate is absorbed from foods. A sodium (Na+)
dependent phosphate cotransporter was found to be expressed in the
intestine and recently cloned (Hilfiker, PNAS 95(24) (1998),
14564-14569). The liver, skin and kidney are involved in the
conversion of vitamin D3 to its active metabolite, calcitriol,
which plays an active role in the maintenance of phosphate balance
and skeletal mineralization.
[0085] Vitamin D deficiency causes rickets in children and
osteomalacia in adults. Both conditions are characterized by
failure of calcification of osteoid, which is the matrix of
skeleton.
[0086] Thus, all of the humoral functions by matrix extracellular
phosphoglycoprotein, namely, renal phosphate leak, hypophosphatemia
(low serum phosphate levels), low serum calcitriol (1,25-vitamin
D3), are harmful to healthy skeletal formation.
[0087] Matrix extracellular phosphoglycoprotein is a large
polypeptide with 525 amino acid with short N-terminus signal
sequence. Therefore, it is highly probable that this molecule is
secreted from its producing cells into the body fluid and
circulation. Out of its 525 amino acid sequence, a 23 amino acid
motif on the C-terminus showed high similarities to a group of
bone-tooth mineral matrix phosphoglycoproteins such as osteopontin
(OPN), dentin sialophosphoprotein (DSPP), dentin matrix protein 1
(DMP1), and bone sialoprotein II (IBSP). It has been proposed that
these bone-tooth mineral matrix phosphoproteins may play important
roles in skeletal mineralization.
[0088] Notwithstanding the above observations about matrix
extracellular phosphoglycoprotein, smaller peptide sequence
containing integrin binding motif that is located within the amino
acid sequence and far from its C-terminus sequence with a high
degree of similarity to other bone-tooth mineral matrix
phosphoglycoproteins demonstrated a very potent skeletal formation
activity and increased the number of osteoblasts on such skeletal
formation surface. The potency of such activities was equivalent to
fibroblast growth factor (FGF). It was surprising in that small
motifs located within a larger protein which has destructive
functions on the skeleton demonstrated potent bone formation
activity, and that such motifs were located far from the sequence
which showed homology to other known bone-tooth matrix
proteins.
[0089] Another surprising fact was that potent skeletal formation
motifs of the invention contained an integrin binding motif, in
particular, RGD sequence. It has been reported that a synthetic
peptide containing the RGD sequence inhibited bone formation and
resorption in a mineralizing organ culture system of fetal rat
skeleton (Gronowicz et. al. Journal of Bone and Mineral Research
9(2):193-201 (1994)), that is a very similar experimental method
used to test the subject of the present invention.
[0090] Further, the skeletal formation activity provided by the
small peptides of the invention was as potent as that of an intact
growth factor such as FGF.
Therapeutic Methods
[0091] The invention provides methods for reducing skeletal bone
loss, methods for reducing renal phosphate leakage, methods for
increasing bone mass, methods for increasing bone strength, and
methods for reducing Pi excretion, comprising administering a
peptidic compound of the invention. Typically, a peptidic compound
of the invention is formulated with a pharmaceutically acceptable
excipient for delivery to an individual in need thereof.
[0092] As used herein, an "effective amount" of a peptidic compound
of the invention is an amount that reduces bone loss, and/or
increases bone strength, and/or increases bone mass, and/or reduces
phosphate loss, and/or reduces renal phosphate excretion by at
least about 10%, at least about 15%, at least about 20%, at least
about 25%, at least about 30%, at least about 35%, at least about
40%, at least about 45%, at least about 50%, at least about 55%, or
at least about 60%, or more, when compared to a suitable control.
Suitable controls are, in the case of experimental animals, an
animal not treated with the peptide, e.g. treated with vehicle, or
treated with an irrelevant peptide; and in the case of human
subjects, a human subject treated with a placebo, or a human
subject before treatment with a peptide of the invention.
[0093] In some embodiments, an effective amount of a peptidic
compound of the invention is an amount that reduces renal phosphate
excretion, and therefore reduces phosphate loss from an individual,
by at least about 10%, at least about 15%, at least about 20%, at
least about 25%, at least about 30%, at least about 35%, at least
about 40%, at least about 45%, at least about 50%, at least about
55%, or at least about 60%, or more, when compared to a suitable
control.
[0094] Whether a given peptide reduces bone loss, and/or increases
bone strength, and/or increases bone mass, and/or reduces phosphate
loss, and/or reduces renal phosphate excretion in an individual can
be determined using any known assay to measure any known parameter
associated with any one or more of reduced bone loss, increased
bone strength, increased bone mass, reduces phosphate loss, and
reduced renal phosphate excretion, including, but not limited to,
serum and urinary phosphorus levels (e.g., using a calorimetric
assay); serum and urinary calcium levels (e.g., using a
calorimetric assay); serum and urinary creatinine levels; bone
turnover marker levels (e.g., deoxypyrodinoline and osteocalcin);
bone density (e.g., by in vivo bone densitometry); bone mechanical
testing (e.g., lumbar vertebrae compression test; femoral shaft
three point bending test; and the like); and the like. Such methods
are standard in the art.
[0095] Individuals suitable for treatment with the methods of the
invention are individuals having to believed to be at risk for,
bone loss, or a disorder caused by bone loss, or a disorder whose
sequelae include bone loss, including, but not limited to, dental
caries, osteoporosis, Paget's disease, renal phosphate leakage,
renal osteodystrophy, osteomalacia, osteodystrophy resulting from
other causes, osteolysis mediated by cancer, fractures, and
hyperparathyroidism. Such individuals include older individuals,
post-menapausal women, kidney transplant recipients, and
individuals having, or being at risk for, any of the aforementioned
disorders.
[0096] Routes of Administration
[0097] Peptides of the invention are administered to an individual
using any available method and route suitable for drug delivery,
including in vivo and ex vivo methods, as well as systemic and
localized routes of administration.
[0098] Conventional and pharmaceutically acceptable routes of
administration include intranasal, intramuscular, intratracheal,
subcutaneous, intradermal, topical application, intravenous,
rectal, nasal, oral and other parenteral routes of administration.
Routes of administration may be combined, if desired, or adjusted
depending upon the immunomodulatory nucleic acid molecule and/or
the desired effect on the immune response. Peptides of the
invention can be administered in a single dose or in multiple
doses.
[0099] Peptides of the invention can be administered to a subject
using any available conventional methods and routes suitable for
delivery of conventional drugs, including systemic or localized
routes. In general, routes of administration contemplated by the
invention include, but are not necessarily limited to, enteral,
parenteral, or inhalational routes.
[0100] Parenteral routes of administration other than inhalation
administration include, but are not necessarily limited to,
topical, transdermal, subcutaneous, intramuscular, intraorbital,
intracapsular, intraspinal, intrasternal, and intravenous routes,
i.e., any route of administration other than through the alimentary
canal. Parenteral administration can be carried to effect systemic
or local delivery of peptides of the invention. Where systemic
delivery is desired, administration typically involves invasive or
systemically absorbed topical or mucosal administration of
pharmaceutical preparations.
[0101] Peptides of the invention can also be delivered to the
subject by enteral administration. Enteral routes of administration
include, but are not necessarily limited to, oral and rectal (e.g.,
using a suppository) delivery.
[0102] Methods of administration of a peptide of the invention
through the skin or mucosa include, but are not necessarily limited
to, topical application of a suitable pharmaceutical preparation,
transdermal transmission, injection and epidermal administration.
Also contemplated for delivery of a peptide of the invention is a
patch containing therein a peptide of the invention. A patch can be
applied to the skin, or to other tissue, e.g., gum tissue. Any
known patch delivery system that is suitable for oral delivery
system can be used. See, e.g., U.S. Pat. No. 6,146,655.
[0103] Peptides of the invention can also be delivered to an
individual by administering to the individual a nucleic acid
molecule comprising a nucleotide sequence that encodes a peptide of
the invention. The terms "poly-nucleotide" and "nucleic acid
molecule" are used interchangeably herein to refer to polymeric
forms of nucleotides of any length. The polynucleotides may contain
deoxyribonucleotides, ribonucleotides, and/or their analogs. For
expression, an expression cassette may be employed. The expression
vector will provide a transcriptional and translational initiation
region, which may be inducible or constitutive, where the coding
region is operably linked under the transcriptional control of the
transcriptional initiation region, and a transcriptional and
translational termination region. These control regions may be
native to a gene encoding the subject peptides, or may be derived
from exogenous sources.
[0104] Expression vectors generally have convenient restriction
sites located near the promoter sequence to provide for the
insertion of nucleic acid sequences encoding heterologous proteins.
A selectable marker operative in the expression host may be
present. Expression vectors may be used for the production of
fusion proteins, where the exogenous fusion peptide provides
additional functionality, i.e. increased protein synthesis,
stability, reactivity with defined antisera, an enzyme marker, e.g.
.beta.-galactosidase, etc.
[0105] Expression cassettes may be prepared comprising a
transcription initiation region, the gene or fragment thereof, and
a transcriptional termination region. Vectors include, but are not
limited to, plasmids; cosmids; viral vectors; artificial
chromosomes (YAC's, BAC's, etc.); mini-chromosomes; and the like.
Vectors are amply described in numerous publications well known to
those in the art, including, e.g., Short Protocols in Molecular
Biology, (1999) F. Ausubel, et al., eds., Wiley & Sons.
[0106] Expression vectors may be used to introduce a nucleic acid
molecule encoding a subject peptide into a cell of an individual.
Such vectors generally have convenient restriction sites located
near the promoter sequence to provide for the insertion of nucleic
acid sequences. Transcription cassettes may be prepared comprising
a transcription initiation region, the target gene or fragment
thereof, and a transcriptional termination region. The
transcription cassettes may be introduced into a variety of
vectors, e.g. plasmid; retrovirus, e.g. lentivirus; adenovirus; and
the like, where the vectors are able to transiently or stably be
maintained in the cells, usually for a period of at least about one
day, more usually for a period of at least about several days to
several weeks.
[0107] An expression vector comprising a nucleotide sequence
encoding a peptide of the invention may be introduced into tissues
or host cells by any number of routes, including viral infection,
microinjection, or fusion of vesicles. Jet injection may also be
used for intramuscular administration, as described by Furth et al.
(1992), Anal Biochem 205:365-368. The expression vector may be
coated onto gold microparticles, and delivered intradermally by a
particle bombardment device, or "gene gun" as described in the
literature (see, for example, Tang et al. (1992), Nature
356:152-154), where gold microprojectiles are coated with the
expression vector, then bombarded into skin cells.
[0108] Dosages
[0109] Although the dosage used will vary depending on the clinical
goals to be achieved, a suitable dosage range is one which provides
up to about 1 .mu.g, to about 1,000 .mu.g, to about 10,000, to
about 25,000 .mu.g or about 50,000 .mu.g of a peptide of the
invention. Peptides of the invention can be administered in a
single dosage or several smaller dosages over time. Alternatively,
a target dosage of a peptide can be considered to be about 0.1-1000
.mu.M, about 1-500 .mu.M, or about 5-250 .mu.M in a sample of host
blood drawn within the first 24-48 hours after administration of
the peptide.
[0110] The effect on bone loss, bone strength, phosphate excretion,
or other parameter may be dose-dependent. Therefore, to increase
potency by a magnitude of two, each single dose is doubled in
concentration. Increased dosages may be needed to achieve the
desired therapeutic goal. The invention thus contemplates
administration of multiple doses to provide and maintain an effect
on bone loss, bone strength, phosphate excretion, or other
parameter. When multiple doses are administered, subsequent doses
are administered within about 16 weeks, about 12 weeks, about 8
weeks, about 6 weeks, about 4 weeks, about 2 weeks, about 1 week,
about 5 days, about 72 hours, about 48 hours, about 24 hours, about
12 hours, about 8 hours, about 4 hours, or about 2 hours or less of
the previous dose.
[0111] In view of the teaching provided by this disclosure, those
of ordinary skill in the clinical arts will be familiar with, or
can readily ascertain, suitable parameters for administration of
peptides according to the invention.
[0112] Formulations
[0113] In general, peptides are prepared in a pharmaceutically
acceptable composition for delivery to a host. Pharmaceutically
acceptable carriers preferred for use with the peptides of the
invention may include sterile aqueous of non-aqueous solutions,
suspensions, and emulsions. Examples of non-aqueous solvents are
propylene glycol, polyethylene glycol, vegetable oils such as olive
oil, and injectable organic esters such as ethyl oleate. Aqueous
carriers include water, alcoholic/aqueous solutions, emulsions or
suspensions, including saline and buffered media. Parenteral
vehicles include sodium chloride solution, Ringer's dextrose,
dextrose and sodium chloride, lactated Ringer's or fixed oils.
Intravenous vehicles include fluid and nutrient replenishers,
electrolyte replenishers (such as those based on Ringer's
dextrose), and the like. A composition comprising a peptide of the
invention may also be lyophilized using means well known in the
art, for subsequent reconstitution and use according to the
invention. Also of interest are formulations for liposomal
delivery, and formulations comprising microencapsulated
peptides.
[0114] In general, the pharmaceutical compositions can be prepared
in various forms, such as granules, tablets, pills, suppositories,
capsules, suspensions, salves, lotions and the like. In some
embodiments, where delivery of a peptide of the invention is to
oral tissues, a peptide of the invention may be formulated in a
toothpaste, a mouthwash, or may be coated on or embedded in a
dental floss. Pharmaceutical grade organic or inorganic carriers
and/or diluents suitable for oral and topical use can be used to
make up compositions comprising the therapeutically-active
compounds. Diluents known to the art include aqueous media,
vegetable and animal oils and fats. Stabilizing agents, wetting and
emulsifying agents, salts for varying the osmotic pressure or
buffers for securing an adequate pH value, and skin penetration
enhancers can be used as auxiliary agents. Preservatives and other
additives may also be present such as, for example, anti-pathogenic
agents (e.g., antimicrobials, antibacterials, antivirals,
antifungals, etc.), antioxidants, chelating agents, and inert gases
and the like.
[0115] A peptidic compound of the invention can be administered
with any other known agent that reduces bone loss. Thus,
combination therapy is contemplated. Other agents that can be
administered with a peptide of the invention include, but are not
limited to, estrogen, calcitonin, vitamin D, fluoride, Ipriflavon,
and bisphosphonate. A peptide of the invention can be administered
simultaneously with (e.g., in admixture with, or in separate
formulations) another agent that reduces bone loss; or can be
administered within about 15 minutes, about 30 minutes, about 60
minutes, about 2 hours, about 5 hours, about 10 hours, about 12
hours, about 24 hours, about 36 hours, about 4 days, about 7 days,
or more, of another agent that reduces bone loss. In addition, two
or more peptides of The invention can be administered
simultaneously or within about 15 minutes, about 30 minutes, about
60 minutes, about 2 hours, about 5 hours, about 10 hours, about 12
hours, about 24 hours, about 36 hours, about 4 days, about 7 days,
or more of each other.
EXAMPLES
[0116] The following examples are put forth so as to provide those
of ordinary skill in the art with a complete disclosure and
description of how to make and use the present invention, and are
not intended to limit the scope of what the inventors regard as
their invention nor are they intended to represent that the
experiments below are all or the only experiments performed.
Efforts have been made to ensure accuracy with respect to numbers
used (e.g. amounts, temperature, etc.) but some experimental errors
and deviations should be accounted for. Unless indicated otherwise,
parts are parts by weight, molecular weight is weight average
molecular weight, temperature is in degrees Centigrade, and
pressure is at or near atmospheric.
Example 1
Synthesis of D-00001, etc
[0117] Six different peptides were manually synthesized by the
9-fluorenylmethoxycarbonyl (Fmoc) strategy and prepared in the
C-terminal amide form. The six peptides are as follows:
TABLE-US-00004 D-00001: IPSDFEGSGYTDLQE (SEQ ID NO: 44) D-00002:
DFEGSGYTDLQERGD (SEQ ID NO: 45) D-00003: YTDLQERGDNDISPF (SEQ ID
NO: 46) D-00004: ERGDNDISPFSGDGQ (SEQ ID NO: 47) D-00005:
NDISPFSGDGQPFKD (SEQ ID NO: 48) D-00006: TDLQERGDNDISPFSGDGQPFKD
(SEQ ID NO: 49) (C-terminus amidated)
[0118] Amino acid derivatives and resins were purchased from
Bachem, Inc., Torrance, Calif. and Novabiochem, La Jolla, Calif.
The respective amino acids were condensed manually in a stepwise
manner using 4-(2',4'-dimethoxyphenyl-Fmoc-aminomethyl)-phenoxy
resin. N-methylpyrrolidone was used during the synthesis as a
solvent. For condensation,
diisopropylcarbodiimide/N-hydroxybenzotriazole was employed, and
for deprotection of N.sup..alpha.-Fmoc groups, 20% piperidine in
N-methyl pyrrolidone was employed. The following side chain
protecting groups were used: Asn and Gin, trityl; Asp, Glu, Ser,
and Thr, t-butyl; Arg 2,2,5,7,8-pentamethylchroman-6-sulfonyl; and
Lys, t-butoxycarbonyl. Resulting protected peptide resins were
deprotected and cleaved from the resin using a trifluoroacetic
acid-thioanisole-m-cresol-ethanedithiol-H.sub.2O (80:5:5:5:5, v/v)
at 20.degree. C. for 2 h. Resulting crude peptides were
precipitated and washed with ethyl ether then purified by
reverse-phase high performance liquid chromatography (using Vaydac
5C18 column and a gradient of water/acetonitrile containing 0.1%
trifluoroacetic acid). All peptides were obtained with 5-20% yield
(from the starting resin). Purity of the peptides was confirmed by
analytical high performance liquid chromatography. Identity of the
peptides was confirmed by a Sciex API IIIE triple quadrupole ion
spray mass spectrometer.
Example 2
Fetal Mouse Calvarial Assay
Reagents
[0119] FGF-1 was purchased from Peprotech Inc. (Rocky Hill, NJ).
RGD-1, 2, 3, 4, 5 and 6 (referred to here as D-00001, D-00002,
D-00003, D-00004, D-00005 and D-00006) were provided by Dr. Nomizu
(Hokkaido University, Japan).
Mice
[0120] Pregnant ICR mice were purchased from SLC Japan Co. Ltd.
(Shizuoka, Japan).
Mouse Calvarial Organ Culture
[0121] Mouse calvarial organ culture was performed as described in
Mundy G et al. Science 286: 1946-1949, 1999 and Traianedes K et al.
Endocrinology 139: 3178-3184, 1998. The calvaria from 4-days-old
mice were excised and cut in half along the sagittal suture. Each
half of the calvaria was placed on a stainless steel grid in a
12-well tissue culture dish (Asahi Glass Techno Corp., Funabashi,
Japan). Each well contained 1.5 ml of BGj medium (Sigma, St. Louis,
Mo.) supplemented with 0.1% bovine serum albumin (Sigma) and each
compound. FGF-1 was used as a positive control as described by
Mundy et al. The medium was changed at day 1 and 4, and the assay
was terminated al day 7.
Histomorphometrical Analysis
[0122] Calvaria was fixed with 10% neutral-buffered formalin,
decalcified with 4.13% EDTA and embedded in paraffin. 4
mm-thickness sections were made and stained with hematoxylin and
eosin. New bone area was measured using Image-Pro Plus (Media
Cybernetics, Silver Spring, MID).
[0123] The six peptides of Example 1 were tested for their ability
to enhance bone growth with the tests being carried out as
described above in Example 2. The peptides which did not include
the RGD sequence did not show positive results. The other four
peptides showed positive results with the best results being
obtained with the sequences TABLE-US-00005 D-00004:
ERGDNDISPFSGDGQ, (SEQ ID NO: 47) and D-00006:
TDLQERGDNDISPFSGDGQPFKD. (SEQ ID NO: 49)
[0124] The best results are in FIG. 3 (specifically FIGS. 3C and
3D). Data from these results are graphically shown in FIG. 4.
Example 3
In Vivo Bone Formation Study
Reagents
[0125] FGF-1 was purchased from Peprotech Inc. (Rocky Hill, NJ).
RGD-6 (referred to here as D-00006) was synthesized by CS Bio (San
Carlos, Calif.) under the instruction of the inventors.
TABLE-US-00006 D-00006: LDLQERGDNDISPFSGDGQPFKD. (SEQ ID NO:
49)
Mice
[0126] Four week old mice were purchased from SLC Japan Co. Ltd.
(Shizuoka, Japan) and randomized to three groups (n=5).
Mouse Calvaria Growth Assay
[0127] D-00006 (20 .mu.g/kg/day), FGF-1 (12.5 .mu.g/kg/day), or
vehicle (saline) was subcutaneously injected into the soft tissues
adjacent to the calvariae of the test animals. The daily amount of
the samples were divided by two, respectively, and injected rice a
day for five days. Aster 15 days of the last administration, the
calvariae were excised and cut in half along the sagittal suture,
and provided to the Histomorphometrical analysis.
Histomorphometrical Analysis
[0128] Calvaria was fixed with 10% neutral-buffered formalin,
decalcified with 4.13% EDTA and embedded in paraffin. 4
mm-thickness sections were made and stained with hematoxylin and
eosin. New bone area was measured using Image-Pro Plus (Media
Cybernetics, Silver Spring, Md.).
Results
[0129] The calvaria sections from the animals treated with FGF-1
showed a significant expansion of bone area as compared to the
vehicle treated group. Those from the animals treated with D-00006
also demonstrated a significant expansion of bone area as compared
to the vehicle treated group and the efficacy was equivalent to
that of FGF-1. Data from these results are graphically shown in
FIG. 5.
Example 4
Effect of D-00006 on Renal Phosphate Excretion
Experimental Design and Treatments
[0130] Forty 3-month old virgin female Sprague-Dawley rats (Harlan
Sprague Dawley, Inc.) were acclimated for one week prior to
beginning the experiments. Following the acclimatization period,
the animal were randomized by initial body weight into treatment
groups outlined in Table 1. Ovx: ovariectomized; LD: low dose; HD:
high dose; Est: estradiol. D-00006 (TDLQERGDNDISPFSGDGQPFKD; SEQ ID
NO:49). TABLE-US-00007 TABLE I Group # of No. Description Treatment
Dose-Level Animals 1 Sham Vehicle -- 8 2 Ovx Vehicle -- 8 3 Ovx +
LD D-00006 20 .mu.g/kg/day 8 4 Ovx + HD D-00006 200 .mu.g/kg/day 8
5 Ovx + Est 17 .beta.-estradiol pellet 10 .mu.g/kg/day 8 implant
and vehicle
[0131] One day prior to the initiation of treatments, the animals
were anesthetized with a ketamin/xylazine anesthetic mixture, and
animals in groups 2-5 were ovariectomized.
[0132] Urine was collected in metabolic cages on Day 41. Blood and
urine samples were collected for chemistry and bone turnover
markers assays at the end of the 41-day treatment period. Prior to
urine and blood collections, the animals were placed in metabolic
cages and deprived of food for an overnight fast period of 18
hours. Urine samples were collected and the volumes recorded. The
urine samples were then centrifuges at approximately 3000.times.g
for 10 minutes in a refrigerated centrifuge. The samples were
filtered to remove contaminating sediments.
Serum and Urine Chemistry
[0133] Total serum calcium and creatinine levels were the same in
all treatment groups, except that the Ovx animals treated with
estradiol showed a slight increase in serum calcium. There was a
dose-dependent increase in serum phosphorus in the D-0006 treated
groups. Total urine volumes, collected over an 18-hour period, were
the same in all groups. FIG. 6 shows the derived urine
parameters.
[0134] The total amount of phosphorus in the 18-hour urine
collections showed a significant decrease in D-00006 treated
groups. As a result, D-00006 treated groups demonstrated lower
phosphate clearance and a higher percentage of tubular reabsorption
of phosphorus. D-00006 was clearly shown to be an agent that
conserves phosphorus in the circulation.
[0135] While the present invention has been described with
reference to the specific embodiments thereof, it should be
understood by those skilled in the art that various changes may be
made and equivalents may be substituted without departing from the
true spirit and scope of the invention. In addition, many
modifications may be made to adapt a particular situation,
material, composition of matter, process, process step or steps, to
the objective, spirit and scope of the present invention. All such
modifications are intended to be within the scope of the claims
appended hereto.
Sequence CWU 0
0
SEQUENCE LISTING <160> NUMBER OF SEQ ID NOS: 50 <210>
SEQ ID NO 1 <211> LENGTH: 97 <212> TYPE: PRT
<213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: peptidic compound <400>
SEQUENCE: 1 Asp Ser Gln Ala Gln Lys Ser Pro Val Lys Ser Lys Ser Thr
His Arg 1 5 10 15 Ile Gln His Asn Ile Asp Tyr Leu Lys His Leu Ser
Lys Val Lys Lys 20 25 30 Ile Pro Ser Asp Phe Glu Gly Ser Gly Tyr
Thr Asp Leu Gln Glu Arg 35 40 45 Gly Asp Asn Asp Ile Ser Pro Phe
Ser Gly Asp Gly Gln Pro Phe Lys 50 55 60 Asp Ile Pro Gly Lys Gly
Glu Ala Thr Gly Pro Asp Leu Glu Gly Lys 65 70 75 80 Asp Ile Gln Thr
Gly Phe Ala Gly Pro Ser Glu Ala Glu Ser Thr His 85 90 95 Leu
<210> SEQ ID NO 2 <211> LENGTH: 47 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: peptidic compound <400>
SEQUENCE: 2 Ala Gln Lys Ser Pro Val Lys Ser Lys Ser Thr His Arg Ile
Gln His 1 5 10 15 Asn Ile Asp Tyr Leu Lys His Leu Ser Lys Val Lys
Lys Ile Pro Ser 20 25 30 Asp Phe Glu Gly Ser Gly Tyr Thr Asp Leu
Gln Glu Arg Gly Asp 35 40 45 <210> SEQ ID NO 3 <211>
LENGTH: 47 <212> TYPE: PRT <213> ORGANISM: Artificial
Sequence <220> FEATURE: <223> OTHER INFORMATION:
peptidic compound <400> SEQUENCE: 3 Arg Gly Asp Ala Gln Lys
Ser Pro Val Lys Ser Lys Ser Thr His Arg 1 5 10 15 Ile Gln His Asn
Ile Asp Tyr Leu Lys His Leu Ser Lys Val Lys Lys 20 25 30 Ile Pro
Ser Asp Phe Glu Gly Ser Gly Tyr Thr Asp Leu Gln Glu 35 40 45
<210> SEQ ID NO 4 <211> LENGTH: 47 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: peptidic compound <400>
SEQUENCE: 4 Asp Ser Gln Ala Gln Lys Ser Pro Val Lys Ser Lys Ser Thr
His Arg 1 5 10 15 Ile Gln His Asn Ile Asp Tyr Leu Lys His Leu Ser
Lys Val Lys Lys 20 25 30 Ile Pro Ser Asp Phe Glu Gly Ser Gly Tyr
Thr Asp Arg Gly Asp 35 40 45 <210> SEQ ID NO 5 <211>
LENGTH: 44 <212> TYPE: PRT <213> ORGANISM: Artificial
Sequence <220> FEATURE: <223> OTHER INFORMATION:
peptidic compound <400> SEQUENCE: 5 Arg Gly Asp Ser Pro Val
Lys Ser Lys Ser Thr His Arg Ile Gln His 1 5 10 15 Asn Ile Asp Tyr
Leu Lys His Leu Ser Lys Val Lys Lys Ile Pro Ser 20 25 30 Asp Phe
Glu Gly Ser Gly Tyr Thr Asp Leu Gln Glu 35 40 <210> SEQ ID NO
6 <211> LENGTH: 44 <212> TYPE: PRT <213>
ORGANISM: Artificial Sequence <220> FEATURE: <223>
OTHER INFORMATION: peptidic compound <400> SEQUENCE: 6 Asp
Ser Gln Ala Gln Lys Ser Pro Val Lys Ser Lys Ser Thr His Arg 1 5 10
15 Ile Gln His Asn Ile Asp Tyr Leu Lys His Leu Ser Lys Val Lys Lys
20 25 30 Ile Pro Ser Asp Phe Glu Gly Ser Gly Arg Gly Asp 35 40
<210> SEQ ID NO 7 <211> LENGTH: 37 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: peptidic compound <400>
SEQUENCE: 7 Arg Gly Asp Thr His Arg Ile Gln His Asn Ile Asp Tyr Leu
Lys His 1 5 10 15 Leu Ser Lys Val Lys Lys Ile Pro Ser Asp Phe Glu
Gly Ser Gly Tyr 20 25 30 Thr Asp Leu Gln Glu 35 <210> SEQ ID
NO 8 <211> LENGTH: 41 <212> TYPE: PRT <213>
ORGANISM: Artificial Sequence <220> FEATURE: <223>
OTHER INFORMATION: peptidic compound <400> SEQUENCE: 8 Asp
Ser Gln Ala Gln Lys Ser Pro Val Lys Ser Lys Ser Thr His Arg 1 5 10
15 Ile Gln His Asn Ile Asp Tyr Leu Lys His Leu Ser Lys Val Lys Lys
20 25 30 Ile Pro Ser Asp Phe Glu Arg Gly Asp 35 40 <210> SEQ
ID NO 9 <211> LENGTH: 27 <212> TYPE: PRT <213>
ORGANISM: Artificial Sequence <220> FEATURE: <223>
OTHER INFORMATION: peptidic compound <400> SEQUENCE: 9 Arg
Gly Asp Leu Lys His Leu Ser Lys Val Lys Lys Ile Pro Ser Asp 1 5 10
15 Phe Glu Gly Ser Gly Tyr Thr Asp Leu Gln Glu 20 25 <210>
SEQ ID NO 10 <211> LENGTH: 38 <212> TYPE: PRT
<213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: peptidic compound <400>
SEQUENCE: 10 Asp Ser Gln Ala Gln Lys Ser Pro Val Lys Ser Lys Ser
Thr His Arg 1 5 10 15 Ile Gln His Asn Ile Asp Tyr Leu Lys His Leu
Ser Lys Val Lys Lys 20 25 30 Ile Pro Ser Arg Gly Asp 35 <210>
SEQ ID NO 11 <211> LENGTH: 24 <212> TYPE: PRT
<213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: peptidic compound <400>
SEQUENCE: 11 Arg Gly Asp Leu Ser Lys Val Lys Lys Ile Pro Ser Asp
Phe Glu Gly 1 5 10 15 Ser Gly Tyr Thr Asp Leu Gln Glu 20
<210> SEQ ID NO 12 <211> LENGTH: 32 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: peptidic compound <400>
SEQUENCE: 12 Asp Ser Gln Ala Gln Lys Ser Pro Val Lys Ser Lys Ser
Thr His Arg 1 5 10 15 Ile Gln His Asn Ile Asp Tyr Leu Lys His Leu
Ser Lys Arg Gly Asp 20 25 30 <210> SEQ ID NO 13 <211>
LENGTH: 21 <212> TYPE: PRT <213> ORGANISM: Artificial
Sequence <220> FEATURE: <223> OTHER INFORMATION:
peptidic compound <400> SEQUENCE: 13 Arg Gly Asp Val Lys Lys
Ile Pro Ser Asp Phe Glu Gly Ser Gly Tyr 1 5 10 15
Thr Asp Leu Gln Glu 20 <210> SEQ ID NO 14 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: peptidic
compound <400> SEQUENCE: 14 Asp Ser Gln Ala Gln Lys Ser Pro
Val Lys Ser Lys Ser Thr His Arg 1 5 10 15 Ile Gln His Asn Ile Asp
Tyr Leu Lys Arg Gly Asp 20 25 <210> SEQ ID NO 15 <211>
LENGTH: 18 <212> TYPE: PRT <213> ORGANISM: Artificial
Sequence <220> FEATURE: <223> OTHER INFORMATION:
peptidic compound <400> SEQUENCE: 15 Arg Gly Asp Ile Pro Ser
Asp Phe Glu Gly Ser Gly Tyr Thr Asp Leu 1 5 10 15 Gln Glu
<210> SEQ ID NO 16 <211> LENGTH: 25 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: peptidic compound <400>
SEQUENCE: 16 Asp Ser Gln Ala Gln Lys Ser Pro Val Lys Ser Lys Ser
Thr His Arg 1 5 10 15 Ile Gln His Asn Ile Asp Arg Gly Asp 20 25
<210> SEQ ID NO 17 <211> LENGTH: 15 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: peptidic compound <400>
SEQUENCE: 17 Arg Gly Asp Asp Phe Glu Gly Ser Gly Tyr Thr Asp Leu
Gln Glu 1 5 10 15 <210> SEQ ID NO 18 <211> LENGTH: 19
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: peptidic
compound <400> SEQUENCE: 18 Asp Ser Gln Ala Gln Lys Ser Pro
Val Lys Ser Lys Ser Thr His Arg 1 5 10 15 Arg Gly Asp <210>
SEQ ID NO 19 <211> LENGTH: 12 <212> TYPE: PRT
<213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: peptidic compound <400>
SEQUENCE: 19 Arg Gly Asp Gly Ser Gly Tyr Thr Asp Leu Gln Glu 1 5 10
<210> SEQ ID NO 20 <211> LENGTH: 13 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: peptidic compound <400>
SEQUENCE: 20 Asp Ser Gln Ala Gln Lys Ser Pro Val Lys Arg Gly Asp 1
5 10 <210> SEQ ID NO 21 <211> LENGTH: 10 <212>
TYPE: PRT <213> ORGANISM: Artificial Sequence <220>
FEATURE: <223> OTHER INFORMATION: peptidic compound
<400> SEQUENCE: 21 Arg Gly Asp Gly Tyr Thr Asp Leu Gln Glu 1
5 10 <210> SEQ ID NO 22 <211> LENGTH: 10 <212>
TYPE: PRT <213> ORGANISM: Artificial Sequence <220>
FEATURE: <223> OTHER INFORMATION: peptidic compound
<400> SEQUENCE: 22 Asp Ser Gln Ala Gln Lys Ser Arg Gly Asp 1
5 10 <210> SEQ ID NO 23 <211> LENGTH: 40 <212>
TYPE: PRT <213> ORGANISM: Artificial Sequence <220>
FEATURE: <223> OTHER INFORMATION: peptidic compound
<400> SEQUENCE: 23 Arg Gly Asp Asn Asp Ile Ser Pro Phe Ser
Gly Asp Gly Gln Pro Phe 1 5 10 15 Lys Asp Ile Pro Gly Lys Gly Glu
Ala Thr Gly Pro Asp Leu Glu Gly 20 25 30 Lys Asp Ile Gln Thr Gly
Phe Ala 35 40 <210> SEQ ID NO 24 <211> LENGTH: 40
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: peptidic
compound <400> SEQUENCE: 24 Asn Asp Ile Arg Gly Asp Ser Pro
Phe Ser Gly Asp Gly Gln Pro Phe 1 5 10 15 Lys Asp Ile Pro Gly Lys
Gly Glu Ala Thr Gly Pro Asp Leu Glu Gly 20 25 30 Lys Asp Ile Gln
Thr Gly Phe Ala 35 40 <210> SEQ ID NO 25 <211> LENGTH:
35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: peptidic
compound <400> SEQUENCE: 25 Asn Asp Ile Ser Pro Phe Arg Gly
Asp Ser Gly Asp Gly Gln Pro Phe 1 5 10 15 Lys Asp Ile Pro Gly Lys
Gly Glu Ala Thr Gly Pro Asp Leu Glu Gly 20 25 30 Lys Asp Ile 35
<210> SEQ ID NO 26 <211> LENGTH: 30 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: peptidic compound <400>
SEQUENCE: 26 Asn Asp Ile Ser Pro Phe Ser Gly Asp Arg Gly Asp Gly
Gln Pro Phe 1 5 10 15 Lys Asp Ile Pro Gly Lys Gly Glu Ala Thr Gly
Pro Asp Leu 20 25 30 <210> SEQ ID NO 27 <211> LENGTH:
45 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: peptidic
compound <400> SEQUENCE: 27 Phe Ser Gly Asp Gly Gln Pro Phe
Lys Asp Ile Pro Gly Lys Gly Glu 1 5 10 15 Ala Thr Gly Pro Asp Leu
Glu Gly Lys Asp Ile Gln Thr Gly Phe Ala 20 25 30 Gly Pro Ser Glu
Ala Glu Ser Arg Gly Asp Thr His Leu 35 40 45 <210> SEQ ID NO
28 <211> LENGTH: 35 <212> TYPE: PRT <213>
ORGANISM: Artificial Sequence <220> FEATURE: <223>
OTHER INFORMATION: peptidic compound <400> SEQUENCE: 28 Ile
Pro Gly Lys Gly Glu Ala Thr Gly Pro Asp Leu Glu Gly Lys Asp 1 5 10
15 Ile Gln Thr Gly Phe Ala Gly Pro Ser Glu Arg Gly Asp Ala Glu Ser
20 25 30 Thr His Leu 35 <210> SEQ ID NO 29 <211>
LENGTH: 30 <212> TYPE: PRT <213> ORGANISM: Artificial
Sequence <220> FEATURE: <223> OTHER INFORMATION:
peptidic compound <400> SEQUENCE: 29
Glu Ala Thr Gly Pro Asp Leu Glu Gly Lys Asp Ile Gln Thr Gly Phe 1 5
10 15 Ala Gly Arg Gly Asp Pro Ser Glu Ala Glu Ser Thr His Leu 20 25
30 <210> SEQ ID NO 30 <211> LENGTH: 33 <212>
TYPE: PRT <213> ORGANISM: Artificial Sequence <220>
FEATURE: <223> OTHER INFORMATION: peptidic compound
<400> SEQUENCE: 30 Asn Asp Ile Ser Pro Phe Ser Gly Asp Gly
Gln Pro Phe Lys Asp Arg 1 5 10 15 Gly Asp Ile Pro Gly Lys Gly Glu
Ala Thr Gly Pro Asp Leu Glu Gly 20 25 30 Lys <210> SEQ ID NO
31 <211> LENGTH: 33 <212> TYPE: PRT <213>
ORGANISM: Artificial Sequence <220> FEATURE: <223>
OTHER INFORMATION: peptidic compound <400> SEQUENCE: 31 Gly
Lys Gly Glu Ala Thr Gly Pro Asp Leu Glu Gly Lys Asp Ile Arg 1 5 10
15 Gly Asp Gln Thr Gly Phe Ala Gly Pro Ser Glu Ala Glu Ser Thr His
20 25 30 Leu <210> SEQ ID NO 32 <211> LENGTH: 40
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: peptidic
compound <400> SEQUENCE: 32 Phe Ser Gly Asp Gly Gln Pro Phe
Lys Asp Ile Pro Gly Lys Gly Glu 1 5 10 15 Ala Thr Gly Arg Gly Asp
Pro Asp Leu Glu Gly Lys Asp Ile Gln Thr 20 25 30 Gly Phe Ala Gly
Pro Ser Glu Ala 35 40 <210> SEQ ID NO 33 <211> LENGTH:
31 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: peptidic
compound <400> SEQUENCE: 33 Asp Gly Gln Pro Phe Lys Asp Ile
Pro Gly Lys Gly Glu Ala Thr Gly 1 5 10 15 Arg Gly Asp Pro Asp Leu
Glu Gly Lys Asp Ile Gln Thr Gly Phe 20 25 30 <210> SEQ ID NO
34 <211> LENGTH: 25 <212> TYPE: PRT <213>
ORGANISM: Artificial Sequence <220> FEATURE: <223>
OTHER INFORMATION: peptidic compound <400> SEQUENCE: 34 Pro
Phe Lys Asp Ile Pro Gly Lys Gly Glu Ala Thr Gly Arg Gly Asp 1 5 10
15 Pro Asp Leu Glu Gly Lys Asp Ile Gln 20 25 <210> SEQ ID NO
35 <211> LENGTH: 28 <212> TYPE: PRT <213>
ORGANISM: Artificial Sequence <220> FEATURE: <223>
OTHER INFORMATION: peptidic compound <400> SEQUENCE: 35 Asp
Ile Pro Gly Lys Gly Glu Ala Thr Gly Arg Gly Asp Pro Asp Leu 1 5 10
15 Glu Gly Lys Asp Ile Gln Thr Gly Phe Ala Gly Pro 20 25
<210> SEQ ID NO 36 <211> LENGTH: 31 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: peptidic compound <400>
SEQUENCE: 36 Asp Gly Gln Pro Phe Lys Asp Ile Pro Gly Lys Gly Glu
Ala Thr Gly 1 5 10 15 Arg Gly Asp Pro Asp Leu Glu Gly Lys Asp Ile
Gln Thr Gly Phe 20 25 30 <210> SEQ ID NO 37 <211>
LENGTH: 28 <212> TYPE: PRT <213> ORGANISM: Artificial
Sequence <220> FEATURE: <223> OTHER INFORMATION:
peptidic compound <400> SEQUENCE: 37 Gly Lys Gly Glu Ala Thr
Gly Arg Gly Asp Pro Asp Leu Glu Gly Lys 1 5 10 15 Asp Ile Gln Thr
Gly Phe Ala Gly Pro Ser Glu Ala 20 25 <210> SEQ ID NO 38
<211> LENGTH: 19 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: peptidic compound <400> SEQUENCE: 38 Glu Ala Thr
Gly Arg Gly Asp Pro Asp Leu Glu Gly Lys Asp Ile Gln 1 5 10 15 Thr
Gly Phe <210> SEQ ID NO 39 <211> LENGTH: 13 <212>
TYPE: PRT <213> ORGANISM: Artificial Sequence <220>
FEATURE: <223> OTHER INFORMATION: peptidic compound
<400> SEQUENCE: 39 Glu Ala Thr Gly Arg Gly Asp Pro Asp Leu
Glu Gly Lys 1 5 10 <210> SEQ ID NO 40 <211> LENGTH: 10
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: peptidic
compound <400> SEQUENCE: 40 Glu Ala Thr Gly Arg Gly Asp Pro
Asp Leu 1 5 10 <210> SEQ ID NO 41 <211> LENGTH: 4
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION:
glycosaminoglycan binding motif <400> SEQUENCE: 41 Ser Gly
Asp Gly 1 <210> SEQ ID NO 42 <211> LENGTH: 12
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: calcium binding
motif <400> SEQUENCE: 42 Asp Asn Asp Ile Ser Pro Phe Ser Gly
Asp Gly Gln 1 5 10 <210> SEQ ID NO 43 <211> LENGTH: 12
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: calcium-binding
motif <220> FEATURE: <221> NAME/KEY: VARIANT
<222> LOCATION: 2, 4, 6, 8, 10, 11 <223> OTHER
INFORMATION: Xaa = Any Amino Acid <400> SEQUENCE: 43 Asp Xaa
Asp Xaa Ser Xaa Phe Xaa Gly Xaa Xaa Gln 1 5 10 <210> SEQ ID
NO 44 <211> LENGTH: 15 <212> TYPE: PRT <213>
ORGANISM: Artificial Sequence <220> FEATURE: <223>
OTHER INFORMATION: D-00001 peptide <220> FEATURE: <221>
NAME/KEY: AMIDATION <222> LOCATION: 15 <400> SEQUENCE:
44 Ile Pro Ser Asp Phe Glu Gly Ser Gly Tyr Thr Asp Leu Gln Glu 1 5
10 15 <210> SEQ ID NO 45 <211> LENGTH: 15 <212>
TYPE: PRT <213> ORGANISM: Artificial Sequence <220>
FEATURE: <223> OTHER INFORMATION: D-00002 peptide <220>
FEATURE: <221> NAME/KEY: AMIDATION <222> LOCATION:
15
<400> SEQUENCE: 45 Asp Phe Glu Gly Ser Gly Tyr Thr Asp Leu
Gln Glu Arg Gly Asp 1 5 10 15 <210> SEQ ID NO 46 <211>
LENGTH: 15 <212> TYPE: PRT <213> ORGANISM: Artificial
Sequence <220> FEATURE: <223> OTHER INFORMATION:
D-00003 peptide <220> FEATURE: <221> NAME/KEY:
AMIDATION <222> LOCATION: 15 <400> SEQUENCE: 46 Tyr Thr
Asp Leu Gln Glu Arg Gly Asp Asn Asp Ile Ser Pro Phe 1 5 10 15
<210> SEQ ID NO 47 <211> LENGTH: 15 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: D-00004 peptide <220> FEATURE:
<221> NAME/KEY: AMIDATION <222> LOCATION: 15
<400> SEQUENCE: 47 Glu Arg Gly Asp Asn Asp Ile Ser Pro Phe
Ser Gly Asp Gly Gln 1 5 10 15 <210> SEQ ID NO 48 <211>
LENGTH: 15 <212> TYPE: PRT <213> ORGANISM: Artificial
Sequence <220> FEATURE: <223> OTHER INFORMATION:
D-00005 peptide <220> FEATURE: <221> NAME/KEY:
AMIDATION <222> LOCATION: 15 <400> SEQUENCE: 48 Asn Asp
Ile Ser Pro Phe Ser Gly Asp Gly Gln Pro Phe Lys Asp 1 5 10 15
<210> SEQ ID NO 49 <211> LENGTH: 23 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: D-00006 peptide <220> FEATURE:
<221> NAME/KEY: AMIDATION <222> LOCATION: 15
<400> SEQUENCE: 49 Thr Asp Leu Gln Glu Arg Gly Asp Asn Asp
Ile Ser Pro Phe Ser Gly 1 5 10 15 Asp Gly Gln Pro Phe Lys Asp 20
<210> SEQ ID NO 50 <211> LENGTH: 4 <212> TYPE:
PRT <213> ORGANISM: peptide <220> FEATURE: <221>
NAME/KEY: VARIANT <222> LOCATION: 3 <223> OTHER
INFORMATION: glycosaminoglycan binding motif <223> OTHER
INFORMATION: Xaa = Any Amino Acid <400> SEQUENCE: 50 Ser Gly
Xaa Gly 1
* * * * *