U.S. patent application number 11/434137 was filed with the patent office on 2006-09-21 for nucleic acids and proteins from streptococcus groups a & b.
This patent application is currently assigned to Novartis Vaccines and Diagnostics, Inc.. Invention is credited to Claire Fraser, Guido Grandi, Vega Masignani, Immaculada Margarit Y Ros, John Telford, Herve Tettelin.
Application Number | 20060210579 11/434137 |
Document ID | / |
Family ID | 27255953 |
Filed Date | 2006-09-21 |
United States Patent
Application |
20060210579 |
Kind Code |
A1 |
Telford; John ; et
al. |
September 21, 2006 |
Nucleic acids and proteins from streptococcus groups A & B
Abstract
The invention provides proteins from group B streptococcus
(Streptococcus agalactiae) and group A streptococcus (Streptococcus
pyogenes), including amino acid sequences and the corresponding
nucleotide sequences. Data are given to show that the proteins are
useful antigens for vaccines, immunogenic compositions, and/or
diagnostics. The proteins are also targets for antibiotics.
Inventors: |
Telford; John; (Siena,
IT) ; Masignani; Vega; (Siena, IT) ; Ros;
Immaculada Margarit Y; (Siena, IT) ; Grandi;
Guido; (Siena, IT) ; Fraser; Claire;
(Rockville, MD) ; Tettelin; Herve; (Rockville,
MD) |
Correspondence
Address: |
Chiron Corporation;Intellectual Property - R440
P.O. Box 8097
Emeryville
CA
94662-8097
US
|
Assignee: |
Novartis Vaccines and Diagnostics,
Inc.
Emeryville
CA
|
Family ID: |
27255953 |
Appl. No.: |
11/434137 |
Filed: |
May 16, 2006 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
10415182 |
Oct 14, 2003 |
|
|
|
PCT/GB01/04789 |
Oct 29, 2001 |
|
|
|
11434137 |
May 16, 2006 |
|
|
|
Current U.S.
Class: |
424/190.1 ;
424/201.1; 424/203.1; 435/252.3; 435/471; 435/69.1; 530/350;
536/23.7 |
Current CPC
Class: |
A61P 31/14 20180101;
C07K 16/1275 20130101; Y02A 50/464 20180101; A61P 21/00 20180101;
C07K 14/315 20130101; C07K 16/40 20130101; A61P 31/10 20180101;
A61P 29/02 20180101; A61K 38/00 20130101; A61K 39/00 20130101; C12N
9/1088 20130101; A61K 2039/53 20130101; Y02A 50/30 20180101; C12Y
205/01018 20130101; A61P 27/16 20180101; Y02A 50/466 20180101; A61P
31/12 20180101; A61P 15/00 20180101; A61K 2039/505 20130101; A61P
31/04 20180101; C07K 2319/00 20130101; A61P 1/02 20180101; A61K
39/092 20130101; A61P 43/00 20180101; A61P 33/02 20180101; A61P
37/04 20180101 |
Class at
Publication: |
424/190.1 ;
530/350; 424/201.1; 424/203.1; 435/006; 435/069.1; 435/252.3;
435/471; 536/023.7 |
International
Class: |
C12Q 1/68 20060101
C12Q001/68; C07H 21/04 20060101 C07H021/04; C12P 21/06 20060101
C12P021/06; A61K 39/02 20060101 A61K039/02; A61K 39/295 20060101
A61K039/295; A61K 39/116 20060101 A61K039/116; C12N 1/21 20060101
C12N001/21; C07K 14/315 20060101 C07K014/315; C12N 15/74 20060101
C12N015/74 |
Foreign Application Data
Date |
Code |
Application Number |
Oct 27, 2000 |
GB |
0026333.5 |
Nov 24, 2000 |
GB |
0028727.6 |
Mar 7, 2001 |
GB |
0105640.7 |
Claims
1. A protein comprising the amino acid sequence SEQ ID NO:7276.
2. A protein having 50% or greater sequence identity to the protein
of claim 1.
3. A protein comprising a fragment of 7 or more consecutive amino
acids from the amino acid sequence SEQ ID NO:7276.
4. An antibody which binds to a protein selected from the group
consisting of: (a) a protein comprising the amino acid sequence SEQ
ID NO:7276; (b) a protein having 50% or greater sequence identity
to (a); and (c) a protein comprising a fragment of 7 or more
consecutive amino acids from the amino acid sequence SEQ ID
NO:7276.
5. The antibody of claim 4 which is a monoclonal antibody, a
chimeric antibody, a humanized antibody, or a fully human
antibody.
6. A nucleic acid molecule which encodes a protein selected from
the group consisting of: (a) a protein comprising the amino acid
sequence SEQ ID NO:7276; (b) a protein having 50% or greater
sequence identity to (a); and (c) a protein comprising a fragment
of 7 or more consecutive amino acids from the amino acid sequence
SEQ ID NO:7276, or the complement thereof.
7. The nucleic acid molecule of claim 6 comprising the nucleotide
sequence SEQ ID NO:7275.
8. A nucleic acid molecule comprising a fragment of 10 or more
consecutive nucleotides from the nucleotide sequence SEQ ID NO:7275
or the complement thereof.
9. A nucleic acid molecule comprising a nucleotide sequence having
50% or greater sequence identity to the nucleic acid sequence SEQ
ID NO:7275 or the complement thereof.
10. A nucleic acid molecule which can hybridize under stringent
conditions to a nucleic acid molecule encoding a protein selected
from the group consisting of: (a) a protein comprising the amino
acid sequence SEQ ID NO:7276; (b) a protein having 50% or greater
sequence identity to (a); and (c) a protein comprising a fragment
of 7 or more consecutive amino acids from the amino acid sequence
SEQ ID NO:7276, or the complement thereof.
11. A composition comprising an active agent selected from the
group consisting of: (a) a protein comprising the amino acid
sequence SEQ ID NO:7276; (b) a protein having 50% or greater
sequence identity to (a); (c) a protein comprising a fragment of 7
or more consecutive amino acids from the amino acid sequence SEQ ID
NO: 7276; (d) an antibody which binds to (a), (b), or (c); (e) a
nucleic acid molecule which encodes (a), (b), or (c) or the
complement thereof; (f) a nucleic acid molecule comprising a
fragment of 10 or more consecutive nucleotides from the nucleotide
sequence SEQ ID NO:7275 or the complement thereof; (g) a nucleic
acid molecule comprising a nucleotide sequence having 50% or
greater sequence identity to (e) or (f); and (h) a nucleic acid
molecule which can hybridize to (e), (f), or (g) under high
stringency conditions.
12. The composition of claim 11 which is an immunogenic
composition, a vaccine composition, or a diagnostic
composition.
13. A method of treatment, comprising administering to a patient in
need thereof a therapeutically effective amount of the composition
of claim 11.
14. A hybrid protein represented by the formula
NH.sub.2-A-[-X-L-].sub.n-B-COOH, wherein X is the amino acid
sequence SEQ ID NO:7276, L is an optional linker amino acid
sequence, A is an optional N-terminal amino acid sequence, B is an
optional C-terminal amino acid sequence, and n is an integer
greater than 1.
15. A kit comprising primers for amplifying a template sequence
contained with a Streptococcus nucleic acid sequence, the kit
comprising a first primer and a second primer, wherein the first
primer is substantially complementary to the template sequence and
the second primer is substantially complementary to a complement of
the template sequence, wherein the parts of the primers which have
substantial complementarity defme the termini of the template
sequence to be amplified, wherein the template sequence comprises
SEQ ID NO:7275.
16. A kit comprising first and second single-stranded
oligonucleotides which allow amplification of a Streptococcus
template nucleic acid sequence contained in a single- or
double-stranded nucleic acid (or mixture thereof), wherein: (a) the
first oligonucleotide comprises a primer sequence which is
substantially complementary to said template nucleic acid sequence;
(b) the second oligonucleotide comprises a primer sequence which is
substantially complementary to the complement of said template
nucleic acid sequence; (c) the first oligonucleotide and/or the
second oligonucleotide comprise(s) sequence which is not
compementary to said template nucleic acid; and (d) said primer
sequences define the termini of the template sequence to be
amplified, wherein the template sequence comprises SEQ ID
NO:7275.
17. The kit of claim 16, wherein the non-complementary sequence(s)
of (c) comprise a restriction site and/or a promoter sequence.
18. A computer-readable medium containing one or both of SEQ ID
NOS: 7276 and 7275.
19. A process for detecting Streptococcus in a biological sample,
comprising the step of contacting under hybridizing conditions a
nucleic acid selected from the group consisting of: (a) a nucleic
acid molecule which encodes a protein selected from the group
consisting of: (1) a protein comprising the amino acid sequence SEQ
ID NO:7276; (2) a protein having 50% or greater sequence identity
to (1); and (3) a protein comprising a fragment of 7 or more
consecutive amino acids from the amino acid sequence SEQ ID
NO:7276, or the complement thereof; (b) a nucleic acid molecule
comprising the nucleotide sequence SEQ ID NO:7275; (c) a nucleic
acid molecule comprising a fragment of 10 or more consecutive
nucleotides from the nucleotide sequence SEQ ID NO:7275 or the
complement thereof; and (d) a nucleic acid molecule comprising a
nucleotide sequence having 50% or greater sequence identity to the
nucleotide sequence SEQ ID NO:7275 or the complement thereof.
20. The process of claim 19, wherein the process involves nucleic
acid amplification.
21. A process for determining whether a compound binds to a protein
selected from the group consisting of: (a) a protein comprising the
amino acid sequence SEQ ID NO:7276; (b) a protein having 50% or
greater sequence identity to (a); and (c) a protein comprising a
fragment of 7 or more consecutive amino acids from the amino acid
sequence SEQ ID NO:7276, comprising contacting a test compound with
the protein and determining whether the test compound binds to the
protein.
22. A composition comprising: (a) a protein selected from the group
consisting of: (1) a protein comprising the amino acid sequence SEQ
ID NO:7276; (2) a protein having 50% or greater sequence identity
to (1); and (3) a protein comprising a fragment of 7 or more
consecutive amino acids from the amino acid sequence SEQ ID
NO:7276; and (b) one or more of the following antigens: a protein
antigen from Helicobacter pylori; a protein antigen from
N.meningitidis serogroup B; an outer-membrane vesicle (OMV)
preparation from N.meningitidis serogroup B; a saccharide antigen
from N.meningitidis serogroup A, C, W135 and/or Y; a saccharide
antigen from Streptococcus pneumoniae; an antigen from hepatitis A
virus; an antigen from hepatitis B virus; an antigen from hepatitis
C virus; an antigen from Bordetella pertussis; a diphtheria
antigen; a tetanus antigen; a saccharide antigen from Haemophilus
influenzae B. an antigen from N.gonorrhoeae; an antigen from
Chlamydia pneumoniae; an antigen from Chlamydia trachomatis; an
antigen from Porphyromonas gingivalis; polio antigen(s); rabies
antigen(s); measles, mumps and/or rubella antigens; influenza
antigen(s); an antigen from Moraxella catarrhalis; and/or an
antigen from Staphylococcus aureus.
23. A composition comprising two or more proteins, wherein each
protein is a protein selected from the group consisting of: (a) a
protein comprising the amino acid sequence SEQ ID NO:7276; (b) a
protein having 50% or greater sequence identity to (a); and (c) a
protein comprising a fragment of 7 or more consecutive amino acids
from the amino acid sequence SEQ ID NO:7276.
Description
[0001] This application is a continuation of Ser. No. 10/415,182
filed Apr. 28, 2003. Ser. No. 10/415,182 is a National Stage
application of PCT application PCT/GB01/04789, which was filed Oct.
29, 2001 and published in English under PCT Article 21(2) on May 2,
2002. PCT/GB01/04789 claims the benefit of Ser. No. GB0026333.5
filed Oct. 27, 2000, Ser. No. GB0028727.6 filed Nov. 24, 2000, and
Ser. No. GB0105640.7 filed Mar. 7, 2001. Each of these applications
and all the other documents cited herein are incorporated by
reference in their entireties.
[0002] This application incorporates by reference the contents of
each of two duplicate CD-ROMS which contain an identical 21.0 MB
file labeled "PP016620.0025 sequence listing.txt," which is the
sequence listing for this application. The CD-ROMs were created on
Mar. 20, 2006.
TECHNICAL FIELD
[0003] This invention relates to nucleic acid and proteins from the
bacteria Streptococcus agalactiae (GBS) and Streptococcus pyogenes
(GAS).
BACKGROUND ART
[0004] Once thought to infect only cows, the Gram-positive
bacterium Streptococcus agalactiae (or "group B streptococcus",
abbreviated to "GBS") is now known to cause serious disease,
bacteremia and meningitis, in immunocompromised individuals and in
neonates. There are two types of neonatal infection. The first
(early onset, usually within 5 days of birth) is manifested by
bacteremia and pneumonia. It is contracted vertically as a baby
passes through the birth canal. GBS colonises the vagina of about
25% of young women, and approximately 1% of infants born via a
vaginal birth to colonised mothers will become infected. Mortality
is between 50-70%. The second is a meningitis that occurs 10 to 60
days after birth. If pregnant women are vaccinated with type III
capsule so that the infants are passively immunised, the incidence
of the late onset meningitis is reduced but is not entirely
eliminated.
[0005] The "B" in "GBS" refers to the Lancefield classification,
which is based on the antigenicity of a carbohydrate which is
soluble in dilute acid and called the C carbohydrate. Lancefield
identified 13 types of C carbohydrate, designated A to O, that
could be serologically differentiated. The organisms that most
commonly infect humans are found in groups A, B, D, and G. Within
group B, strains can be divided into 8 serotypes (Ia, Ib, Ia/c, II,
III, IV, V, and VI) based on the structure of their polysaccharide
capsule.
[0006] Group A streptococcus ("GAS", S.pyogenes) is a frequent
human pathogen, estimated to be present in between 5-15% of normal
individuals without signs of disease. When host defences are
compromised, or when the organism is able to exert its virulence,
or when it is introduced to vulnerable tissues or hosts, however,
an acute infection occurs. Diseases include puerperal fever,
scarlet fever, erysipelas, pharyngitis, impetigo, necrotising
fasciitis, myositis and streptococcal toxic shock syndrome.
[0007] S.pyogenes is typically treated using antibiotics. Although
S.agalactiae is inhibited by antibiotics, however, it is not killed
by penicillin as easily as GAS. Prophylactic vaccination is thus
preferable.
[0008] Current GBS vaccines are based on polysaccharide antigens,
although these suffer from poor immunogenicity. Anti-idiotypic
approaches have also been used (e.g. WO99/54457). There remains a
need, however, for effective adult vaccines against S.agalactiae
infection. There also remains a need for vaccines against
S.pyogenes infection.
[0009] It is an object of the invention to provide proteins which
can be used in the development of such vaccines. The proteins may
also be useful for diagnostic purposes, and as targets for
antibiotics.
BRIEF DESCRIPTION OF DRAWINGS
[0010] FIG. 1A shows the pDEST15 vector. FIG. 1B shows the
pDEST17-1 vector.
DETAILED DESCRIPTION
[0011] The invention provides proteins comprising the S.agalactiae
amino acid sequences disclosed in the examples, and proteins
comprising the S.pyogenes amino acid sequences disclosed in the
examples. These amino acid sequences are the even SEQ ID NOS:
between 1 and 10960.
[0012] It also provides proteins comprising amino acid sequences
having sequence identity to the S.agalactiae amino acid sequences
disclosed in the examples, and proteins comprising amino acid
sequences having sequence identity to the S.pyogenes amino acid
sequences disclosed in the examples. Depending on the particular
sequence, the degree of sequence identity is preferably greater
than 50% (e.g. 60%, 70%, 80%, 90%, 95%, 99% or more). These
proteins include homologs, orthologs, allelic variants and
functional mutants. Typically, 50% identity or more between two
proteins is considered to be an indication of functional
equivalence. Identity between proteins is preferably determined by
the Smith-Waterman homology search algorithm as implemented in the
MPSRCH program (Oxford Molecular), using an affine gap search with
parameters gap open penalty=12 and gap extension penalty=1.
[0013] A preferred protein of the invention is GAS16 (SEQ ID
NO:7276).
[0014] The invention further provides proteins comprising fragments
of the S.agalactiae amino acid sequences disclosed in the examples,
and proteins comprising fragments of the S.pyogenes amino acid
sequences disclosed in the examples. The fragments should comprise
at least n consecutive amino acids from the sequences and,
depending on the particular sequence, n is 7 or more (e.g. 8, 10,
12, 14, 16, 18, 20, 30, 40, 50, 60, 70, 80, 90, 100 or more).
Preferably the fragments comprise one or more epitopes from the
sequence. Other preferred fragments are (a) the N-terminal signal
peptides of the proteins disclosed in the examples, (b) the
proteins disclosed in the examples, but without their N-terminal
signal peptides, (c) fragments common to the related GAS and GBS
proteins disclosed in the examples, and (d) the proteins disclosed
in the examples, but without their N-terminal amino acid
residue.
[0015] The proteins of the invention can, of course, be prepared by
various means (e.g. recombinant expression, purification from GAS
or GBS, chemical synthesis etc.) and in various forms (e.g. native,
fusions, glycosylated, non-glycosylated etc.). They are preferably
prepared in substantially pure form (i.e. substantially free from
other streptococcal or host cell proteins) or substantially
isolated form. Proteins of the invention are preferably
streptococcal proteins.
[0016] According to a further aspect, the invention provides
antibodies which bind to these proteins. These may be polyclonal or
monoclonal and may be produced by any suitable means (e.g. by
recombinant expression). To increase compatibility with the human
immune system, the antibodies may be chimeric or humanised (e.g.
Breedveld (2000) Lancet 355(9205):735-740; Gorman & Clark
(1990) Semin. Immunol. 2:457-466), or fully human antibodies may be
used. The antibodies may include a detectable label (e.g. for
diagnostic assays).
[0017] According to a further aspect, the invention provides
nucleic acid comprising the S.agalactiae nucleotide sequences
disclosed in the examples, and nucleic acid comprising the
S.pyogenes nucleotide sequences disclosed in the examples. These
nucleic acid sequences are the odd SEQ ID NOS: between 1 and
10966.
[0018] In addition, the invention provides nucleic acid comprising
nucleotide sequences having sequence identity to the S.agalactiae
nucleotide sequences disclosed in the examples, and nucleic acid
comprising nucleotide sequences having sequence identity to the
S.pyogenes nucleotide sequences disclosed in the examples. Identity
between sequences is preferably determined by the Smith-Waterman
homology search algorithm as described above.
[0019] Furthermore, the invention provides nucleic acid which can
hybridise to the S.agalactiae nucleic acid disclosed in the
examples, and nucleic acid which can hybridise to the S.pyogenes
nucleic acid disclosed in the examples preferably under `high
stringency` conditions (e.g. 65.degree. C. in 0.1.times.SSC, 0.5%
SDS solution).
[0020] Nucleic acid comprising fragments of these sequences are
also provided. These should comprise at least n consecutive
nucleotides from the S.agalactiae or S.pyogenes sequences and,
depending on the particular sequence, n is 10 or more (e.g. 12, 14,
15, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200 or
more). The fragments may comprise sequences which are common to the
related GAS and GBS sequences disclosed in the examples.
[0021] According to a further aspect, the invention provides
nucleic acid encoding the proteins and protein fragments of the
invention.
[0022] The invention also provides: nucleic acid comprising
nucleotide sequence SEQ ID NO:7275; nucleic acid comprising
nucleotide sequences having sequence identity to SEQ ID NO:7275;
nucleic acid which can hybridise to SEQ ID NO:7275 (preferably
under `high stringency` conditions); nucleic acid comprising a
fragment of at least n consecutive nucleotides from SEQ ID NO:7275,
wherein n is 10 or more e.g. 12, 14, 15, 18, 20, 25, 30, 35, 40,
50, 60, 70, 80, 90, 100, 150, 200, 250, 300, 350, 400, 450, 500,
600, 700, 800, 900, 1000, 1500, 2000, 3000, 4000, 5000, 10000,
100000, 1000000 or more.
[0023] Nucleic acids of the invention can be used in hybridisation
reactions (e.g. Northern or Southern blots, or in nucleic acid
microarrays or `gene chips`) and amplification reactions (e.g. PCR,
SDA, SSSR, LCR, TMA, NASBA etc.) and other nucleic acid
techniques.
[0024] It should also be appreciated that the invention provides
nucleic acid comprising sequences complementary to those described
above (e.g. for antisense or probing, or for use as primers).
[0025] Nucleic acid according to the invention can, of course, be
prepared in many ways (e.g. by chemical synthesis, from genomic or
cDNA libraries, from the organism itself etc.) and can take various
forms (e.g. single stranded, double stranded, vectors, primers,
probes, labelled etc.). The nucleic acid is preferably in
substantially isolated form.
[0026] Nucleic acid according to the invention may be labelled e.g.
with a radioactive or fluorescent label. This is particularly
useful where the nucleic acid is to be used in nucleic acid
detection techniques e.g. where the nucleic acid is a primer or as
a probe for use in techniques such as PCR, LCR, TMA, NASBA etc.
[0027] In addition, the term "nucleic acid" includes DNA and RNA,
and also their analogues, such as those containing modified
backbones, and also peptide nucleic acids (PNA) etc.
[0028] According to a further aspect, the invention provides
vectors comprising nucleotide sequences of the invention (e.g.
cloning or expression vectors) and host cells transformed with such
vectors.
[0029] According to a further aspect, the invention provides
compositions comprising protein, antibody, and/or nucleic acid
according to the invention. These compositions may be suitable as
immunogenic compositions, for instance, or as diagnostic reagents,
or as vaccines.
[0030] The invention also provides nucleic acid, protein, or
antibody according to the invention for use as medicaments (e.g. as
immunogenic compositions or as vaccines) or as diagnostic reagents.
It also provides the use of nucleic acid, protein, or antibody
according to the invention in the manufacture of: (i) a medicament
for treating or preventing disease and/or infection caused by
streptococcus; (ii) a diagnostic reagent for detecting the presence
of streptococcus or of antibodies raised against streptococcus;
and/or (iii) a reagent which can raise antibodies against
streptococcus. Said streptococcus may be any species, group or
strain, but is preferably S.agalactiae, especially serotype III or
V, or S.pyogenes. Said disease may be bacteremia, meningitis,
puerperal fever, scarlet fever, erysipelas, pharyngitis, impetigo,
necrotising fasciitis, myositis or toxic shock syndrome.
[0031] The invention also provides a method of treating a patient,
comprising administering to the patient a therapeutically effective
amount of nucleic acid, protein, and/or antibody of the invention.
The patient may either be at risk from the disease themselves or
may be a pregnant woman (`maternal immunisation` e.g. Glezen &
Alpers (1999) Clin. Infect. Dis. 28:219-224).
[0032] Administration of protein antigens is a preferred method of
treatment for inducing immunity.
[0033] Administration of antibodies of the invention is another
preferred method of treatment. This method of passive immunisation
is particularly useful for newborn children or for pregnant women.
This method will typically use monoclonal antibodies, which will be
humanised or fully human.
[0034] The invention also provides a kit comprising primers (e.g.
PCR primers) for amplifying a template sequence contained within a
Streptococcus (e.g. S.pyogenes or S.agalactiae) nucleic acid
sequence, the kit comprising a first primer and a second primer,
wherein the first primer is substantially complementary to said
template sequence and the second primer is substantially
complementary to a complement of said template sequence, wherein
the parts of said primers which have substantial complementarity
define the termini of the template sequence to be amplified. The
first primer and/or the second primer may include a detectable
label (e.g. a fluorescent label).
[0035] The invention also provides a kit comprising first and
second single-stranded oligonucleotides which allow amplification
of a Streptococcus template nucleic acid sequence contained in a
single- or double-stranded nucleic acid (or mixture thereof),
wherein: (a) the first oligonucleotide comprises a primer sequence
which is substantially complementary to said template nucleic acid
sequence; (b) the second oligonucleotide comprises a primer
sequence which is substantially complementary to the complement of
said template nucleic acid sequence; (c) the first oligonucleotide
and/or the second oligonucleotide comprise(s) sequence which is not
complementary to said template nucleic acid; and (d) said primer
sequences define the termini of the template sequence to be
amplified. The non-complementary sequence(s) of feature (c) are
preferably upstream of (i.e. 5' to) the primer sequences. One or
both of these (c) sequences may comprise a restriction site (e.g.
EP-B-0509612) or a promoter sequence (e.g. EP-B-0505012). The first
oligonucleotide and/or the second oligonucleotide may include a
detectable label (e.g. a fluorescent label).
[0036] The template sequence may be any part of a genome sequence
(e.g. SEQ ID NO:7275). For example, it could be a rRNA gene (e.g.
Turenne et al. (2000) J. Clin. Microbiol. 38:513-520; SEQ ID NOS:
12018-12024 herein) or a protein-coding gene. The template sequence
is preferably specific to GBS.
[0037] The invention also provides a computer-readable medium (e.g.
a floppy disk, a hard disk, a CD-ROM, a DVD etc.) and/or a computer
database containing one or more of the sequences in the sequence
listing. The medium preferably contains one or both of SEQ ID NOS:
7276 and 7275.
[0038] The invention also provides a hybrid protein represented by
the formula NH.sub.2-A-[-X-L-].sub.n-B-COOH, wherein X is a protein
of the invention, L is an optional linker amino acid sequence, A is
an optional N-terminal amino acid sequence, B is an optional
C-terminal amino acid sequence, and n is an integer greater than 1.
The value of n is between 2 and x, and the value of x is typically
3, 4, 5, 6, 7, 8, 9 or 10. Preferably n is 2, 3 or 4; it is more
preferably 2 or 3; most preferably, n=2. For each n instances, -X-
may be the same or different. For each n instances of [-X-L-],
linker amino acid sequence -L- may be present or absent. For
instance, when n=2 the hybrid may be
NH.sub.2-X.sub.1-L.sub.1-X.sub.2-L.sub.2 -COOH,
NH.sub.2-X.sub.1-X.sub.2-COOH,
NH.sub.2-X.sub.1-L.sub.1-X.sub.2-COOH,
NH.sub.2-X.sub.1-X.sub.2-L.sub.2-COOH, etc. Linker amino acid
sequence(s) -L- will typically be short (e.g. 20 or fewer amino
acids i.e. 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5,
4, 3, 2, 1). Examples include short peptide sequences which
facilitate cloning, poly-glycine linkers (i.e. Gly.sub.n where n=2,
3, 4, 5, 6, 7, 8, 9, 10 or more), and histidine tags (i.e.
His.sub.n where n=3, 4, 5, 6, 7, 8, 9, 10 or more). Other suitable
linker amino acid sequences will be apparent to those skilled in
the art. -A- and -B- are optional sequences which will typically be
short (e.g. 40 or fewer amino acids i.e. 39, 38, 37, 36, 35, 34,
33, 32, 31, 30, 29, 28, 27, 26, 25, 24, 23, 22, 21, 20, 19, 18, 17,
16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1). Examples
include leader sequences to direct protein trafficking, or short
peptide sequences which facilitate cloning or purification (e.g.
histidine tags i.e. His.sub.n where n=3, 4, 5, 6, 7, 8, 9, 10 or
more). Other suitable N-terminal and C-terminal amino acid
sequences will be apparent to those skilled in the art. In some
embodiments, each X will be a GBS sequence; in others, mixtures of
GAS and GBS will be used.
[0039] According to further aspects, the invention provides various
processes.
[0040] A process for producing proteins of the invention is
provided, comprising the step of culturing a host cell of to the
invention under conditions which induce protein expression.
[0041] A process for producing protein or nucleic acid of the
invention is provided, wherein the protein or nucleic acid is
synthesised in part or in whole using chemical means.
[0042] A process for detecting polynucleotides of the invention is
provided, comprising the steps of: (a) contacting a nucleic probe
according to the invention with a biological sample under
hybridising conditions to form duplexes; and (b) detecting said
duplexes.
[0043] A process for detecting Streptococcus in a biological sample
(e.g. blood) is also provided, comprising the step of contacting
nucleic acid according to the invention with the biological sample
under hybridising conditions. The process may involve nucleic acid
amplification (e.g. PCR, SDA, SSSR, LCR, TMA, NASBA etc.) or
hybridisation (e.g. microarrays, blots, hybridisation with a probe
in solution etc.). PCR detection of Streptococcus in clinical
samples, in particular S.pyogenes, has been reported [see e.g.
Louie et al. (2000) CMAJ 163:301-309; Louie et al. (1998) J. Clin.
Microbiol. 36:1769-1771]. Clinical assays based on nucleic acid are
described in general in Tang et al. (1997) Clin. Chem.
43:2021-2038.
[0044] A process for detecting proteins of the invention is
provided, comprising the steps of: (a) contacting an antibody of
the invention with a biological sample under conditions suitable
for the formation of an antibody-antigen complexes; and (b)
detecting said complexes.
[0045] A process for identifying an amino acid sequence is
provided, comprising the step of searching for putative open
reading frames or protein-coding regions within a genome sequence
of S.agalactiae. This will typically involve in silico searching
the sequence for an initiation codon and for an in-frame
termination codon in the downstream sequence. The region between
these initiation and termination codons is a putative
protein-coding sequence. Typically, all six possible reading frames
will be searched. Suitable software for such analysis includes
ORFFINDER (NCBI), GENEMARK [Borodovsky & McIninch (1993)
Computers Chem. 17:122-133), GLIMMER [Salzberg et al. (1998)
Nucleic Acids Res. 26:544-548; Salzberg et al. (1999) Genomics
59:24-31; Delcher et al. (1999) Nucleic Acids Res. 27:4636-4641],
or other software which uses Markov models [e.g. Shmatkov et al.
(1999) Bioinformatics 15:874-876]. The invention also provides a
protein comprising the identified amino acid sequence. These
proteins can then expressed using conventional techniques.
[0046] The invention also provides a process for determining
whether a test compound binds to a protein of the invention. If a
test compound binds to a protein of the invention and this binding
inhibits the life cycle of the GBS bacterium, then the test
compound can be used as an antibiotic or as a lead compound for the
design of antibiotics. The process will typically comprise the
steps of contacting a test compound with a protein of the
invention, and determining whether the test compound binds to said
protein. Preferred proteins of the invention for use in these
processes are enzymes (e.g. tRNA synthetases), membrane
transporters and ribosomal proteins. Suitable test compounds
include proteins, polypeptides, carbohydrates, lipids, nucleic
acids (e.g. DNA, RNA, and modified forms thereof), as well as small
organic compounds (e.g. MW between 200 and 2000 Da). The test
compounds may be provided individually, but will typically be part
of a library (e.g. a combinatorial library). Methods for detecting
a binding interaction include NMR, filter-binding assays,
gel-retardation assays, displacement assays, surface plasmon
resonance, reverse two-hybrid etc. A compound which binds to a
protein of the invention can be tested for antibiotic activity by
contacting the compound with GBS bacteria and then monitoring for
inhibition of growth. The invention also provides a compound
identified using these methods.
[0047] The invention also provides a composition comprising a
protein or the invention and one or more of the following antigens:
[0048] a protein antigen from Helicobacter pylori such as VacA,
CagA, NAP, HopX, HopY [e.g. WO98/04702] and/or urease. [0049] a
protein antigen from N.meningitidis serogroup B, such as those in
WO99/24578, WO99/36544, WO99/57280, WO00/22430, Tettelin et al.
(2000) Science 287:1809-1815, Pizza et al. (2000) Science
287:1816-1820 and WO96/29412, with protein `287` and derivatives
being particularly preferred. [0050] an outer-membrane vesicle
(OMV) preparation from N.meningitidis serogroup B, such as those
disclosed in WO01/52885; Bjune et al. (1991) Lancet
338(8775):1093-1096; Fukasawa et al. (1999) Vaccine 17:2951-2958;
Rosenqvist et al. (1998) Dev. Biol. Stand. 92:323-333 etc. [0051] a
saccharide antigen from N.meningitidis serogroup A, C, W135 and/or
Y, such as the oligosaccharide disclosed in Costantino et al.
(1992) Vaccine 10:691-698from serogroup C [see also Costantino et
al. (1999) Vaccine 17:1251-1263]. [0052] a saccharide antigen from
Streptococcus pneumoniae [e.g. Watson (2000) Pediatr Infect Dis J
19:331-332; Rubin (2000) Pediatr Clin North Am 47:269-285, v;
Jedrzejas (2001) Microbiol Mol Biol Rev 65:187-207]. [0053] an
antigen from hepatitis A virus, such as inactivated virus [e.g.
Bell (2000) Pediatr Infect Dis J 19:1187-1188; Iwarson (1995) APMIS
103:321-326]. [0054] an antigen from hepatitis B virus, such as the
surface and/or core antigens [e.g. Gerlich et al. (1990) Vaccine 8
Suppl:S63-68 & 79-80]. [0055] an antigen from hepatitis C virus
[e.g. Hsu et al. (1999) Clin Liver Dis 3:901-915]. [0056] an
antigen from Bordetella pertussis, such as pertussis holotoxin (PT)
and filamentous haemagglutinin (FHA) from B.pertussis, optionally
also in combination with pertactin and/or agglutinogens 2 and 3
[e.g. Gustafsson et al. (1996) N. Engl. J. Med. 334:349-355;
Rappuoli et al. (1991) TIBTECH9:232-238]. [0057] a diphtheria
antigen, such as a diphtheria toxoid [e.g. chapter 3 of Vaccines
(1988) eds. Plotkin & Mortimer. ISBN 0-7216-1946-0] e.g. the
CRM.sub.197 mutant [e.g. Del Guidice et al. (1998) Molecular
Aspects of Medicine 19:1-70]. [0058] a tetanus antigen, such as a
tetanus toxoid [e.g. chapter 4 of Plotkin & Mortimer]. [0059] a
saccharide antigen from Haemophilus influenzae B. [0060] an antigen
from N.gonorrhoeae [e.g. WO99/24578, WO99/36544, WO99/57280].
[0061] an antigen from Chlamydia pneumoniae [e.g. PCT/IB01/01445;
Kalman et al. (1999) Nature Genetics 21:385-389; Read et al. (2000)
Nucleic Acids Res 28:1397-406; Shirai et al. (2000) J. Infect. Dis.
181(Suppl 3):S524-S527; WO99/27105; WO00/27994; WO00/37494]. [0062]
an antigen from Chlamydia trachomatis [e.g. WO99/28475]. [0063] an
antigen from Porphyromonas gingivalis [e.g. Ross et al. (2001)
Vaccine 19:4135-4142]. [0064] polio antigen(s) [e.g. Sutter et al.
(2000) Pediatr Clin North Am 47:287-308; Zimmerman & Spann
(1999) Am Fam Physician 59:113-118, 125-126] such as IPV or OPV.
[0065] rabies antigen(s) [e.g. Dreesen (1997) Vaccine 15
Suppl:S2-6] such as lyophilised inactivated virus [e.g. MMWR Morb
Mortal Wkly Rep 1998 Jan 16;47(1):12, 19; RabAvert.TM.]. [0066]
measles, mumps and/or rubella antigens [e.g. chapters 9, 10 &
11 of Plotkin & Mortimer]. [0067] influenza antigen(s) [e.g.
chapter 19 of Plotkin & Mortimer], such as the haemagglutinin
and/or neuraminidase surface proteins. [0068] an antigen from
Moraxella catarrhalis [e.g. McMichael (2000) Vaccine 19 Suppl
1:S101-107]. [0069] an antigen from Staphylococcus aureus [e.g.
Kuroda et al. (2001) Lancet 357(9264):1225-1240; see also pages
1218-1219].
[0070] Where a saccharide or carbohydrate antigen is included, it
is preferably conjugated to a carrier protein in order to enhance
immunogenicity [e.g. Ramsay et al. (2001) Lancet 357(9251):195-196;
Lindberg (1999) Vaccine 17 Suppl 2:S28-36; Conjugate Vaccines (eds.
Cruse et al.) ISBN 3805549326, particularly vol. 10:48-114 etc.].
Preferred carrier proteins are bacterial toxins or toxoids, such as
diphtheria or tetanus toxoids. The CRM.sub.197 diphtheria toxoid is
particularly preferred. Other suitable carrier proteins include the
N.meningitidis outer membrane protein [e.g. EP-0372501], synthetic
peptides [e.g. EP-0378881, EP-0427347], heat shock proteins [e.g.
WO93/17712], pertussis proteins [e.g. WO98/58668; EP-0471177],
protein D from H.influenzae [e.g. WO00/56360], toxin A or B from C.
difficile [e.g. WO00/61761], etc. Any suitable conjugation reaction
can be used, with any suitable linker where necessary.
[0071] Toxic protein antigens may be detoxified where necessary
(e.g. detoxification of pertussis toxin by chemical and/or genetic
means).
[0072] Where a diphtheria antigen is included in the composition it
is preferred also to include tetanus antigen and pertussis
antigens. Similarly, where a tetanus antigen is included it is
preferred also to include diphtheria and pertussis antigens.
Similarly, where a pertussis antigen is included it is preferred
also to include diphtheria and tetanus antigens.
[0073] Antigens are preferably adsorbed to an aluminium salt.
[0074] Antigens in the composition will typically be present at a
concentration of at least 1 .mu.g/ml each. In general, the
concentration of any given antigen will be sufficient to elicit an
immune response against that antigen.
[0075] The invention also provides compositions comprising two or
more proteins of the present invention. The two or more proteins
may comprise GBS sequences or may comprise GAS and GBS
sequences.
[0076] A summary of standard techniques and procedures which may be
employed to perform the invention (e.g. to utilise the disclosed
sequences for vaccination or diagnostic purposes) follows. This
summary is not a limitation on the invention but, rather, gives
examples that may be used, but are not required.
[0077] General
[0078] The practice of the present invention will employ, unless
otherwise indicated, conventional techniques of molecular biology,
microbiology, recombinant DNA, and immunology, which are within the
skill of the art. Such techniques are explained fully in the
literature eg. Sambrook Molecular Cloning; A Laboratory Manual,
Second Edition (1989); DNA Cloning, Volumes I and II (D.N Glover
ed. 1985); Oligonucleotide Synthesis (M. J. Gait ed, 1984); Nucleic
Acid Hybridization (B.D. Hames & S. J. Higgins eds. 1984);
Transcription and Translation (B. D. Hames & S. J. Higgins eds.
1984); Animal Cell Culture (R. I. Freshney ed. 1986); Immobilized
Cells and Enzymes (IRL Press, 1986); B. Perbal, A Practical Guide
to Molecular Cloning (1984); the Methods in Enzymology series
(Academic Press, Inc.), especially volumes 154 & 155; Gene
Transfer Vectors for Mammalian Cells (J. H. Miller and M. P. Calos
eds. 1987, Cold Spring Harbor Laboratory); Mayer and Walker, eds.
(1987), Immunochemical Methods in Cell and Molecular Biology
(Academic Press, London); Scopes, (1987) Protein Purification:
Principles and Practice, Second Edition (Springer-Verlag, N.Y.),
and Handbook of Experimental Immunology, Volumes I-IV (D. M. Weir
and C. C. Blackwell eds 1986).
[0079] Standard abbreviations for nucleotides and amino acids are
used in this specification.
[0080] Definitions
[0081] A composition containing X is "substantially free of" Y when
at least 85% by weight of the total X+Y in the composition is X.
Preferably, X comprises at least about 90% by weight of the total
of X+Y in the composition, more preferably at least about 95% or
even 99% by weight.
[0082] The term "comprising" means "including" as well as
"consisting" e.g. a composition "comprising" X may consist
exclusively of X or may include something additional e.g X+Y.
[0083] The term "heterologous" refers to two biological components
that are not found together in nature. The components may be host
cells, genes, or regulatory regions, such as promoters. Although
the heterologous components are not found together in nature, they
can finction together, as when a promoter heterologous to a gene is
operably linked to the gene. Another example is where a
streptococcus sequence is heterologous to a mouse host cell. A
further examples would be two epitopes from the same or different
proteins which have been assembled in a single protein in an
arrangement not found in nature.
[0084] An "origin of replication" is a polynucleotide sequence that
initiates and regulates replication of polynucleotides, such as an
expression vector. The origin of replication behaves as an
autonomous unit of polynucleotide replication within a cell,
capable of replication under its own control. An origin of
replication may be needed for a vector to replicate in a particular
host cell. With certain origins of replication, an expression
vector can be reproduced at a high copy number in the presence of
the appropriate proteins within the cell. Examples of origins are
the autonomously replicating sequences, which are effective in
yeast; and the viral T-antigen, effective in COS-7 cells.
[0085] A "mutant" sequence is defined as DNA, RNA or amino acid
sequence differing from but having sequence identity with the
native or disclosed sequence. Depending on the particular sequence,
the degree of sequence identity between the native or disclosed
sequence and the mutant sequence is preferably greater than 50%
(eg. 60%, 70%, 80%, 90%, 95%, 99% or more, calculated using the
Smith-Waterman algorithm as described above). As used herein, an
"allelic variant" of a nucleic acid molecule, or region, for which
nucleic acid sequence is provided herein is a nucleic acid
molecule, or region, that occurs essentially at the same locus in
the genome of another or second isolate, and that, due to natural
variation caused by, for example, mutation or recombination, has a
similar but not identical nucleic acid sequence. A coding region
allelic variant typically encodes a protein having similar activity
to that of the protein encoded by the gene to which it is being
compared. An allelic variant can also comprise an alteration in the
5' or 3' untranslated regions of the gene, such as in regulatory
control regions (eg. see U.S Pat. 5,753,235).
[0086] Exyression systems
[0087] The streptococcus nucleotide sequences can be expressed in a
variety of different expression systems; for example those used
with mammalian cells, baculoviruses, plants, bacteria, and
yeast.
[0088] i. Mammalian Systems
[0089] Mammalian expression systems are known in the art. A
mammalian promoter is any DNA sequence capable of binding mammalian
RNA polymerase and initiating the downstream (3') transcription of
a coding sequence (eg. structural gene) into MRNA. A promoter will
have a transcription initiating region, which is usually placed
proximal to the 5' end of the coding sequence, and a TATA box,
usually located 25-30 base pairs (bp) upstream of the transcription
initiation site. The TATA box is thought to direct RNA polymerase
II to begin RNA synthesis at the correct site. A mammalian promoter
will also contain an upstream promoter element, usually located
within 100 to 200 bp upstream of the TATA box. An upstream promoter
element determines the rate at which transcription is initiated and
can act in either orientation [Sambrook et al. (1989) "Expression
of Cloned Genes in Mammalian Cells." In Molecular Cloning: A
Laboratory Manual, 2nd ed.].
[0090] Mammalian viral genes are often highly expressed and have a
broad host range; therefore sequences encoding mammalian viral
genes provide particularly useful promoter sequences. Examples
include the SV40 early promoter, mouse mammary tumor virus LTR
promoter, adenovirus major late promoter (Ad MLP), and herpes
simplex virus promoter. In addition, sequences derived from
non-viral genes, such as the murine metallotheionin gene, also
provide useful promoter sequences. Expression may be either
constitutive or regulated (inducible), depending on the promoter
can be induced with glucocorticoid in hormone-responsive cells.
[0091] The presence of an enhancer element (enhancer), combined
with the promoter elements described above, will usually increase
expression levels. An enhancer is a regulatory DNA sequence that
can stimulate transcription up to 1000-fold when linked to
homologous or heterologous promoters, with synthesis beginning at
the normal RNA start site. Enhancers are also active when they are
placed upstream or downstream from the transcription initiation
site, in either normal or flipped orientation, or at a distance of
more than 1000 nucleotides from the promoter [Maniatis et al.
(1987) Science 236:1237; Alberts et al. (1989) Molecular Biology of
the Cell, 2nd ed.]. Enhancer elements derived from viruses may be
particularly useful, because they usually have a broader host
range. Examples include the SV40 early gene enhancer [Dijkema et al
(1985) EMBO J. 4:761] and the enhancer/promoters derived from the
long terminal repeat (LTR) of the Rous Sarcoma Virus [Gorman et al.
(1982b) Proc. Natl. Acad. Sci. 79:6777] and from human
cytomegalovirus [Boshart et al. (1985) Cell 41:521]. Additionally,
some enhancers are regulatable and become active only in the
presence of an inducer, such as a hormone or metal ion
[Sassone-Corsi and Borelli (1986) Trends Genet. 2:215; Maniatis et
al. (1987) Science 236:1237].
[0092] A DNA molecule may be expressed intracellularly in mammalian
cells. A promoter sequence may be directly linked with the DNA
molecule, in which case the first amino acid at the N-terminus of
the recombinant protein will always be a methionine, which is
encoded by the ATG start codon. If desired, the N-terminus may be
cleaved from the protein by in vitro incubation with cyanogen
bromide.
[0093] Alternatively, foreign proteins can also be secreted from
the cell into the growth media by creating chimeric DNA molecules
that encode a fusion protein comprised of a leader sequence
fragment that provides for secretion of the foreign protein in
mammalian cells. Preferably, there are processing sites encoded
between the leader fragment and the foreign gene that can be
cleaved either in vivo or in vitro. The leader sequence fragment
usually encodes a signal peptide comprised of hydrophobic amino
acids which direct the secretion of the protein from the cell. The
adenovirus tripartite leader is an example of a leader sequence
that provides for secretion of a foreign protein in mammalian
cells.
[0094] Usually, transcription termination and polyadenylation
sequences recognized by mammalian cells are regulatory regions
located 3' to the translation stop codon and thus, together with
the promoter elements, flank the coding sequence. The 3' terminus
of the mature mRNA is formed by site-specific post-transcriptional
cleavage and polyadenylation [Bimstiel et al. (1985) Cell 41:349;
Proudfoot and Whitelaw (1988) "Termination and 3' end processing of
eukaryotic RNA. In Transcription and splicing (ed. B. D. Hames and
D. M. Glover); Proudfoot (1989) Trends Biochem. Sci. 14:105]. These
sequences direct the transcription of an mRNA which can be
translated into the polypeptide encoded by the DNA. Examples of
transcription terminater/polyadenylation signals include those
derived from SV40 [Sambrook et al (1989) "Expression of cloned
genes in cultured mammalian cells." In Molecular Cloning: A
Laboratory Manual].
[0095] Usually, the above described components, comprising a
promoter, polyadenylation signal, and transcription termination
sequence are put together into expression constructs. Enhancers,
introns with functional splice donor and acceptor sites, and leader
sequences may also be included in an expression construct, if
desired. Expression constructs are often maintained in a replicon,
such as an extrachromosomal element (eg. plasmids) capable of
stable maintenance in a host, such as mammalian cells or bacteria.
Mammalian replication systems include those derived from animal
viruses, which require trans-acting factors to replicate. For
example, plasmids containing the replication systems of
papovaviruses, such as SV40 [Gluzman (1981) Cell 23:175] or
polyomavirus, replicate to extremely high copy number in the
presence of the appropriate viral T antigen. Additional examples of
mammalian replicons include those derived from bovine
papillomavirus and Epstein-Barr virus. Additionally, the replicon
may have two replication systems, thus allowing it to be
maintained, for example, in mammalian cells for expression and in a
prokaryotic host for cloning and amplification. Examples of such
mammalian-bacteria shuttle vectors include pMT2 [Kaufman et al.
(1989) Mol. Cell. Biol. 9:946] and pHEBO [Shimizu et al. (1986)
Mol. Cell. Biol. 6:1074].
[0096] The transformation procedure used depends upon the host to
be transformed. Methods for introduction of heterologous
polynucleotides into mammalian cells are known in the art and
include dextran-mediated transfection, calcium phosphate
precipitation, polybrene mediated transfection, protoplast fusion,
electroporation, encapsulation of the polynucleotide(s) in
liposomes, and direct microinjection of the DNA into nuclei.
[0097] Mammalian cell lines available as hosts for expression are
known in the art and include many immortalized cell lines available
from the American Type Culture Collection (ATCC), including but not
limited to, Chinese hamster ovary (CHO) cells, HeLa cells, baby
hamster kidney (BHK) cells, monkey kidney cells (COS), human
hepatocellular carcinoma cells (eg. Hep G2), and a number of other
cell lines.
[0098] ii. Baculovirus Systems
[0099] The polynucleotide encoding the protein can also be inserted
into a suitable insect expression vector, and is operably linked to
the control elements within that vector. Vector construction
employs techniques which are known in the art. Generally, the
components of the expression system include a transfer vector,
usually a bacterial plasmid, which contains both a fragment of the
baculovirus genome, and a convenient restriction site for insertion
of the heterologous gene or genes to be expressed; a wild type
baculovirus with a sequence homologous to the baculovirus-specific
fragment in the transfer vector (this allows for the homologous
recombination of the heterologous gene in to the baculovirus
genome); and appropriate insect host cells and growth media.
[0100] After inserting the DNA sequence encoding the protein into
the transfer vector, the vector and the wild type viral genome are
transfected into an insect host cell where the vector and viral
genome are allowed to recombine. The packaged recombinant virus is
expressed and recombinant plaques are identified and purified.
Materials and methods for baculovirus/insect cell expression
systems are commercially available in kit form from, inter alia,
Invitrogen, San Diego Calif. ("MaxBac" kit). These techniques are
generally known to those skilled in the art and fully described in
Summers and Smith, Texas Agricultural Experiment Station Bulletin
No. 1555 (1987) (hereinafter "Summers and Smith").
[0101] Prior to inserting the DNA sequence encoding the protein
into the baculovirus genome, the above described components,
comprising a promoter, leader (if desired), coding sequence, and
transcription termination sequence, are usually assembled into an
intermediate transplacement construct (transfer vector). This may
contain a single gene and operably linked regulatory elements;
multiple genes, each with its owned set of operably linked
regulatory elements; or multiple genes, regulated by the same set
of regulatory elements. Intermediate transplacement constructs are
often maintained in a replicon, such as an extra-chromosomal
element (e.g. plasmids) capable of stable maintenance in a host,
such as a bacterium. The replicon will have a replication system,
thus allowing it to be maintained in a suitable host for cloning
and amplification.
[0102] Currently, the most commonly used transfer vector for
introducing foreign genes into AcNPV is pAc373. Many other vectors,
known to those of skill in the art, have also been designed. These
include, for example, pVL985 (which alters the polyhedrin start
codon from ATG to ATT, and which introduces a BamHI cloning site 32
basepairs downstream from the ATT; see Luckow and Summers, Virology
(1989) 17:31.
[0103] The plasmid usually also contains the polyhedrin
polyadenylation signal (Miller et al. (1988) Ann. Rev. Microbiol.,
42:177) and a prokaryotic ampicillin-resistance (amp) gene and
origin of replication for selection and propagation in E. coli.
[0104] Baculovirus transfer vectors usually contain a baculovirus
promoter. A baculovirus promoter is any DNA sequence capable of
binding a baculovirus RNA polymerase and initiating the downstream
(5' to 3') transcription of a coding sequence (eg. structural gene)
into mRNA. A promoter will have a transcription initiation region
which is usually placed proximal to the 5' end of the coding
sequence. This transcription initiation region usually includes an
RNA polymerase binding site and a transcription initiation site. A
baculovirus transfer vector may also have a second domain called an
enhancer, which, if present, is usually distal to the structural
gene. Expression may be either regulated or constitutive.
[0105] Structural genes, abundantly transcribed at late times in a
viral infection cycle, provide particularly useful promoter
sequences. Examples include sequences derived from the gene
encoding the viral polyhedron protein, Friesen et al., (1986) "The
Regulation of Baculovirus Gene Expression," in: The Molecular
Biology of Baculoviruses (ed. Walter Doerfler); EPO Publ. Nos. 127
839 and 155 476; and the gene encoding the p10 protein, Vlak et
al., (1988), J. Gen. Virol. 69:765.
[0106] DNA encoding suitable signal sequences can be derived from
genes for secreted insect or baculovirus proteins, such as the
baculovirus polyhedrin gene (Carbonell et al. (1988) Gene, 73:409).
Alternatively, since the signals for mammalian cell
posttranslational modifications (such as signal peptide cleavage,
proteolytic cleavage, and phosphorylation) appear to be recognized
by insect cells, and the signals required for secretion and nuclear
accumulation also appear to be conserved between the invertebrate
cells and vertebrate cells, leaders of non-insect origin, such as
those derived from genes encoding human .alpha.-interferon, Maeda
et al., (1985), Nature 315:592; human gastrin-releasing peptide,
Lebacq-Verheyden et al., (1988), Molec. Cell. Biol. 8:3129; human
IL-2, Smith et al., (1985) Proc. Nat'l Acad. Sci. USA, 82:8404;
mouse IL-3, (Miyajima et al., (1987) Gene 58:273; and human
glucocerebrosidase, Martin et al. (1988) DNA, 7:99, can also be
used to provide for secretion in insects.
[0107] A recombinant polypeptide or polyprotein may be expressed
intracellularly or, if it is expressed with the proper regulatory
sequences, it can be secreted. Good intracellular expression of
nonfused foreign proteins usually requires heterologous genes that
ideally have a short leader sequence containing suitable
translation initiation signals preceding an ATG start signal. If
desired, methionine at the N-terminus may be cleaved from the
mature protein by in vitro incubation with cyanogen bromide.
[0108] Alternatively, recombinant polyproteins or proteins which
are not naturally secreted can be secreted from the insect cell by
creating chimeric DNA molecules that encode a fusion protein
comprised of a leader sequence fragment that provides for secretion
of the foreign protein in insects. The leader sequence fragment
usually encodes a signal peptide comprised of hydrophobic amino
acids which direct the translocation of the protein into the
endoplasmic reticulum.
[0109] After insertion of the DNA sequence and/or the gene encoding
the expression product precursor of the protein, an insect cell
host is co-transformed with the heterologous DNA of the transfer
vector and the genomic DNA of wild type baculovirus--usually by
co-transfection. The promoter and transcription termination
sequence of the construct will usually comprise a 2-5 kb section of
the baculovirus genome. Methods for introducing heterologous DNA
into the desired site in the baculovirus virus are known in the
art. (See Summers and Smith supra; Ju et al. (1987); Smith et al.,
Mol. Cell. Biol. (1983) 3:2156; and Luckow and Summers (1989)). For
example, the insertion can be into a gene such as the polyhedrin
gene, by homologous double crossover recombination; insertion can
also be into a restriction enzyme site engineered into the desired
baculovirus gene. Miller et al., (1989), Bioessays 4:91. The DNA
sequence, when cloned in place of the polyhedrin gene in the
expression vector, is flanked both 5' and 3' by polyhedrin-specific
sequences and is positioned downstream of the polyhedrin
promoter.
[0110] The newly formed baculovirus expression vector is
subsequently packaged into an infectious recombinant baculovirus.
Homologous recombination occurs at low frequency (between about 1%
and about 5%); thus, the majority of the virus produced after
cotransfection is still wild-type virus. Therefore, a method is
necessary to identify recombinant viruses. An advantage of the
expression system is a visual screen allowing recombinant viruses
to be distinguished. The polyhedrin protein, which is produced by
the native virus, is produced at very high levels in the nuclei of
infected cells at late times after viral infection. Accumulated
polyhedrin protein forms occlusion bodies that also contain
embedded particles. These occlusion bodies, up to 15 .mu.m in size,
are highly refractile, giving them a bright shiny appearance that
is readily visualized under the light microscope. Cells infected
with recombinant viruses lack occlusion bodies. To distinguish
recombinant virus from wild-type virus, the transfection
supernatant is plaqued onto a monolayer of insect cells by
techniques known to those skilled in the art. Namely, the plaques
are screened under the light microscope for the presence
(indicative of wild-type virus) or absence (indicative of
recombinant virus) of occlusion bodies. "Current Protocols in
Microbiology" Vol. 2 (Ausubel et al. eds) at 16.8 (Supp. 10, 1990);
Summers and Smith, supra; Miller et al. (1989).
[0111] Recombinant baculovirus expression vectors have been
developed for infection into several insect cells. For example,
recombinant baculoviruses have been developed for, inter alia:
Aedes aegypti , Autographa californica, Bombyx mori, Drosophila
melanogaster, Spodoptera frugiperda, and Trichoplusia ni (WO
89/046699; Carbonell et al., (1985) J. Virol. 56:153; Wright (1986)
Nature 321:718; Smith et al., (1983) Mol. Cell. Biol. 3:2156; and
see generally, Fraser, et al. (1989) In Vitro Cell. Dev. Biol.
25:225).
[0112] Cells and cell culture media are commercially available for
both direct and fusion expression of heterologous polypeptides in a
baculovirus/expression system; cell culture technology is generally
known to those skilled in the art. See, eg. Summers and Smith
supra.
[0113] The modified insect cells may then be grown in an
appropriate nutrient medium, which allows for stable maintenance of
the plasmid(s) present in the modified insect host. Where the
expression product gene is under inducible control, the host may be
grown to high density, and expression induced. Alternatively, where
expression is constitutive, the product will be continuously
expressed into the medium and the nutrient medium must be
continuously circulated, while removing the product of interest and
augmenting depleted nutrients. The product may be purified by such
techniques as chromatography, eg. HPLC, affinity chromatography,
ion exchange chromatography, etc.; electrophoresis; density
gradient centrifugation; solvent extraction, etc. As appropriate,
the product may be further purified, as required, so as to remove
substantially any insect proteins which are also present in the
medium, so as to provide a product which is at least substantially
free of host debris, eg. proteins, lipids and polysaccharides.
[0114] In order to obtain protein expression, recombinant host
cells derived from the transformants are incubated under conditions
which allow expression of the recombinant protein encoding
sequence. These conditions will vary, dependent upon the host cell
selected. However, the conditions are readily ascertainable to
those of ordinary skill in the art, based upon what is known in the
art.
[0115] iii. Plant Systems
[0116] There are many plant cell culture and whole plant genetic
expression systems known in the art. Exemplary plant cellular
genetic expression systems include those described in patents, such
as: U.S. Pat. Nos. 5,693,506; 5,659,122; and 5,608,143. Additional
examples of genetic expression in plant cell culture has been
described by Zenk, Phytochemistry 30:3861-3863 (1991). Descriptions
of plant protein signal peptides may be found in addition to the
references described above in Vaulcombe et al., Mol. Gen. Genet.
209:33-40 (1987); Chandler et al., Plant Molecular Biology
3:407-418 (1984); Rogers, J. Biol. Chem. 260:3731-3738 (1985);
Rothstein et al., Gene 55:353-356 (1987); Whittier et al., Nucleic
Acids Research 15:2515-2535 (1987); Wirsel et al., Molecular
Microbiology 3:3-14 (1989); Yu et al., Gene 122:247-253 (1992). A
description of the regulation of plant gene expression by the
phytohormone, gibberellic acid and secreted enzymes induced by
gibberellic acid can be found in R. L. Jones and J. MacMillin,
Gibberellins: in: Advanced Plant Physiology,. Malcolm B. Wilkins,
ed., 1984 Pitman Publishing Limited, London, pp. 21-52. References
that describe other metabolically-regulated genes: Sheen, Plant
Cell, 2:1027-1038(1990); Maas et al., EMBO J. 9:3447-3452 (1990);
Benkel and Hickey, Proc. Natl. Acad. Sci. 84:1337-1339 (1987).
[0117] Typically, using techniques known in the art, a desired
polynucleotide sequence is inserted into an expression cassette
comprising genetic regulatory elements designed for operation in
plants. The expression cassette is inserted into a desired
expression vector with companion sequences upstream and downstream
from the expression cassette suitable for expression in a plant
host. The companion sequences will be of plasmid or viral origin
and provide necessary characteristics to the vector to permit the
vectors to move DNA from an original cloning host, such as
bacteria, to the desired plant host. The basic bacterial/plant
vector construct will preferably provide a broad host range
prokaryote replication origin; a prokaryote selectable marker; and,
for Agrobacterium transformations, T DNA sequences for
Agrobacterium-mediated transfer to plant chromosomes. Where the
heterologous gene is not readily amenable to detection, the
construct will preferably also have a selectable marker gene
suitable for determining if a plant cell has been transformed. A
general review of suitable markers, for example for the members of
the grass family, is found in Wilmink and Dons, 1993, Plant Mol.
Biol. Reptr, 11(2):165-185.
[0118] Sequences suitable for permitting integration of the
heterologous sequence into the plant genome are also recommended.
These might include transposon sequences and the like for
homologous recombination as well as Ti sequences which permit
random insertion of a heterologous expression cassette into a plant
genome. Suitable prokaryote selectable markers include resistance
toward antibiotics such as ampicillin or tetracycline. Other DNA
sequences encoding additional functions may also be present in the
vector, as is known in the art.
[0119] The nucleic acid molecules of the subject invention may be
included into an expression cassette for expression of the
protein(s) of interest. Usually, there will be only one expression
cassette, although two or more are feasible. The recombinant
expression cassette will contain in addition to the heterologous
protein encoding sequence the following elements, a promoter
region, plant 5' untranslated sequences, initiation codon depending
upon whether or not the structural gene comes equipped with one,
and a transcription and translation termination sequence. Unique
restriction enzyme sites at the 5' and 3' ends of the cassette
allow for easy insertion into a pre-existing vector.
[0120] A heterologous coding sequence may be for any protein
relating to the present invention. The sequence encoding the
protein of interest will encode a signal peptide which allows
processing and translocation of the protein, as appropriate, and
will usually lack any sequence which might result in the binding of
the desired protein of the invention to a membrane. Since, for the
most part, the transcriptional initiation region will be for a gene
which is expressed and translocated during germination, by
employing the signal peptide which provides for translocation, one
may also provide for translocation of the protein of interest. In
this way, the protein(s) of interest will be translocated from the
cells in which they are expressed and may be efficiently harvested.
Typically secretion in seeds are across the aleurone or scutellar
epithelium layer into the endosperm of the seed. While it is not
required that the protein be secreted from the cells in which the
protein is produced, this facilitates the isolation and
purification of the recombinant protein.
[0121] Since the ultimate expression of the desired gene product
will be in a eucaryotic cell it is desirable to determine whether
any portion of the cloned gene contains sequences which will be
processed out as introns by the host's splicosome machinery. If so,
site-directed mutagenesis of the "intron" region may be conducted
to prevent losing a portion of the genetic message as a false
intron code, Reed and Maniatis, Cell 41:95-105, 1985.
[0122] The vector can be microinjected directly into plant cells by
use of micropipettes to mechanically transfer the recombinant DNA.
Crossway, Mol. Gen. Genet, 202:179-185, 1985. The genetic material
may also be transferred into the plant cell by using polyethylene
glycol, Krens, et al., Nature, 296, 72-74, 1982. Another method of
introduction of nucleic acid segments is high velocity ballistic
penetration by small particles with the nucleic acid either within
the matrix of small beads or particles, or on the surface, Klein,
et al., Nature, 327, 70-73, 1987 and Knudsen and Muller, 1991,
Planta, 185:330-336 teaching particle bombardment of barley
endosperm to create transgenic barley. Yet another method of
introduction would be fusion of protoplasts with other entities,
either minicells, cells, lysosomes or other fusible lipid-surfaced
bodies, Fraley, et al., Proc. Natl. Acad. Sci. USA, 79, 1859-1863,
1982.
[0123] The vector may also be introduced into the plant cells by
electroporation. (Fromm et al., Proc. Natl Acad. Sci. USA 82:5824,
1985). In this technique, plant protoplasts are electroporated in
the presence of plasmids containing the gene construct. Electrical
impulses of high field strength reversibly permeabilize
biomembranes allowing the introduction of the plasmids.
Electroporated plant protoplasts reform the cell wall, divide, and
form plant callus.
[0124] All plants from which protoplasts can be isolated and
cultured to give whole regenerated plants can be transformed by the
present invention so that whole plants are recovered which contain
the transferred gene. It is known that practically all plants can
be regenerated from cultured cells or tissues, including but not
limited to all major species of sugarcane, sugar beet, cotton,
fruit and other trees, legumes and vegetables. Some suitable plants
include, for example, species from the genera Fragaria, Lotus,
Medicago, Onobrychis, Trifolium, Trigonella, Vigna, Citrus, Linum,
Geranium, Manihot, Daucus, Arabidopsis, Brassica, Raphanus,
Sinapis, Atropa, Capsicum, Datura, Hyoscyamus, Lycopersion,
Nicotiana, Solanum, Petunia, Digitalis, Majorana, Cichorium,
Helianthus, Lactuca, Bromus, Asparagus, Antirrhinum, Hererocallis,
Nemesia, Pelargonium, Panicum, Pennisetum, Ranunculus, Senecio,
Salpiglossis, Cucumis, Browaalia, Glycine, Lolium, Zea, Triticum,
Sorghum, and Datura.
[0125] Means for regeneration vary from species to species of
plants, but generally a suspension of transformed protoplasts
containing copies of the heterologous gene is first provided.
Callus tissue is formed and shoots may be induced from callus and
subsequently rooted. Alternatively, embryo formation can be induced
from the protoplast suspension. These embryos germinate as natural
embryos to form plants. The culture media will generally contain
various amino acids and hormones, such as auxin and cytokinins. It
is also advantageous to add glutamic acid and proline to the
medium, especially for such species as corn and alfalfa. Shoots and
roots normally develop simultaneously. Efficient regeneration will
depend on the medium, on the genotype, and on the history of the
culture. If these three variables are controlled, then regeneration
is fully reproducible and repeatable.
[0126] In some plant cell culture systems, the desired protein of
the invention may be excreted or alternatively, the protein may be
extracted from the whole plant. Where the desired protein of the
invention is secreted into the medium, it may be collected.
Alternatively, the embryos and embryoless-half seeds or other plant
tissue may be mechanically disrupted to release any secreted
protein between cells and tissues. The mixture may be suspended in
a buffer solution to retrieve soluble proteins. Conventional
protein isolation and purification methods will be then used to
purify the recombinant protein. Parameters of time, temperature pH,
oxygen, and volumes will be adjusted through routine methods to
optimize expression and recovery of heterologous protein.
[0127] iv. Bacterial Systems
[0128] Bacterial expression techniques are known in the art. A
bacterial promoter is any DNA sequence capable of binding bacterial
RNA polymerase and initiating the downstream (3' ) transcription of
a coding sequence (eg. structural gene) into MRNA. A promoter will
have a transcription initiation region which is usually placed
proximal to the 5' end of the coding sequence. This transcription
initiation region usually includes an RNA polymerase binding site
and a transcription initiation site. A bacterial promoter may also
have a second domain called an operator, that may overlap an
adjacent RNA polymerase binding site at which RNA synthesis begins.
The operator permits negative regulated (inducible) transcription,
as a gene repressor protein may bind the operator and thereby
inhibit transcription of a specific gene. Constitutive expression
may occur in the absence of negative regulatory elements, such as
the operator. In addition, positive regulation may be achieved by a
gene activator protein binding sequence, which, if present is
usually proximal (5' ) to the RNA polymerase binding sequence. An
example of a gene activator protein is the catabolite activator
protein (CAP), which helps initiate transcription of the lac operon
in Escherichia coli (E.coli) [Raibaud et al. (1984) Annu. Rev.
Genet. 18:173]. Regulated expression may therefore be either
positive or negative, thereby either enhancing or reducing
transcription.
[0129] Sequences encoding metabolic pathway enzymes provide
particularly useful promoter sequences. Examples include promoter
sequences derived from sugar metabolizing enzymes, such as
galactose, lactose (lac) [Chang et al. (1977) Nature 198:1056], and
maltose. Additional examples include promoter sequences derived
from biosynthetic enzymes such as tryptophan (trp) [Goeddel et al.
(1980) Nuc. Acids Res. 8:4057; Yelverton et al. (1981) Nucl. Acids
Res. 9:731; U.S. Pat. No. 4,738,921; EP-A-0036776 and
EP-A-0121775]. The g-laotamase (bla) promoter system [Weissmann
(1981) "The cloning of interferon and other mistakes." In
Interferon 3 (ed. I. Gresser)], bacteriophage lambda PL [Shimatake
et al. (1981) Nature 292:128] and T5 [U.S. Pat. No. 4,689,406]
promoter systems also provide useful promoter sequences.
[0130] In addition, synthetic promoters which do not occur in
nature also finction as bacterial promoters. For example,
transcription activation sequences of one bacterial or
bacteriophage promoter may be joined with the operon sequences of
another bacterial or bacteriophage promoter, creating a synthetic
hybrid promoter [U.S. Pat. No. 4,551,433]. For example, the tac
promoter is a hybrid trp-lac promoter comprised of both trp
promoter and lac operon sequences that is regulated by the lac
repressor [Amann et al. (1983) Gene 25:167; de Boer et al. (1983)
Proc. Natl. Acad. Sci. 80:21]. Furthermore, a bacterial promoter
can include naturally occurring promoters of non-bacterial origin
that have the ability to bind bacterial RNA polymerase and initiate
transcription. A naturally occurring promoter of non-bacterial
origin can also be coupled with a compatible RNA polymerase to
produce high levels of expression of some genes in prokaryotes. The
bacteriophage T7 RNA polymerase/promoter system is an example of a
coupled promoter system [Studier et al. (1986) J. Mol. Biol.
189:113; Tabor et al. (1985) Proc Natl. Acad. Sci. 82:1074]. In
addition, a hybrid promoter can also be comprised of a
bacteriophage promoter and an E.coli operator region (EPO-A-0 267
851).
[0131] In addition to a finctioning promoter sequence, an efficient
ribosome binding site is also useful for the expression of foreign
genes in prokaryotes. In E.coli, the ribosome binding site is
called the Shine-Dalgarno (SD) sequence and includes an initiation
codon (ATG) and a sequence 3-9 nucleotides in length located 3-11
nucleotides upstream of the initiation codon [Shine et al. (1975)
Nature 254:34]. The SD sequence is thought to promote binding of
mRNA to the ribosome by the pairing of bases between the SD
sequence and the 3' and of E.coli 16S rRNA [Steitz et al. (1979)
"Genetic signals and nucleotide sequences in messenger RNA." In
Biological Regulation and Development: Gene Expression (ed. R.F.
Goldberger)]. To express eukaryotic genes and prokaryotic genes
with weak ribosome-binding site [Sambrook et al. (1989) "Expression
of cloned genes in Escherichia coli." In Molecular Cloning: A
Laboratory Manual].
[0132] A DNA molecule may be expressed intracellularly. A promoter
sequence may be directly linked with the DNA molecule, in which
case the first amino acid at the N-terminus will always be a
methionine, which is encoded by the ATG start codon. If desired,
methionine at the N-terminus may be cleaved from the protein by in
vitro incubation with cyanogen bromide or by either in vivo on in
vitro incubation with a bacterial methionine N-terminal peptidase
(EP-A-0 219 237).
[0133] Fusion proteins provide an alternative to direct expression.
Usually, a DNA sequence encoding the N-terminal portion of an
endogenous bacterial protein, or other stable protein, is fused to
the 5' end of heterologous coding sequences. Upon expression, this
construct will provide a fusion of the two amino acid sequences.
For example, the bacteriophage lambda cell gene can be linked at
the 5' terminus of a foreign gene and expressed in bacteria. The
resulting fusion protein preferably retains a site for a processing
enzyme (factor Xa) to cleave the bacteriophage protein from the
foreign gene [Nagai et al. (1984) Nature 309:810]. Fusion proteins
can also be made with sequences from the lacZ [Jia et al. (1987)
Gene 60:197], trpE [Allen et al. (1987) J. Biotechnol. 5:93; Makoff
et al. (1989) J. Gen. Microbiol. 135:11], and Chey [EP-A-0 324 647]
genes. The DNA sequence at the junction of the two amino acid
sequences may or may not encode a cleavable site. Another example
is a ubiquitin fusion protein. Such a fusion protein is made with
the ubiquitin region that preferably retains a site for a
processing enzyme (eg. ubiquitin specific processing-protease) to
cleave the ubiquitin from the foreign protein. Through this method,
native foreign protein can be isolated [Miller et al. (1989)
Bio/Technology 7:698].
[0134] Alternatively, foreign proteins can also be secreted from
the cell by creating chimeric DNA molecules that encode a fusion
protein comprised of a signal peptide sequence fragment that
provides for secretion of the foreign protein in bacteria [U.S.
Pat. No. 4,336,336]. The signal sequence fragment usually encodes a
signal peptide comprised of hydrophobic amino acids which direct
the secretion of the protein from the cell. The protein is either
secreted into the growth media (gram-positive bacteria) or into the
periplasmic space, located between the inner and outer membrane of
the cell (gram-negative bacteria). Preferably there are processing
sites, which can be cleaved either in vivo or in vitro encoded
between the signal peptide fragment and the foreign gene.
[0135] DNA encoding suitable signal sequences can be derived from
genes for secreted bacterial proteins, such as the E.coli outer
membrane protein gene (ompA) [Masui et al. (1983), in: Experimental
Manipulation of Gene Expression; Ghrayeb et al. (1984) EMBO J.
3:2437] and the E.coli alkaline phosphatase signal sequence (phoA)
[Oka et al. (1985) Proc. Natl. Acad. Sci. 82:7212]. As an
additional example, the signal sequence of the alpha-amylase gene
from various Bacillus strains can be used to secrete heterologous
proteins from B. subtilis [Palva et al. (1982) Proc. Nat. Acad.
Sci. USA 79:5582; EP-A-0 244 042].
[0136] Usually, transcription termination sequences recognized by
bacteria are regulatory regions located 3' to the translation stop
codon, and thus together with the promoter flank the coding
sequence. These sequences direct the transcription of an mRNA which
can be translated into the polypeptide encoded by the DNA.
Transcription termination sequences frequently include DNA
sequences of about 50 nucleotides capable of forming stem loop
structures that aid in terminating transcription. Examples include
transcription termination sequences derived from genes with strong
promoters, such as the trp gene in E. coli as well as other
biosynthetic genes.
[0137] Usually, the above described components, comprising a
promoter, signal sequence (if desired), coding sequence of
interest, and transcription termination sequence, are put together
into expression constructs. Expression constructs are often
maintained in a replicon, such as an extrachromosomal element (eg.
plasmids) capable of stable maintenance in a host, such as
bacteria. The replicon will have a replication system, thus
allowing it to be maintained in a prokaryotic host either for
expression or for cloning and amplification. In addition, a
replicon may be either a high or low copy number plasmid. A high
copy number plasmid will generally have a copy number ranging from
about 5 to about 200, and usually about 10 to about 150. A host
containing a high copy number plasmid will preferably contain at
least about 10, and more preferably at least about 20 plasmids.
Either a high or low copy number vector may be selected, depending
upon the effect of the vector and the foreign protein on the
host.
[0138] Alternatively, the expression constructs can be integrated
into the bacterial genome with an integrating vector. Integrating
vectors usually contain at least one sequence homologous to the
bacterial chromosome that allows the vector to integrate.
Integrations appear to result from recombinations between
homologous DNA in the vector and the bacterial chromosome. For
example, integrating vectors constructed with DNA from various
Bacillus strains integrate into the Bacillus chromosome (EP-A-0 127
328). Integrating vectors may also be comprised of bacteriophage or
transposon sequences.
[0139] Usually, extrachromosomal and integrating expression
constructs may contain selectable markers to allow for the
selection of bacterial strains that have been transformed.
Selectable markers can be expressed in the bacterial host and may
include genes which render bacteria resistant to drugs such as
ampicillin, chloramphenicol, erythromycin, kanamycin (neomycin),
and tetracycline [Davies et al. (1978) Annu. Rev. Microbiol.
32:469]. Selectable markers may also include biosynthetic genes,
such as those in the histidine, tryptophan, and leucine
biosynthetic pathways.
[0140] Alternatively, some of the above described components can be
put together in transformation vectors. Transformation vectors are
usually comprised of a selectable market that is either maintained
in a replicon or developed into an integrating vector, as described
above.
[0141] Expression and transformation vectors, either
extra-chromosomal replicons or integrating vectors, have been
developed for transformation into many bacteria. For example,
expression vectors have been developed for, inter alia, the
following bacteria: Bacillus subtilis [Palva et al. (1982) Proc.
Natl. Acad. Sci. USA 79:5582; EP-A-0 036 259 and EP-A-0 063 953; WO
84/04541], Escherichia coli [Shimatake et al. (1981) Nature
292:128; Amann et al. (1985) Gene 40:183; Studier et al. (1986) J.
Mol. Biol. 189:113; EP-A-0 036 776, EP-A-0 136 829 and EP-A-0 136
907], Streptococcus cremoris [Powell et al. (1988) Appl. Environ.
Microbiol. 54:655]; Streptococcus lividans [Powell et al. (1988)
Appl. Environ. Microbiol. 54:655], Streptomyces lividans [U.S. Pat.
No. 4,745,056].
[0142] Methods of introducing exogenous DNA into bacterial hosts
are well-known in the art, and usually include either the
transformation of bacteria treated with CaCl.sub.2 or other agents,
such as divalent cations and DMSO. DNA can also be introduced into
bacterial cells by electroporation. Transformation procedures
usually vary with the bacterial species to be transformed. See eg.
[Masson et al. (1989) FEMS Microbiol. Lett. 60:273; Palva et al.
(1982) Proc. Natl. Acad. Sci. USA 79:5582; EP-A-0 036 259 and
EP-A-0 063 953; WO 84/04541, Bacillus], [Miller et al. (1988) Proc.
Natl. Acad. Sci. 85:856; Wang et al. (1990) J. Bacteriol. 172:949,
Campylobacter], [Cohen et al. (1973) Proc. Natl. Acad. Sci.
69:2110; Dower et al. (1988) Nucleic Acids Res. 16:6127; Kushner
(1978) "An improved method for transformation of Escherichia coli
with ColE1-derived plasmids. In Genetic Engineering: Proceedings of
the International Symposium on Genetic Engineering (eds. H. W.
Boyer and S. Nicosia); Mandel et al. (1970) J. Mol. Biol. 53:159;
Taketo (1988) Biochim. Biophys. Acta 949:318; Escherichia], [Chassy
et al. (1987) FEMS Microbiol. Lett. 44:173 Lactobacillus]; [Fiedler
et al. (1988) Anal. Biochem 170:38, Pseudomonas]; [Augustin et al.
(1990) FEMS Microbiol. Lett. 66:203, Staphylococcus], [Barany et
al. (1980) J. Bacteriol. 144:698; Harlander (1987) "Transformation
of Streptococcus lactis by electroporation, in: Streptococcal
Genetics (ed. J. Ferretti and R. Curtiss III); Perry et al. (1981)
Infect. Immun. 32:1295; Powell et al. (1988) Appl. Environ.
Microbiol. 54:655; Somkuti et al. (1987) Proc. 4th Evr. Cong.
Biotechnology 1:412, Streptococcus].
[0143] v. Yeast Expression
[0144] Yeast expression systems are also known to one of ordinary
skill in the art. A yeast promoter is any DNA sequence capable of
binding yeast RNA polymerase and initiating the downstream (3' )
transcription of a coding sequence (eg. structural gene) into mRNA.
A promoter will have a transcription initiation region which is
usually placed proximal to the 5' end of the coding sequence. This
transcription initiation region usually includes an RNA polymerase
binding site (the "TATA Box") and a transcription initiation site.
A yeast promoter may also have a second domain called an upstream
activator sequence (UAS), which, if present, is usually distal to
the structural gene. The UAS permits regulated (inducible)
expression. Constitutive expression occurs in the absence of a UAS.
Regulated expression may be either positive or negative, thereby
either enhancing or reducing transcription.
[0145] Yeast is a fermenting organism with an active metabolic
pathway, therefore sequences encoding enzymes in the metabolic
pathway provide particularly useful promoter sequences. Examples
include alcohol dehydrogenase (ADH) (EP-A-0 284 044), enolase,
glucokinase, glucose-6-phosphate isomerase,
glyceraldehyde-3-phosphate-dehydrogenase (GAP or GAPDH),
hexokinase, phosphofructokinase, 3-phosphoglycerate mutase, and
pyruvate kinase (PyK) (EPO-A-0 329 203). The yeast PHO5 gene,
encoding acid phosphatase, also provides useful promoter sequences
[Myanohara et al. (1983) Proc. Natl. Acad. Sci. USA 80:1].
[0146] In addition, synthetic promoters which do not occur in
nature also finction as yeast promoters. For example, UAS sequences
of one yeast promoter may be joined with the transcription
activation region of another yeast promoter, creating a synthetic
hybrid promoter. Examples of such hybrid promoters include the ADH
regulatory sequence linked to the GAP transcription activation
region (U.S. Pat. Nos. 4,876,197 and 4,880,734). Other examples of
hybrid promoters include promoters which consist of the regulatory
sequences of either the ADH2, GAL4, GAL10, OR PHO5 genes, combined
with the transcriptional activation region of a glycolytic enzyme
gene such as GAP or PyK (EP-A-0 164 556). Furthermore, a yeast
promoter can include naturally occurring promoters of non-yeast
origin that have the ability to bind yeast RNA polymerase and
initiate transcription. Examples of such promoters include, inter
alia, [Cohen et al. (1980) Proc. Natl. Acad. Sci. USA 77:1078;
Henikoff et al. (1981) Nature 283:835; Hollenberg et al. (1981)
Curr. Topics Microbiol. Immunol. 96:119; Hollenberg et al. (1979)
"The Expression of Bacterial Antibiotic Resistance Genes in the
Yeast Saccharomyces cerevisiae," in: Plasmids of Medical,
Environmental and Commercial Importance (eds. K. N. Timmis and A.
Puhler); Mercerau-Puigalon et al. (1980) Gene 11:163; Panthier et
al. (1980) Curr. Genet. 2:109;].
[0147] A DNA molecule may be expressed intracellularly in yeast. A
promoter sequence may be directly linked with the DNA molecule, in
which case the first amino acid at the N-terminus of the
recombinant protein will always be a methionine, which is encoded
by the ATG start codon. If desired, methionine at the N-terminus
may be cleaved from the protein by in vitro incubation with
cyanogen bromide.
[0148] Fusion proteins provide an alternative for yeast expression
systems, as well as in mammalian, baculovirus, and bacterial
expression systems. Usually, a DNA sequence encoding the N-terninal
portion of an endogenous yeast protein, or other stable protein, is
fused to the 5' end of heterologous coding sequences. Upon
expression, this construct will provide a fusion of the two amino
acid sequences. For example, the yeast or human superoxide
dismutase (SOD) gene, can be linked at the 5' terminus of a foreign
gene and expressed in yeast. The DNA sequence at the junction of
the two amino acid sequences may or may not encode a cleavable
site. See eg. EP-A-0 196 056. Another example is a ubiquitin fusion
protein. Such a fusion protein is made with the ubiquitin region
that preferably retains a site for a processing enzyme (eg.
ubiquitin-specific processing protease) to cleave the ubiquitin
from the foreign protein. Through this method, therefore, native
foreign protein can be isolated (eg. WO88/024066).
[0149] Alternatively, foreign proteins can also be secreted from
the cell into the growth media by creating chimeric DNA molecules
that encode a fusion protein comprised of a leader sequence
fragment that provide for secretion in yeast of the foreign
protein. Preferably, there are processing sites encoded between the
leader fragment and the foreign gene that can be cleaved either in
vivo or in vitro. The leader sequence fragment usually encodes a
signal peptide comprised of hydrophobic amino acids which direct
the secretion of the protein from the cell.
[0150] DNA encoding suitable signal sequences can be derived from
genes for secreted yeast proteins, such as the yeast invertase gene
(EP-A-0 012 873; JPO. 62,096,086) and the A-factor gene (U.S. Pat.
No. 4,588,684). Alternatively, leaders of non-yeast origin, such as
an interferon leader, exist that also provide for secretion in
yeast (EP-A-0 060 057).
[0151] A preferred class of secretion leaders are those that employ
a fragment of the yeast alpha-factor gene, which contains both a
"pre" signal sequence, and a "pro" region. The types of
alpha-factor fragments that can be employed include the full-length
pre-pro alpha factor leader (about 83 amino acid residues) as well
as truncated alpha-factor leaders (usually about 25 to about 50
amino acid residues) (U.S. Pat. Nos. 4,546,083 and 4,870,008;
EP-A-0 324 274). Additional leaders employing an alpha-factor
leader fragment that provides for secretion include hybrid
alpha-factor leaders made with a presequence of a first yeast, but
a pro-region from a second yeast alphafactor. (eg. see WO
89/02463.)
[0152] Usually, transcription termination sequences recognized by
yeast are regulatory regions located 3' to the translation stop
codon, and thus together with the promoter flank the coding
sequence. These sequences direct the transcription of an mRNA which
can be translated into the polypeptide encoded by the DNA. Examples
of transcription terminator sequence and other yeast-recognized
termination sequences, such as those coding for glycolytic
enzymes.
[0153] Usually, the above described components, comprising a
promoter, leader (if desired), coding sequence of interest, and
transcription termination sequence, are put together into
expression constructs. Expression constructs are often maintained
in a replicon, such as an extrachromosomal element (eg. plasmids)
capable of stable maintenance in a host, such as yeast or bacteria.
The replicon may have two replication systems, thus allowing it to
be maintained, for example, in yeast for expression and in a
prokaryotic host for cloning and amplification. Examples of such
yeast-bacteria shuttle vectors include YEp24 [Botstein et al.
(1979) Gene 8:17-24], pCl/1 [Brake et al. (1984) Proc. Natl. Acad.
Sci USA 81:4642-4646], and YRp17 [Stinchcomb et al. (1982) J. Mol.
Biol. 158:157]. In addition, a replicon may be either a high or low
copy number plasmid. A high copy number plasmid will generally have
a copy number ranging from about 5 to about 200, and usually about
10 to about 150. A host containing a high copy number plasmid will
preferably have at least about 10, and more preferably at least
about 20. Enter a high or low copy number vector may be selected,
depending upon the effect of the vector and the foreign protein on
the host. See eg. Brake et al., supra.
[0154] Alternatively, the expression constructs can be integrated
into the yeast genome with an integrating vector. Integrating
vectors usually contain at least one sequence homologous to a yeast
chromosome that allows the vector to integrate, and preferably
contain two homologous sequences flanking the expression construct.
Integrations appear to result from recombinations between
homologous DNA in the vector and the yeast chromosome [Orr-Weaver
et al. (1983) Methods in Enzymol. 101:228-245]. An integrating
vector may be directed to a specific locus in yeast by selecting
the appropriate homologous sequence for inclusion in the vector.
See Orr-Weaver et al., supra. One or more expression construct may
integrate, possibly affecting levels of recombinant protein
produced [Rine et al. (1983) Proc. Natl. Acad. Sci. USA 80:6750].
The chromosomal sequences included in the vector can occur either
as a single segment in the vector, which results in the integration
of the entire vector, or two segments homologous to adjacent
segments in the chromosome and flanking the expression construct in
the vector, which can result in the stable integration of only the
expression construct.
[0155] Usually, extrachromosomal and integrating expression
constructs may contain selectable markers to allow for the
selection of yeast strains that have been transformed. Selectable
markers may include biosynthetic genes that can be expressed in the
yeast host, such as ADE2, HIS4, LEU2, TRP1, and ALG7, and the G418
resistance gene, which confer resistance in yeast cells to
tunicamycin and G418, respectively. In addition, a suitable
selectable marker may also provide yeast with the ability to grow
in the presence of toxic compounds, such as metal. For example, the
presence of CUP1 allows yeast to grow in the presence of copper
ions [Butt et al. (1987) Microbiol, Rev. 51:351].
[0156] Alternatively, some of the above described components can be
put together into transformation vectors. Transformation vectors
are usually comprised of a selectable marker that is either
maintained in a replicon or developed into an integrating vector,
as described above.
[0157] Expression and transformation vectors, either
extrachromosomal replicons or integrating vectors, have been
developed for transformation into many yeasts. For example,
expression vectors have been developed for, inter alia, the
following yeasts: Candida albicans [Kurtz, et al. (1986) Mol. Cell.
Biol. 6:142], Candida maltosa [Kunze, et al. (1985) J. Basic
Microbiol. 25:141]. Hansenula polymorpha [Gleeson, et al. (1986) J.
Gen. Microbiol. 132:3459; Roggenkamp et al. (1986) Mol. Gen. Genet.
202:302], Kluyveromyces fragilis [Das, et al. (1984) J. Bacteriol.
158:1165], Kluyveromyces lactis [De Louvencourt et al. (1983) J.
Bacteriol. 154:737; Van den Berg et al. (1990) Bio/Technology
8:135], Pichia guillerimondii [Kunze et al. (1985) J. Basic
Microbiol. 25:141], Pichia pastoris [Cregg, et al. (1985) Mol.
Cell. Biol. 5:3376; U.S. Pat. Nos. 4,837,148 and 4,929,555],
Saccharomyces cerevisiae [Hinnen et al. (1978) Proc. Natl. Acad.
Sci. USA 75:1929; Ito et al. (1983) J. Bacteriol. 153:163],
Schizosaccharomyces pombe [Beach and Nurse (1981) Nature 300:706],
and Yarrowia lipolytica [Davidow, et al. (1985) Curr. Genet.
10:380471 Gaillardin, et al. (1985) Curr. Genet. 10:49].
[0158] Methods of introducing exogenous DNA into yeast hosts are
well-known in the art, and usually include either the
transformation of spheroplasts or of intact yeast cells treated
with alkali cations. Transformation procedures usually vary with
the yeast species to be transformed. See eg. [Kurtz et al. (1986)
Mol. Cell. Biol. 6:142; Kunze et al. (1985) J. Basic Microbiol.
25:141; Candida]; [Gleeson et al. (1986) J. Gen. Microbiol.
132:3459; Roggenkamp et al. (1986) Mol. Gen. Genet. 202:302;
Hansenula]; [Das et al. (1984) J. Bacteriol. 158:1165; De
Louvencourt et al. (1983) J. Bacteriol. 154:1165; Van den Berg et
al. (1990) Bio/Technology 8:135; Kluyveromyces]; [Cregg et al.
(1985) Mol. Cell. Biol. 5:3376; Kunze et al. (1985) J. Basic
Microbiol. 25:141; U.S. Pat. Nos. 4,837,148 and 4,929,555; Pichia];
[Hinnen et al. (1978) Proc. Natl. Acad. Sci. USA 75;1929; Ito et
al. (1983) J. Bacteriol 153:163 Saccharomyces]; [Beach and Nurse
(1981) Nature 300:706; Schizosaccharomyces]; [Davidow et al. (1985)
Curr. Genet. 10:39; Gaillardin et al. (1985) Curr. Genet. 10:49;
Yarrowia].
[0159] Antibodies
[0160] As used herein, the term "antibody" refers to a polypeptide
or group of polypeptides composed of at least one antibody
combining site. An "antibody combining site" is the
three-dimensional binding space with an internal surface shape and
charge distribution complementary to the features of an epitope of
an antigen, which allows a binding of the antibody with the
antigen. "Antibody" includes, for example, vertebrate antibodies,
hybrid antibodies, chimeric antibodies, humanised antibodies,
altered antibodies, univalent antibodies, Fab proteins, and single
domain antibodies.
[0161] Antibodies against the proteins of the invention are useful
for affinity chromatography, immunoassays, and
distinguishing/identifying streptococcus proteins.
[0162] Antibodies to the proteins of the invention, both polyclonal
and monoclonal, may be prepared by conventional methods. In
general, the protein is first used to immunize a suitable animal,
preferably a mouse, rat, rabbit or goat. Rabbits and goats are
preferred for the preparation of polyclonal sera due to the volume
of serum obtainable, and the availability of labeled anti-rabbit
and anti-goat antibodies. Immunization is generally performed by
mixing or emulsifying the protein in saline, preferably in an
adjuvant such as Freund's complete adjuvant, and injecting the
mixture or emulsion parenterally (generally subcutaneously or
intramuscularly). A dose of 50-200 .mu.g/injection is typically
sufficient. Immunization is generally boosted 2-6 weeks later with
one or more injections of the protein in saline, preferably using
Freund's incomplete adjuvant. One may alternatively generate
antibodies by in vitro immunization using methods known in the art,
which for the purposes of this invention is considered equivalent
to in vivo immunization. Polyclonal antisera is obtained by
bleeding the immunized animal into a glass or plastic container,
incubating the blood at 25.degree. C. for one hour, followed by
incubating at 4.degree. C. for 2-18 hours. The serum is recovered
by centrifugation (eg. 1,000g for 10 minutes). About 20-50 ml per
bleed may be obtained from rabbits.
[0163] Monoclonal antibodies are prepared using the standard method
of Kohler & Milstein [Nature (1975) 256:495-96], or a
modification thereof. Typically, a mouse or rat is immunized as
described above. However, rather than bleeding the animal to
extract serum, the spleen (and optionally several large lymph
nodes) is removed and dissociated into single cells. If desired,
the spleen cells may be screened (after removal of nonspecifically
adherent cells) by applying a cell suspension to a plate or well
coated with the protein antigen. B-cells expressing membrane-bound
immunoglobulin specific for the antigen bind to the plate, and are
not rinsed away with the rest of the suspension. Resulting B-cells,
or all dissociated spleen cells, are then induced to fuse with
myeloma cells to form hybridomas, and are cultured in a selective
medium (eg hypoxanthine, aminopterin, thymidine medium, "HAT"). The
resulting hybridomas are plated by limiting dilution, and are
assayed for production of antibodies which bind specifically to the
immunizing antigen (and which do not bind to unrelated antigens).
The selected MAb-secreting hybridomas are then cultured either in
vitro (eg. in tissue culture bottles or hollow fiber reactors), or
in vivo (as ascites in mice).
[0164] If desired, the antibodies (whether polyclonal or
monoclonal) may be labeled using conventional techniques. Suitable
labels include fluorophores, chromophores, radioactive atoms
(particularly .sup.32P and .sup.25I), electron-dense reagents,
enzymes, and ligands having specific binding partners. Enzymes are
typically detected by their activity. For example, horseradish
peroxidase is usually detected by its ability to convert
3,3',5,5'-tetramethylbenzidine (TMB) to a blue pigment,
quantifiable with a spectrophotometer. "Specific binding partner"
refers to a protein capable of binding a ligand molecule with high
specificity, as for example in the case of an antigen and a
monoclonal antibody specific therefor. Other specific binding
partners include biotin and avidin or streptavidin, IgG and protein
A, and the numerous receptor-ligand couples known in the art. It
should be understood that the above description is not meant to
categorize the various labels into distinct classes, as the same
label may serve in several different modes. For example, .sup.125I
may serve as a radioactive label or as an electron-dense reagent.
HRP may serve as enzyme or as antigen for a MAb. Further, one may
combine various labels for desired effect. For example, MAbs and
avidin also require labels in the practice of this invention: thus,
one might label a MAb with biotin, and detect its presence with
avidin labeled with .sup.125I, or with an anti-biotin MAb labeled
with HRP. Other permutations and possibilities will be readily
apparent to those of ordinary skill in the art, and are considered
as equivalents within the scope of the instant invention.
[0165] Pharmaceutical Compositions
[0166] Pharmaceutical compositions can comprise either
polypeptides, antibodies, or nucleic acid of the invention. The
pharmaceutical compositions will comprise a therapeutically
effective amount of either polypeptides, antibodies, or
polynucleotides of the claimed invention.
[0167] The term "therapeutically effective amount" as used herein
refers to an amount of a therapeutic agent to treat, ameliorate, or
prevent a desired disease or condition, or to exhibit a detectable
therapeutic or preventative effect. The effect can be detected by,
for example, chemical markers or antigen levels. Therapeutic
effects also include reduction in physical symptoms, such as
decreased body temperature. The precise effective amount for a
subject will depend upon the subject's size and health, the nature
and extent of the condition, and the therapeutics or combination of
therapeutics selected for administration. Thus, it is not useful to
specify an exact effective amount in advance. However, the
effective amount for a given situation can be determined by routine
experimentation and is within the judgement of the clinician.
[0168] For purposes of the present invention, an effective dose
will be from about 0.01 mg/ kg to 50 mg/kg or 0.05 mg/kg to about
10 mg/kg of the molecule of the invention in the individual to
which it is administered.
[0169] A pharmaceutical composition can also contain a
pharmaceutically acceptable carrier. The term "pharmaceutically
acceptable carrier" refers to a carrier for administration of a
therapeutic agent, such as antibodies or a polypeptide, genes, and
other therapeutic agents. The term refers to any pharmaceutical
carrier that does not itself induce the production of antibodies
harmful to the individual receiving the composition, and which may
be administered without undue toxicity. Suitable carriers may be
large, slowly metabolized macromolecules such as proteins,
polysaccharides, polylactic acids, polyglycolic acids, polymeric
amino acids, amino acid copolymers, and inactive virus particles.
Such carriers are well known to those of ordinary skill in the
art.
[0170] Pharmaceutically acceptable salts can be used therein, for
example, mineral acid salts such as hydrochlorides, hydrobromides,
phosphates, sulfates, and the like; and the salts of organic acids
such as acetates, propionates, malonates, benzoates, and the like.
A thorough discussion of pharmaceutically acceptable excipients is
available in Remington's Pharmaceutical Sciences (Mack Pub. Co.,
N.J. 1991).
[0171] Pharmaceutically acceptable carriers in therapeutic
compositions may contain liquids such as water, saline, glycerol
and ethanol. Additionally, auxiliary substances, such as wetting or
emulsifying agents, pH buffering substances, and the like, may be
present in such vehicles. Typically, the therapeutic compositions
are prepared as injectables, either as liquid solutions or
suspensions; solid forms suitable for solution in, or suspension
in, liquid vehicles prior to injection may also be prepared.
Liposomes are included within the definition of a pharmaceutically
acceptable carrier.
[0172] Delivery Methods
[0173] Once formulated, the compositions of the invention can be
administered directly to the subject. The subjects to be treated
can be animals; in particular, human subjects can be treated.
[0174] Direct delivery of the compositions will generally be
accomplished by injection, either subcutaneously,
intraperitoneally, intravenously or intramuscularly or delivered to
the interstitial space of a tissue. The compositions can also be
administered into a lesion. Other modes of administration include
oral and pulmonary administration, suppositories, and transdermal
or transcutaneous applications (eg. see WO98/20734), needles, and
gene guns or hyposprays. Dosage treatment may be a single dose
schedule or a multiple dose schedule.
[0175] Vaccines
[0176] Vaccines according to the invention may either be
prophylactic (ie. to prevent infection) or therapeutic (ie. to
treat disease after infection).
[0177] Such vaccines comprise immunising antigen(s), immunogen(s),
polypeptide(s), protein(s) or nucleic acid, usually in combination
with "pharmaceutically acceptable carriers," which include any
carrier that does not itself induce the production of antibodies
harmful to the individual receiving the composition. Suitable
carriers are typically large, slowly metabolized macromolecules
such as proteins, polysaccharides, polylactic acids, polyglycolic
acids, polymeric amino acids, amino acid copolymers, lipid
aggregates (such as oil droplets or liposomes), and inactive virus
particles. Such carriers are well known to those of ordinary skill
in the art. Additionally, these carriers may function as
immunostimulating agents ("adjuvants"). Furthermore, the antigen or
immunogen may be conjugated to a bacterial toxoid, such as a toxoid
from diphtheria, tetanus, cholera, H. pylori, etc. pathogens.
[0178] Preferred adjuvants to enhance effectiveness of the
composition include, but are not limited to: (1) oil-in-water
emulsion formulations (with or without other specific
immunostimulating agents such as muramyl peptides (see below) or
bacterial cell wall components), such as for example (a) MF59.TM.
(WO90/14837; Chapter 10 in Vaccine Design--the subunit and adjuvant
approach (1995) ed. Powell & Newman), containing 5% Squalene,
0.5% Tween 80, and 0.5% Span 85 (optionally containing MTP-PE)
formulated into submicron particles using a microfluidizer, (b)
SAF, containing 10% Squalane, 0.4% Tween 80, 5% pluronic-blocked
polymer L121, and thr-MDP either microfluidized into a submicron
emulsion or vortexed to generate a larger particle size emulsion,
and (c) RIBI.TM. adjuvant system (RAS), (Ribi Immunochem, Hamilton,
Mont.) containing 2% Squalene, 0.2% Tween 80, and one or more
bacterial cell wall components from the group consisting of
monophosphorylipid A (MPL), trehalose dimycolate (TDM), and cell
wall skeleton (CWS), preferably MPL+CWS (DETOX.TM.); (2) saponin
adjuvants, such as QS21 or STIMULON.TM. (Cambridge Bioscience,
Worcester, Mass.) may be used or particles generated therefrom such
as ISCOMs (immunostimulating complexes), which ISCOMS may be devoid
of additional detergent e.g. WO00/07621; (3) Complete Freund's
Adjuvant (CFA) and Incomplete Freund's Adjuvant (IFA); (4)
cytokines, such as interleukins (e.g. IL-1, IL-2, IL-4, IL-5, IL-6,
IL-7, IL-12 (WO99/44636), etc.), interferons (e.g. gamma
interferon), macrophage colony stimulating factor (M-CSF), tumor
necrosis factor (TNF), etc.; (5) monophosphoryl lipid A (MPL) or
3-O-deacylated MPL (3dMPL) e.g. GB-2220221, EP-A-0689454; (6)
combinations of 3dMPL with, for example, QS21 and/or oil-in-water
emulsions e.g. EP-A-0835318, EP-A-0735898, EP-A-0761231; (7)
oligonucleotides comprising CpG motifs [Krieg Vaccine 2000, 19,
618-622; Krieg Curr Opin Mol Ther 2001 3:15-24; Roman et al., Nat.
Med., 1997, 3, 849-854; Weiner et al., PNAS USA, 1997, 94,
10833-10837; Davis et al., J. Immunol., 1998, 160, 870-876; Chu et
al., J. Exp. Med., 1997, 186, 1623-1631; Lipford et al., Eur. J.
Immunol., 1997, 27, 2340-2344; Moldoveanu et al., Vaccine, 1988,
16, 1216-1224, Krieg et al., Nature, 1995, 374, 546-549; Klinman et
al., PNAS USA, 1996, 93, 2879-2883; Ballas et al., J. Immunol.,
1996, 157, 1840-1845; Cowdery et al., J. Immunol., 1996, 156,
4570-4575; Halpern et al., Cell. Immunol., 1996, 167, 72-78;
Yamamoto et al., Jpn. J. Cancer Res., 1988, 79, 866-873; Stacey et
al., J. Immunol., 1996, 157, 2116-2122; Messina et al., J.
Immunol., 1991, 147, 1759-1764; Yi et al., J. Immunol., 1996, 157,
4918-4925; Yi et al., J. Immunol., 1996, 157, 5394-5402; Yi et al.,
J. Immunol., 1998, 160, 4755-4761; and Yi et al., J. Immunol.,
1998, 160, 5898-5906; International patent applications WO96/02555,
WO98/16247, WO98/18810, WO98/40100, WO98/55495, WO98/37919 and
WO98/52581] i.e. containing at least one CG dinucleotide, with
5-methylcytosine optionally being used in place of cytosine; (8) a
polyoxyethylene ether or a polyoxyethylene ester e.g. WO99/52549;
(9) a polyoxyethylene sorbitan ester surfactant in combination with
an octoxynol (e.g. WO01/21207) or a polyoxyethylene alkyl ether or
ester surfactant in combination with at least one additional
non-ionic surfactant such as an octoxynol (e.g. WO01/21152); (10)
an immunostimulatory oligonucleotide (e.g. a CpG oligonucleotide)
and a saponin e.g. WO00/62800; (11) an immunostimulant and a
particle of metal salt e.g. WO00/23105; (12) a saponin and an
oil-in-water emulsion e.g. WO99/11241; (13) a saponin (e.g.
QS21)+3dMPL+IL-12 (optionally+a sterol) e.g. WO98/57659; (14)
aluminium salts, preferably hydroxide or phosphate, but any other
suitable salt may also be used (e.g. hydroxyphosphate,
oxyhydroxide, orthophosphate, sulphate etc. [e.g. see chapters 8
& 9 of Powell & Newman]). Mixtures of different aluminium
salts may also be used. The salt may take any suitable form (e.g.
gel, crystalline, amorphous etc.); (15) other substances that act
as immunostimulating agents to enhance the efficacy of the
composition. Aluminium salts and/or MF59.TM. are preferred.
[0179] As mentioned above, muramyl peptides include, but are not
limited to, N-acetyl-muramyl-L-threonyl-D-isoglutamine (thr-MDP),
N-acetyl-normuramyl-L-alanyl-D-isoglutamine (nor-MDP),
N-acetylmuramyl-L-alanyl-D-isoglutaminyl-L-alanine-2-(1'-2'-dipalmitoyl-s-
n-glycero-3-hydroxyphos-phoryloxy) -ethylamine (MTP-PE), etc.
[0180] The immunogenic compositions (eg. the immunising
antigen/immunogen/polypeptide/protein/nucleic acid,
pharmaceutically acceptable carrier, and adjuvant) typically will
contain diluents, such as water, saline, glycerol, ethanol, etc.
Additionally, auxiliary substances, such as wetting or emulsifying
agents, pH buffering substances, and the like, may be present in
such vehicles.
[0181] Typically, the immunogenic compositions are prepared as
injectables, either as liquid solutions or suspensions; solid forms
suitable for solution in, or suspension in, liquid vehicles prior
to injection may also be prepared. The preparation also may be
emulsified or encapsulated in liposomes for enhanced adjuvant
effect, as discussed above under pharmaceutically acceptable
carriers.
[0182] Immunogenic compositions used as vaccines comprise an
immunologically effective amount of the antigenic or immunogenic
polypeptides, as well as any other of the above-mentioned
components, as needed. By "immunologically effective amount", it is
meant that the administration of that amount to an individual,
either in a single dose or as part of a series, is effective for
treatment or prevention. This amount varies depending upon the
health and physical condition of the individual to be treated, the
taxonomic group of individual to be treated (eg. nonhuman primate,
primate, etc.), the capacity of the individual's immune system to
synthesize antibodies, the degree of protection desired, the
formulation of the vaccine, the treating doctor's assessment of the
medical situation, and other relevant factors. It is expected that
the amount will fall in a relatively broad range that can be
determined through routine trials.
[0183] The immunogenic compositions are conventionally administered
parenterally, eg. by injection, either subcutaneously,
intramuscularly, or transdermally/transcutaneously (eg.
WO98/20734). Additional formulations suitable for other modes of
administration include oral and pulmonary formulations,
suppositories, and transdermal applications. Dosage treatment may
be a single dose schedule or a multiple dose schedule. The vaccine
may be administered in conjunction with other immunoregulatory
agents.
[0184] As an alternative to protein-based vaccines, DNA vaccination
may be used [eg. Robinson & Torres (1997) Seminars in Immunol
9:271-283; Donnelly et al. (1997) Annu Rev Immunol 15:617-648;
later herein].
[0185] Gene Delivery Vehicles
[0186] Gene therapy vehicles for delivery of constructs including a
coding sequence of a therapeutic of the invention, to be delivered
to the mammal for expression in the mammal, can be administered
either locally or systemically. These constructs can utilize viral
or non-viral vector approaches in in vivo or ex vivo modality.
Expression of such coding sequence can be induced using endogenous
mammalian or heterologous promoters. Expression of the coding
sequence in vivo can be either constitutive or regulated.
[0187] The invention includes gene delivery vehicles capable of
expressing the contemplated nucleic acid sequences. The gene
delivery vehicle is preferably a viral vector and, more preferably,
a retroviral, adenoviral, adeno-associated viral (AAV), herpes
viral, or alphavirus vector. The viral vector can also be an
astrovirus, coronavirus, orthomyxovirus, papovavirus,
paramyxovirus, parvovirus, picornavirus, poxvirus, or togavirus
viral vector. See generally, Jolly (1994) Cancer Gene Therapy
1:51-64; Kimura (1994) Human Gene Therapy 5:845-852; Connelly
(1995) Human Gene Therapy 6:185-193; and Kaplitt (1994) Nature
Genetics 6:148-153.
[0188] Retroviral vectors are well known in the art and we
contemplate that any retroviral gene therapy vector is employable
in the invention, including B, C and D type retroviruses,
xenotropic retroviruses (for example, NZB-X1, NZB-X2 and NZB9-1
(see O'Neill (1985) J. Virol. 53:160) polytropic retroviruses eg.
MCF and MCF-MLV (see Kelly (1983) J. Virol. 45:291), spumaviruses
and lentiviruses. See RNA Tumor Viruses, Second Edition, Cold
Spring Harbor Laboratory, 1985.
[0189] Portions of the retroviral gene therapy vector may be
derived from different retroviruses. For example, retrovector LTRs
may be derived from a Murine Sarcoma Virus, a tRNA binding site
from a Rous Sarcoma Virus, a packaging signal from a Murine
Leukemia Virus, and an origin of second strand synthesis from an
Avian Leukosis Virus.
[0190] These recombinant retroviral vectors may be used to generate
transduction competent retroviral vector particles by introducing
them into appropriate packaging cell lines (see U.S. Pat. No.
5,591,624). Retrovirus vectors can be constructed for site-specific
integration into host cell DNA by incorporation of a chimeric
integrase enzyme into the retroviral particle (see WO96/37626). It
is preferable that the recombinant viral vector is a replication
defective recombinant virus.
[0191] Packaging cell lines suitable for use with the
above-described retrovirus vectors are well known in the art, are
readily prepared (see WO95/30763 and WO92/05266), and can be used
to create producer cell lines (also termed vector cell lines or
"VCLs") for the production of recombinant vector particles.
Preferably, the packaging cell lines are made from human parent
cells (eg. HT1080 cells) or mink parent cell lines, which
eliminates inactivation in human serum.
[0192] Preferred retroviruses for the construction of retroviral
gene therapy vectors include Avian Leukosis Virus, Bovine Leukemia,
Virus, Murine Leukemia Virus, Mink-Cell Focus-Inducing Virus,
Murine Sarcoma Virus, Reticuloendotheliosis Virus and Rous Sarcoma
Virus. Particularly preferred Murine Leukemia Viruses include 4070A
and 1504A (Hartley and Rowe (1976) J Virol 19:19-25), Abelson (ATCC
No. VR-999), Friend (ATCC No. VR-245), Graffi, Gross (ATCC Nol
VR-590), Kirsten, Harvey Sarcoma Virus and Rauscher (ATCC No.
VR-998) and Moloney Murine Leukemia Virus (ATCC No. VR-190). Such
retroviruses may be obtained from depositories or collections such
as the American Type Culture Collection ("ATCC") in Rockville, Md.
or isolated from known sources using commonly available
techniques.
[0193] Exemplary known retroviral gene therapy vectors employable
in this invention include those described in patent applications
GB2200651, EP0415731, EP0345242, EP0334301, WO89/02468; WO89/05349,
WO89/09271, WO90/02806, WO90/07936, WO94/03622, WO93/25698,
WO93/25234, WO93/1 1230, WO93/10218, WO91/02805, WO91/02825,
WO95/07994, U.S. Pat. Nos. 5,219,740, 4,405,712, 4,861,719,
4,980,289, 4,777,127, 5,591,624. See also Vile (1993) Cancer Res
53:3860-3864; Vile (1993) Cancer Res 53:962-967; Ram (1993) Cancer
Res 53 (1993) 83-88; Takamiya (1992) J Neurosci Res 33:493-503;
Baba (1993) J Neurosurg 79:729-735; Mann (1983) Cell 33:153; Cane
(1984) Proc Natl Acad Sci 81:6349; and Miller (1990) Human Gene
Therapy 1.
[0194] Human adenoviral gene therapy vectors are also known in the
art and employable in this invention. See, for example, Berkner
(1988) Biotechniques 6:616 and Rosenfeld (1991) Science 252:431,
and WO93/07283, WO93/06223, and WO93/07282. Exemplary known
adenoviral gene therapy vectors employable in this invention
include those described in the above referenced documents and in
WO94/12649, WO93/03769, WO93/19191, WO94/28938, WO95/11984,
WO95/00655, WO95/27071, WO95/29993, WO95/34671, WO96/05320,
WO94/08026, WO94/11506, WO93/06223, WO94/24299, WO95/14102,
WO95/24297, WO95/02697, WO94/28152, WO94/24299, WO95/09241,
WO95/25807, WO95/05835, WO94/18922 and WO95/09654. Alternatively,
administration of DNA linked to killed adenovirus as described in
Curiel (1992) Hum. Gene Ther. 3:147-154 may be employed. The gene
delivery vehicles of the invention also include adenovirus
associated virus (AAV) vectors. Leading and preferred examples of
such vectors for use in this invention are the AAV-2 based vectors
disclosed in Srivastava, WO93/09239. Most preferred AAV vectors
comprise the two AAV inverted terminal repeats in which the native
D-sequences are modified by substitution of nucleotides, such that
at least 5 native nucleotides and up to 18 native nucleotides,
preferably at least 10 native nucleotides up to 18 native
nucleotides, most preferably 10 native nucleotides are retained and
the remaining nucleotides of the D-sequence are deleted or replaced
with non-native nucleotides. The native D-sequences of the AAV
inverted terminal repeats are sequences of 20 consecutive
nucleotides in each AAV inverted terminal repeat (ie. there is one
sequence at each end) which are not involved in HP formation. The
non-native replacement nucleotide may be any nucleotide other than
the nucleotide found in the native D-sequence in the same position.
Other employable exemplary AAV vectors are pWP-19, pWN-1, both of
which are disclosed in Nahreini (1993) Gene 124:257-262. Another
example of such an AAV vector is psub201 (see Samulski (1987) J.
Virol. 61:3096). Another exemplary AAV vector is the Double-D ITR
vector. Construction of the Double-D ITR vector is disclosed in
U.S. Pat. No. 5,478,745. Still other vectors are those disclosed in
Carter U.S. Pat. No. 4,797,368 and Muzyczka U.S. Pat. No.
5,139,941, Chartejee U.S. Pat. No. 5,474,935, and Kotin
WO94/288157. Yet a further example of an AAV vector employable in
this invention is SSV9AFABTKneo, which contains the AFP enhancer
and albumin promoter and directs expression predominantly in the
liver. Its structure and construction are disclosed in Su (1996)
Human Gene Therapy 7:463-470. Additional AAV gene therapy vectors
are described in U.S. Pat. Nos. 5,354,678, 5,173,414, 5,139,941,
and 5,252,479.
[0195] The gene therapy vectors of the invention also include
herpes vectors. Leading and preferred examples are herpes simplex
virus vectors containing a sequence encoding a thymidine kinase
polypeptide such as those disclosed in U.S. Pat. No. 5,288,641 and
EP0176170 (Roizman). Additional exemplary herpes simplex virus
vectors include HFEM/ICP6-LacZ disclosed in WO95/04139 (Wistar
Institute), pHSVlac described in Geller (1988) Science
241:1667-1669 and in WO90/09441 and WO92/07945, HSV Us3::pgC-lacZ
described in Fink (1992) Human Gene Therapy 3:11-19 and HSV 7134, 2
RH 105 and GAL4 described in EP 0453242 (Breakefield), and those
deposited with the ATCC with accession numbers VR-977 and
VR-260.
[0196] Also contemplated are alpha virus gene therapy vectors that
can be employed in this invention. Preferred alpha virus vectors
are Sindbis viruses vectors. Togaviruses, Semliki Forest virus
(ATCC VR-67; ATCC VR-1247), Middleberg virus (ATCC VR-370), Ross
River virus (ATCC VR-373; ATCC VR-1246), Venezuelan equine
encephalitis virus (ATCC VR923; ATCC VR-1250; ATCC VR-1249; ATCC
VR-532), and those described in U.S. Pat. Nos. 5,091,309,
5,217,879, and WO92/10578. More particularly, those alpha virus
vectors described in U.S. Ser. No. 08/405,627, filed Mar. 15, 1995,
WO94/21792, WO92/10578, WO95/07994, U.S. Pat. Nos. 5,091,309 and
5,217,879 are employable. Such alpha viruses may be obtained from
depositories or collections such as the ATCC in Rockville, Md. or
isolated from known sources using commonly available techniques.
Preferably, alphavirus vectors with reduced cytotoxicity are used
(see U.S. Ser. No. 08/679640).
[0197] DNA vector systems such as eukaryotic layered expression
systems are also useful for expressing the nucleic acids of the
invention. See WO95/07994 for a detailed description of eukaryotic
layered expression systems. Preferably, the eukaryotic layered
expression systems of the invention are derived from alphavirus
vectors and most preferably from Sindbis viral vectors.
[0198] Other viral vectors suitable for use in the present
invention include those derived from poliovirus, for example ATCC
VR-58 and those described in Evans, Nature 339 (1989) 385 and Sabin
(1973) J. Biol. Standardization 1:115; rhinovirus, for example ATCC
VR- 1110 and those described in Arnold (1990) J Cell Biochem L401;
pox viruses such as canary pox virus or vaccinia virus, for example
ATCC VR-111 and ATCC VR-2010 and those described in Fisher-Hoch
(1989) Proc Natl Acad Sci 86:317; Flexner (1989) Ann NY Acad Sci
569:86, Flexner (1990) Vaccine 8:17; in U.S. Pat. Nos. 4,603,112
and 4,769,330 and WO89/01973; SV40 virus, for example ATCC VR-305
and those described in Mulligan (1979) Nature 277:108 and Madzak
(1992) J Gen Virol 73:1533; influenza virus, for example ATCC
VR-797 and recombinant influenza viruses made employing reverse
genetics techniques as described in U.S. Pat. No. 5,166,057 and in
Enami (1990) Proc Natl Acad Sci 87:3802-3805; Enami & Palese
(1991) J Virol 65:2711-2713 and Luytjes (1989) Cell 59:110, (see
also McMichael (1983) NEJ Med 309:13, and Yap (1978) Nature 273:238
and Nature (1979) 277:108); human immunodeficiency virus as
described in EP-0386882 and in Buchschacher (1992) J. Virol.
66:2731; measles virus, for example ATCC VR-67 and VR-1247 and
those described in EP-0440219; Aura virus, for example ATCC VR-368;
Bebaru virus, for example ATCC VR-600 and ATCC VR-1240; Cabassou
virus, for example ATCC VR-922; Chikungunya virus, for example ATCC
VR-64 and ATCC VR-1241; Fort Morgan Virus, for example ATCC VR-924;
Getah virus, for example ATCC VR-369 and ATCC VR-1243; Kyzylagach
virus, for example ATCC VR-927; Mayaro virus, for example ATCC
VR-66; Mucambo virus, for example ATCC VR-580 and ATCC VR-1244;
Ndumu virus, for example ATCC VR-371; Pixuna virus, for example
ATCC VR-372 and ATCC VR-1245; Tonate virus, for example ATCC
VR-925; Triniti virus, for example ATCC VR-469; Una virus, for
example ATCC VR-374; Whataroa virus, for example ATCC VR-926;
Y-62-33 virus, for example ATCC VR-375; O'Nyong virus, Eastern
encephalitis virus, for example ATCC VR-65 and ATCC VR-1242;
Western encephalitis virus, for example ATCC VR-70, ATCC VR-1251,
ATCC VR-622 and ATCC VR-1252; and coronavirus, for example ATCC
VR-740 and those described in Hamre (1966) Proc Soc Exp Biol Med
121:190.
[0199] Delivery of the compositions of this invention into cells is
not limited to the above mentioned viral vectors. Other delivery
methods and media may be employed such as, for example, nucleic
acid expression vectors, polycationic condensed DNA linked or
unlinked to killed adenovirus alone, for example see U.S. Ser. No.
08/366,787, filed Dec. 30, 1994 and Curiel (1992) Hum Gene Ther
3:147-154 ligand linked DNA, for example see Wu (1989) J Biol Chem
264:16985-16987, eucaryotic cell delivery vehicles cells, for
example see U.S. Ser. No.08/240,030, filed May 9, 1994, and U.S.
Ser. No. 08/404,796, deposition of photopolymerized hydrogel
materials, hand-held gene transfer particle gun, as described in
U.S. Pat. No. 5,149,655, ionizing radiation as described in U.S.
Pat. No. 5,206,152 and in WO92/11033, nucleic charge neutralization
or fusion with cell membranes. Additional approaches are described
in Philip (1994) Mol Cell Biol 14:2411-2418 and in Woffendin (1994)
Proc Natl Acad Sci 91:1581-1585.
[0200] Particle mediated gene transfer may be employed, for example
see U.S. Ser. No. 60/023,867. Briefly, the sequence can be inserted
into conventional vectors that contain conventional control
sequences for high level expression, and then incubated with
synthetic gene transfer molecules such as polymeric DNA-binding
cations like polylysine, protamine, and albumin, linked to cell
targeting ligands such as asialoorosomucoid, as described in Wu
& Wu (1987) J. Biol. Chem. 262:4429-4432, insulin as described
in Hucked (1990) Biochem Pharmacol 40:253-263, galactose as
described in Plank (1992) Bioconjugate Chem 3:533-539, lactose or
transferrin.
[0201] Naked DNA may also be employed. Exemplary naked DNA
introduction methods are described in WO90/11092 and U.S. Pat. No.
5,580,859. Uptake efficiency may be improved using biodegradable
latex beads. DNA coated latex beads are efficiently transported
into cells after endocytosis initiation by the beads. The method
may be improved further by treatment of the beads to increase
hydrophobicity and thereby facilitate disruption of the endosome
and release of the DNA into the cytoplasm.
[0202] Liposomes that can act as gene delivery vehicles are
described in U.S. Pat. No. 5,422,120, WO95/13796, WO94/23697,
WO91/14445 and EP-524,968. As described in U.S. Ser. No.
60/023,867, on non-viral delivery, the nucleic acid sequences
encoding a polypeptide can be inserted into conventional vectors
that contain conventional control sequences for high level
expression, and then be incubated with synthetic gene transfer
molecules such as polymeric DNA-binding cations like polylysine,
protamine, and albumin, linked to cell targeting ligands such as
asialoorosomucoid, insulin, galactose, lactose, or transferrin.
Other delivery systems include the use of liposomes to encapsulate
DNA comprising the gene under the control of a variety of
tissue-specific or ubiquitously-active promoters. Further non-viral
delivery suitable for use includes mechanical delivery systems such
as the approach described in Woffendin et al (1994) Proc. Natl.
Acad. Sci. USA 91(24):11581-11585. Moreover, the coding sequence
and the product of expression of such can be delivered through
deposition of photopolymerized hydrogel materials. Other
conventional methods for gene delivery that can be used for
delivery of the coding sequence include, for example, use of
hand-held gene transfer particle gun, as described in U.S. Pat. No.
5,149,655; use of ionizing radiation for activating transferred
gene, as described in U.S. Pat. No. 5,206,152 and WO92/11033
[0203] Exemplary liposome and polycationic gene delivery vehicles
are those described in U.S. Pat. Nos. 5,422,120 and 4,762,915; in
WO95/13796; WO94/23697; and WO91/14445; in EP-0524968; and in
Stryer, Biochemistry, pages 236-240 (1975) W. H. Freeman, San
Francisco; Szoka (1980) Biochem Biophys Acta 600:1; Bayer (1979)
Biochem Biophys Acta 550:464; Rivnay (1987) Meth Enzymol 149:119;
Wang (1987) Proc Natl Acad Sci 84:7851; Plant (1989) Anal Biochem
176:420.
[0204] A polynucleotide composition can comprises therapeutically
effective amount of a gene therapy vehicle, as the term is defined
above. For purposes of the present invention, an effective dose
will be from about 0.01 mg/ kg to 50 mg/kg or 0.05 mg/kg to about
10 mg/kg of the DNA constructs in the individual to which it is
administered.
[0205] Deliverv Methods
[0206] Once formulated, the polynucleotide compositions of the
invention can be administered (1) directly to the subject; (2)
delivered ex vivo, to cells derived from the subject; or (3) in
vitro for expression of recombinant proteins. The subjects to be
treated can be mammals or birds. Also, human subjects can be
treated.
[0207] Direct delivery of the compositions will generally be
accomplished by injection, either subcutaneously,
intraperitoneally, intravenously or intramuscularly or delivered to
the interstitial space of a tissue. The compositions can also be
administered into a lesion. Other modes of administration include
oral and pulmonary administration, suppositories, and transdermal
or transcutaneous applications (eg. see WO98/20734), needles, and
gene guns or hyposprays. Dosage treatment may be a single dose
schedule or a multiple dose schedule.
[0208] Methods for the ex vivo delivery and reimplantation of
transformed cells into a subject are known in the art and described
in eg. WO93/14778. Examples of cells useful in ex vivo applications
include, for example, stem cells, particularly hematopoetic, lymph
cells, macrophages, dendritic cells, or tumor cells.
[0209] Generally, delivery of nucleic acids for both ex vivo and in
vitro applications can be accomplished by the following procedures,
for example, dextran-mediated transfection, calcium phosphate
precipitation, polybrene mediated transfection, protoplast fusion,
electroporation, encapsulation of the polynucleotide(s) in
liposomes, and direct microinjection of the DNA into nuclei, all
well known in the art.
[0210] Polynucleotide and Polypeptide Pharmaceutical
Compositions
[0211] In addition to the pharmaceutically acceptable carriers and
salts described above, the following additional agents can be used
with polynucleotide and/or polypeptide compositions.
[0212] A. Polypeptides
[0213] One example are polypeptides which include, without
limitation: asioloorosomucoid (ASOR); transferrin;
asialoglycoproteins; antibodies; antibody fragments; ferritin;
interleukins; interferons, granulocyte, macrophage colony
stimulating factor (GM-CSF), granulocyte colony stimulating factor
(G-CSF), macrophage colony stimulating factor (M-CSF), stem cell
factor and erythropoietin. Viral antigens, such as envelope
proteins, can also be used. Also, proteins from other invasive
organisms, such as the 17 amino acid peptide from the
circumsporozoite protein of plasmodium falciparum known as RII.
[0214] B. Hormones, Vitamins, etc.
[0215] Other groups that can be included are, for example:
hormones, steroids, androgens, estrogens, thyroid hormone, or
vitamins, folic acid.
[0216] C. Polyalkylenes, Polysaccharides, etc.
[0217] Also, polyalkylene glycol can be included with the desired
polynucleotides/polypeptides. In a preferred embodiment, the
polyalkylene glycol is polyethlylene glycol. In addition, mono-,
di-, or polysaccharides can be included. In a preferred embodiment
of this aspect, the polysaccharide is dextran or DEAE-dextran.
Also, chitosan and poly(lactide-co-glycolide)
[0218] D. Lipids, and Liposomes
[0219] The desired polynucleotide/polypeptide can also be
encapsulated in lipids or packaged in liposomes prior to delivery
to the subject or to cells derived therefrom.
[0220] Lipid encapsulation is generally accomplished using
liposomes which are able to stably bind or entrap and retain
nucleic acid. The ratio of condensed polynucleotide to lipid
preparation can vary but will generally be around 1:1 (mg
DNA:micromoles lipid), or more of lipid. For a review of the use of
liposomes as carriers for delivery of nucleic acids, see, Hug and
Sleight (1991) Biochim. Biophys. Acta. 1097:1-17; Straubinger
(1983) Meth. Enzymol. 101:512-527.
[0221] Liposomal preparations for use in the present invention
include cationic (positively charged), anionic (negatively charged)
and neutral preparations. Cationic liposomes have been shown to
mediate intracellular delivery of plasmid DNA (Felgner (1987) Proc.
Natl. Acad. Sci. USA 84:7413-7416); mRNA (Malone (1989) Proc. Natl.
Acad. Sci. USA 86:6077-6081); and purified transcription factors
(Debs (1990) J. Biol. Chem. 265:10189-10192), in functional
form.
[0222] Cationic liposomes are readily available. For example,
N[1-2,3-dioleyloxy)propyl]-N,N,N-triethyl-ammonium (DOTMA)
liposomes are available under the trademark Lipofectin, from GIBCO
BRL, Grand Island, N.Y. (See, also, Felgner supra). Other
commercially available liposomes include transfectace (DDAB/DOPE)
and DOTAP/DOPE (Boerhinger). Other cationic liposomes can be
prepared from readily available materials using techniques well
known in the art. See, eg. Szoka (1978) Proc. Natl. Acad. Sci. USA
75:4194-4198; WO90/11092 for a description of the synthesis of
DOTAP (1,2-bis(oleoyloxy)-3-(trimethylammonio)propane)
liposomes.
[0223] Similarly, anionic and neutral liposomes are readily
available, such as from Avanti Polar Lipids (Birmingham, Ala.), or
can be easily prepared using readily available materials. Such
materials include phosphatidyl choline, cholesterol, phosphatidyl
ethanolamine, dioleoylphosphatidyl choline (DOPC),
dioleoylphosphatidyl glycerol (DOPG), dioleoylphoshatidyl
ethanolamine (DOPE), among others. These materials can also be
mixed with the DOTMA and DOTAP starting materials in appropriate
ratios. Methods for making liposomes using these materials are well
known in the art.
[0224] The liposomes can comprise multilammelar vesicles (MLVs),
small unilamellar vesicles (SUVs), or large unilamellar vesicles
(LUVs). The various liposome-nucleic acid complexes are prepared
using methods known in the art. See eg. Straubinger (1983) Meth.
Immunol. 101:512-527; Szoka (1978) Proc. Natl. Acad. Sci. USA
75:4194-4198; Papahadjopoulos (1975) Biochim. Biophys. Acta
394:483; Wilson (1979) Cell 17:77); Deamer & Bangham (1976)
Biochim. Biophys. Acta 443:629; Ostro (1977) Biochem. Biophys. Res.
Commun. 76:836; Fraley (1979) Proc. Natl. Acad. Sci. USA 76:3348);
Enoch & Strittmatter (1979) Proc. Natl. Acad. Sci. USA 76:145;
Fraley (1980) J. Biol. Chem. (1980) 255:10431; Szoka &
Papahadjopoulos (1978) Proc. Natl. Acad. Sci. USA 75:145; and
Schaefer-Ridder (1982) Science 215:166.
[0225] E. Lipoproteins
[0226] In addition, lipoproteins can be included with the
polynucleotide/polypeptide to be delivered. Examples of
lipoproteins to be utilized include: chylomicrons, HDL, IDL, LDL,
and VLDL. Mutants, fragments, or fusions of these proteins can also
be used. Also, modifications of naturally occurring lipoproteins
can be used, such as acetylated LDL. These lipoproteins can target
the delivery of polynucleotides to cells expressing lipoprotein
receptors. Preferably, if lipoproteins are including with the
polynucleotide to be delivered, no other targeting ligand is
included in the composition.
[0227] Naturally occurring lipoproteins comprise a lipid and a
protein portion. The protein portion are known as apoproteins. At
the present, apoproteins A, B, C, D, and E have been isolated and
identified. At least two of these contain several proteins,
designated by Roman numerals, AI, AII, AIV; CI, CII, CIII.
[0228] A lipoprotein can comprise more than one apoprotein. For
example, naturally occurring chylomicrons comprises of A, B, C
& E, over time these lipoproteins lose A and acquire C & E.
VLDL comprises A, B, C & E apoproteins, LDL comprises
apoprotein B; and HDL comprises apoproteins A, C, & E.
[0229] The amino acid of these apoproteins are known and are
described in, for example, Breslow (1985) Annu Rev. Biochem 54:699;
Law (1986) Adv. Exp Med. Biol. 151:162; Chen (1986) J Biol Chem
261:12918; Kane (1980) Proc Natl Acad Sci USA 77:2465; and Utermann
(1984) Hum Genet 65:232.
[0230] Lipoproteins contain a variety of lipids including,
triglycerides, cholesterol (free and esters), and phospholipids.
The composition of the lipids varies in naturally occurring
lipoproteins. For example, chylomicrons comprise mainly
triglycerides. A more detailed description of the lipid content of
naturally occurring lipoproteins can be found, for example, in
Meth. Enzymol. 128 (1986). The composition of the lipids are chosen
to aid in conformation of the apoprotein for receptor binding
activity. The composition of lipids can also be chosen to
facilitate hydrophobic interaction and association with the
polynucleotide binding molecule.
[0231] Naturally occurring lipoproteins can be isolated from serum
by ultracentrifugation, for instance. Such methods are described in
Meth. Enzymol. (supra); Pitas (1980) J. Biochem. 255:5454-5460 and
Mahey (1979) J Clin. Invest 64:743-750. Lipoproteins can also be
produced by in vitro or recombinant methods by expression of the
apoprotein genes in a desired host cell. See, for example, Atkinson
(1986) Annu Rev Biophys Chem 15:403 and Radding (1958) Biochim
Biophys Acta 30: 443. Lipoproteins can also be purchased from
commercial suppliers, such as Biomedical Technologies, Inc.,
Stoughton, Mass., USA. Further description of lipoproteins can be
found in WO98/06437.
[0232] F. Polycationic Agents
[0233] Polycationic agents can be included, with or without
lipoprotein, in a composition with the desired
polynucleotide/polypeptide to be delivered.
[0234] Polycationic agents, typically, exhibit a net positive
charge at physiological relevant pH and are capable of neutralizing
the electrical charge of nucleic acids to facilitate delivery to a
desired location. These agents have both in vitro, ex vivo, and in
vivo applications. Polycationic agents can be used to deliver
nucleic acids to a living subject either intramuscularly,
subcutaneously, etc.
[0235] The following are examples of useful polypeptides as
polycationic agents: polylysine, polyarginine, polyornithine, and
protamine. Other examples include histones, protamines, human serum
albumin, DNA binding proteins, non-histone chromosomal proteins,
coat proteins from DNA viruses, such as (X174, transcriptional
factors also contain domains that bind DNA and therefore may be
useful as nucleic aid condensing agents. Briefly, transcriptional
factors such as C/CEBP, c-jun, c-fos, AP-1, AP-2, AP-3, CPF,
Prot-1, Sp-1, Oct-1, Oct-2, CREP, and TFIID contain basic domains
that bind DNA sequences.
[0236] Organic polycationic agents include: spermine, spermidine,
and purtrescine.
[0237] The dimensions and of the physical properties of a
polycationic agent can be extrapolated from the list above, to
construct other polypeptide polycationic agents or to produce
synthetic polycationic agents.
[0238] Synthetic polycationic agents which are useful include, for
example, DEAE-dextran, polybrene. Lipofectin.TM., and
LIPOFECTAMINE.TM. are monomers that form polycationic complexes
when combined with polynucleotides/polypeptides.
[0239] Immunodiagnostic Assays
[0240] Streptococcus antigens of the invention can be used in
immunoassays to detect antibody levels (or, conversely,
anti-streptococcus antibodies can be used to detect antigen
levels). Immunoassays based on well defined, recombinant antigens
can be developed to replace invasive diagnostics methods.
Antibodies to streptococcus proteins within biological samples,
including for example, blood or serum samples, can be detected.
Design of the immunoassays is subject to a great deal of variation,
and a variety of these are known in the art. Protocols for the
immunoassay may be based, for example, upon competition, or direct
reaction, or sandwich type assays. Protocols may also, for example,
use solid supports, or may be by immunoprecipitation. Most assays
involve the use of labeled antibody or polypeptide; the labels may
be, for example, fluorescent, chemiluminescent, radioactive, or dye
molecules. Assays which amplify the signals from the probe are also
known; examples of which are assays which utilize biotin and
avidin, and enzyme-labeled and mediated immunoassays, such as ELISA
assays.
[0241] Kits suitable for immunodiagnosis and containing the
appropriate labeled reagents are constructed by packaging the
appropriate materials, including the compositions of the invention,
in suitable containers, along with the remaining reagents and
materials (for example, suitable buffers, salt solutions, etc.)
required for the conduct of the assay, as well as suitable set of
assay instructions.
[0242] Nucleic Acid Hybridisation
[0243] "Hybridization" refers to the association of two nucleic
acid sequences to one another by hydrogen bonding. Typically, one
sequence will be fixed to a solid support and the other will be
free in solution. Then, the two sequences will be placed in contact
with one another under conditions that favor hydrogen bonding.
Factors that affect this bonding include: the type and volume of
solvent; reaction temperature; time of hybridization; agitation;
agents to block the non-specific attachment of the liquid phase
sequence to the solid support (Denhardt's reagent or BLOTTO);
concentration of the sequences; use of compounds to increase the
rate of association of sequences (dextran sulfate or polyethylene
glycol); and the stringency of the washing conditions following
hybridization. See Sambrook et al. [supra] Volume 2, chapter 9,
pages 9.47 to 9.57.
[0244] "Stringency" refers to conditions in a hybridization
reaction that favor association of very similar sequences over
sequences that differ. For example, the combination of temperature
and salt concentration should be chosen that is approximately 120
to 200.degree. C. below the calculated Tm of the hybrid under
study. The temperature and salt conditions can often be determined
empirically in preliminary experiments in which samples of genomic
DNA immobilized on filters are hybridized to the sequence of
interest and then washed under conditions of different
stringencies. See Sambrook et al. at page 9.50.
[0245] Variables to consider when performing, for example, a
Southern blot are (1) the complexity of the DNA being blotted and
(2) the homology between the probe and the sequences being
detected. The total amount of the fragment(s) to be studied can
vary a magnitude of 10, from 0.1 to 1 .mu.g for a plasmid or phage
digest to 10.sup.-9 to 10.sup.-8 g for a single copy gene in a
highly complex eukaryotic genome. For lower complexity
polynucleotides, substantially shorter blotting, hybridization, and
exposure times, a smaller amount of starting polynucleotides, and
lower specific activity of probes can be used. For example, a
single-copy yeast gene can be detected with an exposure time of
only 1 hour starting with 1 .mu.g of yeast DNA, blotting for two
hours, and hybridizing for 4-8 hours with a probe of 10.sup.8
cpm/.mu.g. For a single-copy mammalian gene a conservative approach
would start with 10 .mu.g of DNA, blot overnight, and hybridize
overnight in the presence of 10% dextran sulfate using a probe of
greater than 10.sup.8 cpm/.mu.g, resulting in an exposure time of
.about.24 hours.
[0246] Several factors can affect the melting temperature (Tm) of a
DNA-DNA hybrid between the probe and the fragment of interest, and
consequently, the appropriate conditions for hybridization and
washing. In many cases the probe is not 100% homologous to the
fragment. Other commonly encountered variables include the length
and total G+C content of the hybridizing sequences and the ionic
strength and formamide content of the hybridization buffer. The
effects of all of these factors can be approximated by a single
equation:
Tm=81+16.6(log.sub.10Ci)+0.4[%(G+C)]-0.6(%formamide)-600/n-1.5(%mismatch)-
.
[0247] where Ci is the salt concentration (monovalent ions) and n
is the length of the hybrid in base pairs (slightly modified from
Meinkoth & Wahl (1984) Anal. Biochem. 138: 267-284).
[0248] In designing a hybridization experiment, some factors
affecting nucleic acid hybridization can be conveniently altered.
The temperature of the hybridization and washes and the salt
concentration during the washes are the simplest to adjust. As the
temperature of the hybridization increases (ie. stringency), it
becomes less likely for hybridization to occur between strands that
are nonhomologous, and as a result, background decreases. If the
radiolabeled probe is not completely homologous with the
immobilized fragment (as is frequently the case in gene family and
interspecies hybridization experiments), the hybridization
temperature must be reduced, and background will increase. The
temperature of the washes affects the intensity of the hybridizing
band and the degree of background in a similar manner. The
stringency of the washes is also increased with decreasing salt
concentrations.
[0249] In general, convenient hybridization temperatures in the
presence of 50% formamide are 42.degree. C. for a probe with is 95%
to 100% homologous to the target fragment, 37.degree. C. for 90% to
95% homology, and 32.degree. C. for 85% to 90% homology. For lower
homologies, formamide content should be lowered and temperature
adjusted accordingly, using the equation above. If the homology
between the probe and the target fragment are not known, the
simplest approach is to start with both hybridization and wash
conditions which are nonstringent. If non-specific bands or high
background are observed after autoradiography, the filter can be
washed at high stringency and reexposed. If the time required for
exposure makes this approach impractical, several hybridization
and/or washing stringencies should be tested in parallel.
[0250] Nucleic Acid Probe Assays
[0251] Methods such as PCR, branched DNA probe assays, or blotting
techniques utilizing nucleic acid probes according to the invention
can determine the presence of cDNA or mRNA. A probe is said to
"hybridize" with a sequence of the invention if it can form a
duplex or double stranded complex, which is stable enough to be
detected.
[0252] The nucleic acid probes will hybridize to the streptococcus
nucleotide sequences of the invention (including both sense and
antisense strands). Though many different nucleotide sequences will
encode the amino acid sequence, the native streptococcus sequence
is preferred because it is the actual sequence present in cells.
mRNA represents a coding sequence and so a probe should be
complementary to the coding sequence; single-stranded cDNA is
complementary to mRNA, and so a cDNA probe should be complementary
to the non-coding sequence.
[0253] The probe sequence need not be identical to the
streptococcus sequence (or its complement)--some variation in the
sequence and length can lead to increased assay sensitivity if the
nucleic acid probe can form a duplex with target nucleotides, which
can be detected. Also, the nucleic acid probe can include
additional nucleotides to stabilize the formed duplex. Additional
streptococcus sequence may also be helpful as a label to detect the
formed duplex. For example, a non-complementary nucleotide sequence
may be attached to the 5' end of the probe, with the remainder of
the probe sequence being complementary to a streptococcus sequence.
Alternatively, non-complementary bases or longer sequences can be
interspersed into the probe, provided that the probe sequence has
sufficient complementarity with the a streptococcus sequence in
order to hybridize therewith and thereby form a duplex which can be
detected.
[0254] The exact length and sequence of the probe will depend on
the hybridization conditions (e.g. temperature, salt condition
etc.). For example, for diagnostic applications, depending on the
complexity of the analyte sequence, the nucleic acid probe
typically contains at least 10-20 nucleotides, preferably 15-25,
and more preferably at least 30 nucleotides, although it may be
shorter than this. Short primers generally require cooler
temperatures to form sufficiently stable hybrid complexes with the
template.
[0255] Probes may be produced by synthetic procedures, such as the
triester method of Matteucci et al. [J. Am. Chem. Soc. (1981)
103:3185], or according to Urdea et al. [Proc. Natl. Acad. Sci. USA
(1983) 80: 7461], or using commercially available automated
oligonucleotide synthesizers.
[0256] The chemical nature of the probe can be selected according
to preference. For certain applications, DNA or RNA are
appropriate. For other applications, modifications may be
incorporated eg backbone modifications, such as phosphorothioates
or methylphosphonates, can be used to increase in vivo half-life,
alter RNA affinity, increase nuclease resistance etc. [eg. see
Agrawal & Iyer (1995) Curr Opin Biotechnol 6:12-19; Agrawal
(1996) TIBTECH 14:376-387]; analogues such as peptide nucleic acids
may also be used [eg. see Corey (1997) TIBTECH 15:224-229; Buchardt
et al. (1993) TIBTECH 11:384-386].
[0257] Alternatively, the polymerase chain reaction (PCR) is
another well-known means for detecting small amounts of target
nucleic acid. The assay is described in Mullis et al. [Meth.
Enzymol. (1987) 155:335-350] & U.S. Pat. Nos. 4,683,195 &
4,683,202. Two "primer" nucleotides hybridize with the target
nucleic acids and are used to prime the reaction. The primers can
comprise sequence that does not hybridize to the sequence of the
amplification target (or its complement) to aid with duplex
stability or, for example, to incorporate a convenient restriction
site. Typically, such sequence will flank the desired streptococcus
sequence.
[0258] A thermostable polymerase creates copies of target nucleic
acids from the primers using the original target nucleic acids as a
template. After a threshold amount of target nucleic acids are
generated by the polymerase, they can be detected by more
traditional methods, such as Southern blots. When using the
Southern blot method, the labelled probe will hybridize to the
streptococcus sequence (or its complement).
[0259] Also, mRNA or cDNA can be detected by traditional blotting
techniques described in Sambrook et al [supra]. mRNA, or cDNA
generated from mRNA using a polymerase enzyme, can be purified and
separated using gel electrophoresis. The nucleic acids on the gel
are then blotted onto a solid support, such as nitrocellulose. The
solid support is exposed to a labelled probe and then washed to
remove any unhybridized probe. Next, the duplexes containing the
labeled probe are detected. Typically, the probe is labelled with a
radioactive moiety.
EXAMPLES
[0260] The following examples describe nucleic acid sequences which
have been identified in Streptococcus, along with their inferred
translation products. The examples are generally in the following
format: [0261] a nucleotide sequence which has been identified in
Streptococcus [0262] the inferred translation product of this
sequence [0263] a computer analysis (e.g. PSORT output) of the
translation product, indicating antigenicity
[0264] Most examples describe nucleotide sequences from
S.agalactiae. The specific strain which was sequenced was from
serotype V, and is a clinical strain isolated in Italy which
expresses the R antigen (ISS/Rome/Italy collection, strain.2603
V/R). For several of these examples, the corresponding sequences
from S.pyogenes are also given. Where GBS and GAS show homology in
this way, there is conservation between species which suggests an
essential function and also gives good cross-species
reactivity.
[0265] In contrast, several examples describe nucleotide sequences
from GAS for which no homolog in GBS has been identified. This lack
of homology gives molecules which are useful for distinguishing GAS
from GBS and for making GAS-specific products. The same is true for
GBS sequences which lack GAS homologs e.g these are useful for
making GBS-specific products.
[0266] The examples typically include details of homology to
sequences in the public databases. Proteins that are similar in
sequence are generally similar in both structure and function, and
the homology often indicates a common evolutionary origin.
Comparison with sequences of proteins of known function is widely
used as a guide for the assignment of putative protein function to
a new sequence and has proved particularly useful in whole-genome
analyses.
[0267] Various tests can be used to assess the in vivo
immunogenicity of the proteins identified in the examples. For
example, the proteins can be expressed recombinantly and used to
screen patient sera by immunoblot. A positive reaction between the
protein and patient serum indicates that the patient has previously
mounted an immune response to the protein in question i.e. the
protein is an immunogen. This method can also be used to identify
immunodominant proteins. The mouse model used in the examples can
also be used.
[0268] The recombinant protein can also be conveniently used to
prepare antibodies e.g. in a mouse. These can be used for direct
confirmation that a protein is located on the cell-surface.
Labelled antibody (e.g. fluorescent labelling for FACS) can be
incubated with intact bacteria and the presence of label on the
bacterial surface confirms the location of the protein.
[0269] For many GBS proteins, the following data are given: [0270]
SDS-PAGE analysis of total recombinant E.coli cell extracts for GBS
protein expression [0271] SDS-PAGE analysis after the protein
purification [0272] Western-blot analysis of GBS total cell extract
using antisera raised against recombinant proteins [0273] FACS and
ELISA analysis against GBS using antisera raise against recombinant
proteins [0274] Results of the in vivo passive protection assay
[0275] Details of experimental techniques used are presented
below:
[0276] Sequence Analysis
[0277] Open reading frames (ORFs) within nucleotide sequences were
predicted using the GLIMMER program [Salzberg et al. (1998) Nucleic
Acids Res 26:544-8]. Where necessary, start codons were modified
and corrected manually on the basis of the presence of
ribosome-binding sites and promoter regions on the upstream DNA
sequence.
[0278] ORFs were then screened against the non-redundant protein
databases using the programs BLASTp [Altschul et al. (1990) J. Mol.
Biol. 215:403-410] and PRAZE, a modification of the Smith-Waterman
algorithm [Smith & Waterman (1981) J Mol Biol 147:195-7; see
Fleischmann et al (1995) Science 269:496-512].
[0279] Leader peptides within the ORFs were located using three
different approaches: (i) PSORT [Nakai (1991) Bull. Inst. Chem.
Res., Kyoto Univ. 69:269-291; Horton & Nakai (1996) Intellig.
Syst. Mol. Biol. 4:109-115; Horton & Nakai (1997) Intellig.
Syst. Mol. Biol. 5:147-152]; (ii) SignalP [Nielsen & Krogh
(1998) in Proceedings of the Sixth International Conference on
Intelligent Systems for Molecular Biology (ISMB 6), AAAI Press,
Menlo Park, Calif., pp. 122-130; Nielsen et al. (1999) Protein
Engineering 12:3-9; Nielsen et al. (1997). Int. J. Neural Sys.
8:581-599]; and (iii) visual inspection of the ORF sequences. Where
a signal sequences is given a "possible site" value, the value
represents the C-terminus residue of the signal peptide e.g. a
"possible site" of 26 means that the signal sequence consists of
amino acids 1-26.
[0280] Lipoprotein-specific signal peptides were located using
three different approaches: (i) PSORT [see above]; (ii) the
"prokaryotic membrane lipoprotein lipid attachment site" PROSITE
motif [Hofmann et al. (1999) Nucleic Acids Res. 27:215-219; Bucher
& Bairoch (1994) in Proceedings 2nd International Conference on
Intelligent Systems for Molecular Biology (ISMB-94), AAAI Press,
pages 53-61]; and (iii) the FINDPATTERNS program available in the
GCG Wisconsin Package, using the pattern (M, L, V)x{9,
35}LxxCx.
[0281] Transmembrane domains were located using two approaches: (i)
PSORT [see above]; (ii) TopPred [von Heijne (1992) J. Mol. Biol.
225:487-494].
[0282] LPXTG motifs, characteristic of cell-wall attached proteins
in Gram-positive bacteria [Fischetti et al. (1990) Mol Microbiol
4:1603-5] were located with FINDPATTERNS using the pattern (L, I,
V, M, Y, F)Px(T, A, S, G) (G, N, S, T, A, L).
[0283] RGD motifs, characteristic of cell-adhesion molecules
[D'Souza et al. (1991) Trends Biochem Sci 16:246-50] were located
using FINDPATTERNS.
[0284] Enzymes belonging to the glycolytic pathway were also
selected as antigens, because these have been found experimentally
expressed on the surface of Streptococci [e.g. Pancholi &
Fischetti (1992) J Exp Med 176:415-26; Pancholi & Fischetti
(1998) J Biol Chem 273:14503-15].
[0285] Cloning, Expression and Purification of Proteins
[0286] GBS genes were cloned to facilitate expression in E.coli as
two different types of fusion proteins: [0287] a) proteins having a
hexa-histidine tag at the amino-terminus (His-gbs) [0288] b)
proteins having a GST fusion partner at the amino-terninus
(Gst-gbs)
[0289] Cloning was performed using the Gateway.TM. technology (Life
Technologies), which is based on the site-specific recombination
reactions that mediate integration and excision of phage lambda
into and from the E.coli genome. A single cloning experiment
included the following steps: [0290] 1--Amplification of GBS
chromosomal DNA to obtain a PCR product coding for a single ORF
flanked by attB recombination sites. [0291] 2--Insertion of the PCR
product into a pDONR vector (containing attP sites) through a BP
reaction (attB.times.attP sites). This reaction gives a so called
`pEntry` vector, which now contains attL sites flanking the insert.
[0292] 3--Insertion of the GBS gene into E.coli expression vectors
(pDestination vectors, containing attR sites) through a LR reaction
between pEntry and pDestination plasmids (attL.times.attR
sites).
[0293] A) Chromosomal DNA Preparation
[0294] For chromosomal DNA preparation, GBS strain 2603 V/R
(Istituto Superiore Sanita, Rome) was grown to exponential phase in
2 litres TH Broth (Difco) at 37.degree. C., harvested by
centrifugation, and dissolved in 40 ml TES (50 mM Tris pH 8, 5 mM
EDTA pH 8, 20% sucrose). After addition of 2.5 ml lysozyme solution
(25 mg/ml in TES) and 0.5 ml mutanolysin (Sigma M-9901, 25000U/ml
in H.sub.2O), the suspension was incubated at 37.degree. C. for 1
hour. 1 ml RNase (20 mg/ml) and 0.1 ml proteinase K (20 mg/ml) were
added and incubation was continued for 30 min. at 37.degree. C.
[0295] Cell lysis was obtained by adding 5 ml sarkosyl solution
(10% N-laurylsarcosine in 250 mM EDTA pH 8.0), and incubating 1
hour at 37.degree. C. with frequent inversion. After sequential
extraction with phenol, phenol-chloroform and chloroform, DNA was
precipitated with 0.3M sodium acetate pH 5.2 and 2 volumes of
absolute ethanol. The DNA pellet was rinsed with 70% ethanol and
dissolved in TE buffer (10 mM Tris-HCl, 1 mM EDTA, pH 8). DNA
concentration was evaluated by OD.sub.260.
[0296] B) Oligonucleotide Design
[0297] Synthetic oligonucleotide primers were designed on the basis
of the coding sequence of each ORF. The aim was to express the
protein's extracellular region. Accordingly, predicted signal
peptides were omitted (by deducing the 5' end amplification primer
sequence immediately downstream from the predicted leader sequence)
and C-terminal cell-wall anchoring regions were removed (e.g. LPXTG
motifs and downstream amino acids). Where additional nucleotides
have been deleted, this is indicated by the suffix `d` (e.g.
`GBS352d`). Conversely, a suffix `L` refers to expression without
these deletions. Deletions of C- or N-terminal residues were also
sometimes made, as indicated by a `C` or `N` suffix.
[0298] The amino acid sequences of the expressed GBS proteins
(including `d` and `L` forms etc.) are definitively defined by the
sequences of the oligonucleotide primers.
[0299] 5' tails of forward primers and 3' tails of reverse primers
included attB1 and attB2 sites respectively:
[0300] Forward primers: 5'-GGGGACAAGTTTGTACAAAAAAGCAGGCTCT-ORF in
frame-3' (nucleotides 1-31 of SEQ ID NO: 11027; the TCT sequence
preceding the ORF was omitted when the ORF's first coding triplet
began with T).
[0301] Reverse primers: 5'-GGGGACCACTTTGTACAAGAAAGCTGGGTT-ORF
reverse complement-3' (nucleotides 1-30 of SEQ ID NO: 11552).
[0302] The primers for GAS16 are thus: TABLE-US-00001 Fwd:
GGGGACAAGTTTGTACAAAAAAGCAGGCXXXXX (SEQ ID NO:_) Rev:
GGGGACCACTTTGTACAAGAAAGCTGGGTTXXX (SEQ ID NO:_)
[0303] The number of nucleotides which hybridized to the sequence
to be amplified depended on the melting temperature of the primers,
which was determined as described by Breslauer et al. [PNAS USA
(1986) 83:3746-50]. The average melting temperature of the selected
oligos was 50-55.degree. C. for the hybridizing region and
80-85.degree. C. for the whole oligos.
[0304] C) Amplification
[0305] The standard PCR protocol was as follows: 50 ng genomic DNA
were used as template in the presence of 0.5 .mu.M each primer, 200
.mu.M each dNTP, 1.5 mM MgCl.sub.2, 1.times. buffer minus Mg.sup.++
(Gibco-BRL) and 2 units of Taq DNA polymerase (Platinum Taq,
Gibco-BRL) in a final volume of 100 .mu.l. Each sample underwent a
double-step of amplification: 5 cycles performed using as the
hybridizing temperature 50.degree. C., followed by 25 cycles at
68.degree. C.
[0306] The standard cycles were as follows: [0307] Denaturation:
94.degree. C., 2 min [0308] 5 cycles: Denaturation: 94.degree. C.,
30 seconds [0309] Hybridization: 50.degree. C., 50 seconds [0310]
Elongation: 72.degree. C., 1 min. or 2 min. and 40 sec. [0311] 25
cycles: Denaturation: 94.degree. C., 30 seconds [0312]
Hybridization: 68.degree. C., 50 seconds [0313] Elongation:
72.degree. C., 1 min. or 2 min. and 40 sec.
[0314] Elongation time was 1 minute for ORFs shorter than 2000bp
and 2:40 minutes for ORFs longer than 2000bp. Amplifications were
performed using a Gene Amp PCR system 9600 (Perkin Elmer).
[0315] To check amplification results, 2 .mu.l of each PCR product
were loaded onto 1-1.5 agarose gel and the size of amplified
fragments was compared with DNA molecular weight standards (DNA
marker IX Roche, 1 kb DNA ladder Biolabs).
[0316] Single band PCR products were purified by PEG precipitation:
300 .mu.l of TE buffer and 200 .mu.l of 30% PEG 8000/30 mM
MgCl.sub.2 were added to 100 .mu.l PCR reaction. After vortexing,
the DNA was centrifuged for 20 min at 10000 g, washed with 1 vol.
70% ethanol and the pellet dissolved in 30 .mu.l TE. PCR products
smaller than 350 bp were purified using a PCR purification Kit
(Qiagen) and eluted with 30 .mu.l of the provided elution
buffer.
[0317] In order to evaluate the yield, 2.mu.l of the purified DNA
were subjected to agarose gel electrophoresis and compared to
titrated molecular weight standards.
[0318] D) Cloning of PCR Products into Expression Vectors
[0319] Cloning was performed following the GATEWAY.TM. technology's
"one-tube protocol", which consists of a two step reaction (BP and
LR) for direct insertion of PCR products into expression
vectors.
[0320] BP reaction (attB.times.attP sites): The reaction allowed
insertion of the PCR product into a pDONR vector. The pDONR.TM. 201
vector we used contains the killer toxin gene ccdB between attP1
and attP2 sites to minimize background colonies lacking the PCR
insert, and a selectable marker gene for kanamycin resistance. The
reaction resulted in a so called pEntry vector, in which the GBS
gene was located between attL1 and attL2 sites.
[0321] 60 fmol of PCR product and 100 ng of pDONR.TM. 201 vector
were incubated with 2.5 .mu.l of BP CLONASE.TM. in a final volume
of 12.5 .mu.l for 4 hours at 25.degree. C.
[0322] LR reaction (attL.times.attR sites): The reaction allowed
the insertion of the GBS gene, now present in the pEntry vector,
into E.coli expression vectors (pDestination vectors, containing
attR sites). Two pDestination vectors were used (pDEST15 for N-
terminal GST fusions--FIG. 86; and pDEST17-1 for N-terminal
His-tagged fusions--FIG. 87). Both allow transcription of the ORF
fusion coding mRNA under T7 RNA polymerase promoter [Studier et al
(1990) Meth. Enzymol 185: 60ff].
[0323] To 5 .mu.l of BP reaction were added 0.25 .mu.l of 0.75 M
NaCl, 100 ng of destination vector and 1.5 .mu.l of LR CLONASE.TM..
The reaction was incubated at 25.degree. C. for 2 hours and stopped
with 1 .mu.l of 1 mg/ml proteinase K solution at 37.degree. C. for
15 min.
[0324] 1 .mu.l of the completed reaction was used to transform 50
.mu.l electrocompetent BL21-SI.TM. cells (0.1 cm, 200 ohms, 25
.mu.F). BL21-SI cells contain an integrated T7 RNA polymerase gene
under the control of the salt-inducible prU promoter [Gowrishankar
(1985) J. Bacteriol. 164:434ff]. After electroporation cells were
diluted in 1 ml SOC medium (20 g/l bacto-tryptone, 5 g/l yeast
extract, 0.58 g/l NaCl, 0.186 g/l KCl, 20 mM glucose, 10 mM
MgCl.sub.2) and incubated at 37.degree. C. for 1 hour. 200 .mu.l
cells were plated onto LBON plates (Luria Broth medium without
NaCl) containing 100 .mu.g/ml ampicillin. Plates were then
incubated for 16 hours at 37.degree. C.
[0325] Entry clones: In order to allow the future preparation of
Gateway compatible pEntry plasmids containing genes which might
turn out of interest after immunological assays, 2.5 .mu.l of BP
reaction were incubated for 15 min in the presence of 3 .mu.l 0.15
mg/ml proteinase K solution and then kept at -20.degree. C. The
reaction was in this way available to transform E.coli competent
cells so as to produce Entry clones for future introduction of the
genes in other Destination vectors.
[0326] E) Protein Expression
[0327] Single colonies derived from the transformation of LR
reactions were inoculated as small-scale cultures in 3 ml LBON 100
.mu.g/ml ampicillin for overnight growth at 25.degree. C. 50-200
.mu.l of the culture was inoculated in 3 ml LBON/Amp to an initial
OD600 of 0.1. The cultures were grown at 37.degree. C. until OD600
0.4-0.6 and recombinant protein expression was induced by adding
NaCl to a final concentration of 0.3 M. After 2 hour incubation the
final OD was checked and the cultures were cooled on ice. 0.5
OD.sub.600 of cells were harvested by centrifugation. The cell
pellet was suspended in 50 .mu.l of protein Loading Sample Buffer
(50 mM TRIS-HCI pH 6.8, 0.5% w/v SDS, 2.5% v/v glycerin, 0.05% w/v
Bromophenol Blue, 100 mM DTT) and incubated at 100 .degree. C. for
5 min. 10 .mu.l of sample was analyzed by SDS-PAGE and Coomassie
Blue staining to verify the presence of induced protein band.
[0328] F) Purification of the Recombinant Proteins
[0329] Single colonies were inoculated in 25 ml LBON 100 .mu.g/ml
ampicillin and grown at 25.degree. C. overnight. The overnight
culture was inoculated in 500 ml LBON/amp and grown under shaking
at 25 .degree. C. until OD.sub.600 values of 0.4-0.6. Protein
expression was then induced by adding NaCl to a final concentration
of 0.3 M. After 3 hours incubation at 25 .degree. C the final
OD.sub.600 was checked and the cultures were cooled on ice. After
centrifugation at 6000 rpm (JA10 rotor, Beckman) for 20 min., the
cell pellet was processed for purification or frozen at -20
.degree. C.
[0330] Proteins were purified in 1 of 3 ways depending on the
fusion partner and the protein's solubility:
[0331] Purification of Soluble His-tagged Proteins from E. coli
[0332] 1. Transfer pellets from -20.degree. C. to ice bath and
reconstitute each pellet with 10 ml B-PER.TM. solution
(Bacterial-Protein Extraction Reagent, Pierce cat. 78266), 10 .mu.l
of a 100 mM MgCl.sub.2 solution, 50 .mu.l of DNAse I (Sigma D-4263,
100 Kunits in PBS) and 100 .mu.l of 100 mg/ml lysozyme in PBS
(Sigma L-7651, final concentration 1 mg/ml). [0333] 2. Transfer
resuspended pellets in 50 ml centrifuge tubes and leave at room
temperature for 30-40 minutes, vortexing 3-4 times. [0334] 3.
Centrifuge 15-20 minutes at about 30-40000.times.g. [0335] 4.
Prepare Poly-Prep (Bio-Rad) columns containing 1 ml of Fast Flow
Ni-activated Chelating Sepharose (Pharmacia). Equilibrate with 50
mM phosphate buffer, 300 mM NaCl, pH 8.0. [0336] 5. Store the
pellet at -20.degree. C., and load the supernatant on to the
columns. [0337] 6. Discard the flow through. [0338] 7. Wash with 10
ml 20 mM imidazole buffer, 50 mM phosphate, 300 mM NaCl, pH 8.0.
[0339] 8. Elute the proteins bound to the columns with 4.5 ml (1.5
ml+1.5 ml+1.5 ml) 250 mM imidazole buffer, 50 mM phosphate, 300 mM
NaCl, pH 8.0 and collect three fractions of .about.1.5 ml each. Add
to each tube 15 .mu.l DTT 200 mM (fmal concentration 2 mM). [0340]
9. Measure the protein concentration of the collected fractions
with the Bradford method and analyse the proteins by SDS-PAGE.
[0341] 10. Store the collected fractions at +4.degree. C. while
waiting for the results of the SDS-PAGE analysis. [0342] 11. For
immunisation prepare 4-5 aliquots of 20-100 .mu.g each in 0.5 ml in
40% glycerol. The dilution buffer is the above elution buffer, plus
2 mM DTT. Store the aliquots at -20.degree. C. until
immunisation.
[0343] Purification of His-tagged Proteins from Inclusion Bodies
[0344] 1. Bacteria are collected from 500 ml cultures by
centrifugation. If required store bacterial pellets at -20.degree.
C. Transfer the pellets from -20.degree. C. to room temperature and
reconstitute each pellet with 10 ml B-PERT.TM. solution, 10 .mu.l
of a 100 mM MgCl.sub.2 solution (final 1 mM), 50 .mu.l of DNAse I
equivalent to 100 Kunits units in PBS and 100 .mu.l of a 100 mg/ml
lysozyme (Sigma L-7651) solution in PBS (equivalent to 10 mg, final
concentration 1 mg/ml). [0345] 2. Transfer the resuspended pellets
in 50 ml centrifuge tubes and let at room temperature for 30-40
minutes, vortexing 3-4 times. [0346] 3. Centrifuge 15 minutes at
30-4000.times.g and collect the pellets. [0347] 4. Dissolve the
pellets with 50 mM TRIS-HCl, 1 mM TCEP
{Tris(2-carboxyethyl)-phosphine hydrochloride, Pierce} , 6M
guanidine hydrochloride, pH 8.5. Stir for .about.10 min. with a
magnetic bar. [0348] 5. Centrifuge as described above, and collect
the supernatant. [0349] 6. Prepare Poly-Prep (Bio-Rad) columns
containing 1 ml of Fast Flow Ni-activated Chelating Sepharose
(Pharmacia). Wash the columns twice with 5 ml of H.sub.2O and
equilibrate with 50 mM TRIS-HCl, 1 mM TCEP, 6M guanidine
hydrochloride, pH 8.5. [0350] 7. Load the supernatants from step 5
onto the columns, and wash with 5 ml of 50 mM TRIS-HCl buffer, 1 mM
TCEP, 6M urea, pH 8.5 [0351] 8. Wash the columns with 10 ml of 20
mM imidazole, 50 mM TRIS-HCl , 6M urea, 1 mM TCEP, pH 8.5. Collect
and set aside the first 5 ml for possible further controls. [0352]
9. Elute proteins bound to columns with 4.5 ml buffer containing
250 mM imidazole, 50 mM TRIS-HCl, 6M urea, 1 mM TCEP, pH 8.5. Add
the elution buffer in three 1.5 ml aliquots, and collect the
corresponding three fractions. Add to each fraction 15 .mu.l DTT
(final concentration 2 mM). [0353] 10. Measure eluted protein
concentration with Bradford method and analyse proteins by
SDS-PAGE. [0354] 11. Dialyse overnight the selected fraction
against 50 mM Na phosphate buffer, pH 8.8, containing 10% glycerol,
0.5 M arginine, 5 mM reduced glutathione, 0.5 mM oxidized
glutathione, 2 M urea. [0355] 12. Dialyse against 50 mM Na
phosphate buffer, pH 8.8, containing 10% glycerol, 0.5 M arginine,
5 mM reduced glutathione, 0.5 mM oxidized glutathione. [0356] 13.
Clarify the dialysed protein preparation by centrifugation and
discard the non-soluble material and measure the protein
concentration with the Bradford method. [0357] 14. For each protein
destined to the immunization prepare 4-5 aliquot of 20-100 .mu.g
each in 0.5 ml after having adjusted the glycerol content up to
40%. Store the prepared aliquots at -20.degree. C. until
immunization.
[0358] Purification of GST-fusion Proteins from E.coli [0359] 1.
Bacteria are collected from 500 ml cultures by centrifugation. If
required store bacterial pellets at -20.degree. C. Transfer the
pellets from -20.degree. C. to room temperature and reconstitute
each pellet with 10 ml B-PER.TM. solution, 10 .mu.l of a 100 mM
MgCl.sub.2 solution (final 1 mM), 50 .mu.l of DNAse I equivalent to
100 Kunits units in PBS and 100 .mu.l of a 100 mg/ml lysozyme
(Sigma L-7651) solution in PBS (equivalent to 10 mg, final
concentration 1 mg/ml). [0360] 2. Transfer the resuspended pellets
in 50 ml centrifuge tubes and let at room temperature for 30-40
minutes, vortexing 3-4 times. [0361] 3. Centrifuge 15-20 minutes at
about 30-40000.times.g. [0362] 4. Discard centrifigation pellets
and load supernatants onto the chromatography columns, as follows.
[0363] 5. Prepare Poly-Prep (Bio-Rad) columns containing 0.5 ml of
Glutathione-Sepharose 4B resin. Wash the columns twice with 1 ml of
H.sub.2O and equilibrate with 10 ml PBS, pH7.4. [0364] 6. Load
supernatants on to the columns and discard the flow through. [0365]
7. Wash the columns with 10 ml PBS, pH 7.4. [0366] 8. Elute
proteins bound to columns with 4.5 ml of 50 mM TRIS buffer, 10 mM
reduced glutathione, pH 8.0, adding 1.5 ml+1.5 ml+1.5 ml and
collecting the respective 3 fractions of .about.1.5 ml each. [0367]
9. Measure protein concentration of the fractions with the Bradford
method and analyse the proteins by SDS-PAGE. [0368] 10. Store the
collected fractions at +4.degree. C. while waiting for the results
of the SDS-PAGE analysis. [0369] 11. For each protein destined for
immunisation prepare 4-5 aliquots of 20-100 .mu.g each in 0.5 ml of
40% glycerol. The dilution buffer is 50 mM TRIS-HCl, 2 mM DTT, pH
8.0. Store the aliquots at -20.degree. C. until immunisation.
[0370] Immunisations with GBS Proteins
[0371] The purified proteins were used to immunise groups of four
CD-1 mice intraperitoneally. 20 .mu.g of each purified protein was
injected in Freund's adjuvant at days 1, 21 & 35. Immune
responses were monitored by using samples taken on day 0 & 49.
Sera were analysed as pools of sera from each group of mice.
[0372] FACScan Bacteria Binding Assay Procedure.
[0373] GBS serotype V 2603 V/R strain was plated on TSA blood agar
plates and incubated overnight at 37.degree. C. Bacterial colonies
were collected from the plates using a sterile dracon swab and
inoculated into 100 ml Todd Hewitt Broth. Bacterial growth was
monitored every 30 minutes by following OD.sub.600. Bacteria were
grown until OD.sub.600=0.7-0.8. The culture was centrifuged for 20
minutes at 5000 rpm. The supernatant was discarded and bacteria
were washed once with PBS, resuspended in 1/2 culture volume of PBS
containing 0.05% paraformaldehyde, and incubated for 1 hour at
37.degree. C. and then overnight at 4.degree. C.
[0374] 50 .mu.l bacterial cells (OD.sub.600 0.1) were washed once
with PBS and resuspended in 20 .mu.l blocking serum (Newborn Calf
Serum, Sigma) and incubated for 20 minutes at room temperature. The
cells were then incubated with 100 .mu.l diluted sera (1:200) in
dilution buffer (20% Newborn Calf Serum 0.1% BSA in PBS) for 1 hour
at 4.degree. C. Cells were centrifuged at 5000 rpm, the supernatant
aspirated and cells washed by adding 200 .mu.l washing buffer (0.1%
BSA in PBS). 50 .mu.l R-Phicoerytrin conjugated F(ab).sub.2 goat
anti-mouse, diluted 1:100 in dilution buffer, was added to each
sample and incubated for 1 hour at 4.degree. C. Cells were spun
down by centrifugation at 5000 rpm and washed by adding 200 .mu.l
of washing buffer. The supernatant was aspirated and cells
resuspended in 200 .mu.l PBS. Samples were transferred to FACScan
tubes and read. The condition for FACScan setting were: FL2 on;
FSC-H threshold:54; FSC PMT Voltage: E 02; SSC PMT: 516; Amp. Gains
2.63; FL-2 PMT: 728. Compensation values: 0.
[0375] Samples were considered as positive if they had a .DELTA.
mean values >50 channel values.
[0376] Whole Extracts Preparation
[0377] GBS serotype III COHI strain and serotype V 2603 V/R strain
cells were grown overnight in Todd Hewitt Broth. 1 ml of the
culture was inoculated into 100 ml Todd Hewitt Broth. Bacterial
growth was monitored every 30 minutes by following OD.sub.600. The
bacteria were grown until the OD reached 0.7-0.8. The culture was
centrifuged for 20 minutes at 5000 rpm. The supernatant was
discarded and bacteria were washed once with PBS, resuspended in 2
ml 50 mM Tris-HCl, pH 6.8 adding 400 units of Mutanolysin
(Sigma-Aldrich) and incubated 3 hrs at 37.degree. C. After 3 cycles
of freeze/thaw, cellular debris were removed by centrifugation at
14000 g for 15 minutes and the protein concentration of the
supernatant was measured by the Bio-Rad Protein assay, using BSA as
a standard.
[0378] Western Blotting
[0379] Purified proteins (50 ng) and total cell extracts (25 .mu.g)
derived from GBS serotype III COH1 strain and serotype V 2603 V/R
strain were loaded on 12% or 15% SDS-PAGE and transferred to a
nitrocellulose membrane. The transfer was performed for 1 hours at
100 V at 4.degree. C., in transferring buffer (25 mM Tris base, 192
mM glycine, 20% methanol). The membrane was saturated by overnight
incubation at 4.degree. C. in saturation buffer (5 % skimmed milk,
0.1% Tween 20 in PBS). The membrane was incubated for 1 hour at
room temperature with 1:1000 mouse sera diluted in saturation
buffer. The membrane was washed twice with washing buffer (3 %
skimmed milk, 0.1% Tween 20 in PBS) and incubated for 1 hour with a
1:5000 dilution of horseradish peroxidase labelled anti-mouse Ig
(Bio-Rad). The membrane was washed twice with 0.1% Tween 20 in PBS
and developed with the Opti-4CN Substrate Kit (Bio-Rad). The
reaction was stopped by adding water.
[0380] Unless otherwise indicated, lanes 1, 2 and 3 of blots in the
drawings are: (1) the purified protein; (2) GBS-III extracts; and
(3) GBS-V extracts. Molecular weight markers are also shown.
[0381] In vivo Passive Protection Assay in Neonatal Sepsis Mouse
Model.
[0382] The immune sera collected from the CD1 immunized mice were
tested in a mouse neonatal sepsis model to verify their protective
efficacy in mice challenged with GBS serotype III. Newborn Balb/C
littermates were randomly divided in two groups within 24 hrs from
birth and injected subcutaneously with 25.mu.l of diluted sera
(1:15) from immunized CD1 adult mice. One group received preimmune
sera, the other received immune sera. Four hours later all pups
were challenged with a 75% lethal dose of the GBS serotype III COH1
strain. The challenge dose obtained diluting a mid log phase
culture was administered subcutaneously in 25 .mu.l of saline. The
number of pups surviving GBS infection was assessed every 12 hours
for 4 days.
[0383] Identification of GAS16
Example 1
[0384] A DNA sequence (GASx127) was identified in S.pyogenes
<SEQ ID 7275>which encodes the amino acid sequence <SEQ ID
7276>. Analysis of this protein sequence reveals the following:
TABLE-US-00002 Possible site: 17 >>> Seems to have a
cleavable N-term signal seq. INTEGRAL Likelihood = -3.93
Transmembrane 312-328 (311-337) ----- Final Results ----- bacterial
membrane --- Certainty = 0.2572 (Affirmative) < succ>
bacterial outside --- Certainty = 0.0000 (Not Clear) < succ>
bacterial cytoplasm --- Certainty = 0.0000 (Not Clear) <
succ>
No corresponding DNA sequence was identified in S.agalactiae.
[0385] The protein has homology with the following sequences in the
GENPEPT database: TABLE-US-00003 >GP:AAC97152 GB:U49397 unknown
[Streptococcus pyogenes] Identities = 125/355 (35%), Positives =
191/355 (53%), Gaps = 26/355 (7%) Query: 1
MKLRHLLLTGAALTSFA-----ATTVHGET--VVNGAKLTVTKNL-DLVNSNALIPNTDF 52 MK
LLL A L + + + ET V++G+ L V K + N L+P D+ Sbjct: 1
MKKNKLLLATAILATALGMASMSQNIKAETAGVIDGSTLVVKKTFPSYTDDNVLMPKADY 60
Query: 53
TFKIEPDTTVN---EDGNKFK-GVALNTPMTK-VTYTNSDKGGSNTKTAEFDFSEVTFEK 107
+FK+E D +DG K GV TK + Y+NSDK + K+ F+F+ V F Sbjct: 61
SFKVEADDNAKGKTKDGLDIKPGVIDGLENTKTIRYSNSDKITAKEKSVNFEFANVKFPG 120
Query: 108
PGVYYYKVTEEKIDKVPGVSYDTTSYTVQVHVLWNEEQQKPVATYIVGYKEGS--KVPIQ 165
GVY Y V E +K G++YD+ +TV V+V+ N+E YIV + G K P+ Sbjct: 121
VGVYRYTVAEVNGNKA-GITYDSQQWTVDVYVV-NKEGGGFEVKYIVSTEVGQSEKKPVL 178
Query: 166
FKNSLDSTTLTVKKKVSGTGGDRSKDFNFGLTLKANQYYKASEKVMIEKTTKGGQAPVQT 225
FKNS D+T+L ++K+V+G G+ + F+F L L N+ + EK + +GG+ Sbjct: 179
FKNSFDTTSLKIEKQVTGNTGEHQRLFSFTLLLTPNECF---EKGQVVNILQGGETK--- 232
Query: 226
EASIDQLYHFTLKDGESIKVTNLPVGVDYVVTEDDYKSEKYTTNVEVSPQDGAVKNIAGN 285 +
I + Y FTLKD S+ ++ LPVG++Y +TE+D + Y T+ + + + G Sbjct: 233
KVVIGEEYSFTLKDKGSVTLSQLPVGIEYKLTEEDVTKDGYKTSATLKDGEQSSTYELGK 292
Query: 286 STEQETSTDKDMTITFTNKKDFEVPTGVAMTVAPYIALGIVAVGGALYFVKKKNA
340 + + S D+ I TNK+D +VPTGV T+AP+ L IVA+GG +Y K+K A Sbjct: 293
DHKTDKSADE---IVVTNKRDTQVPTGVVGTLAPFAVLSIVAIGGVIYITKRKKA 344
Based on this analysis, it was predicted that this GAS-specific
protein and its epitopes, could be useful antigens for vaccines or
diagnostics.
Sequence CWU 0 SQTB SEQUENCE LISTING The patent application
contains a lengthy "Sequence Listing" section. A copy of the
"Sequence Listing" is available in electronic form from the USPTO
web site
(http://seqdata.uspto.gov/?pageRequest=docDetail&DocID=US20060210579A1).
An electronic copy of the "Sequence Listing" will also be available
from the USPTO upon request and payment of the fee set forth in 37
CFR 1.19(b)(3).
0 SQTB SEQUENCE LISTING The patent application contains a lengthy
"Sequence Listing" section. A copy of the "Sequence Listing" is
available in electronic form from the USPTO web site
(http://seqdata.uspto.gov/?pageRequest=docDetail&DocID=US20060210579A1).
An electronic copy of the "Sequence Listing" will also be available
from the USPTO upon request and payment of the fee set forth in 37
CFR 1.19(b)(3).
* * * * *
References