U.S. patent application number 10/671412 was filed with the patent office on 2005-05-12 for nucleic acid encoding bacillus stearothermophilus polc polymerase subunit.
Invention is credited to Bruck, Irina, Jeruzalmi, David, Kuriyan, John, O'Donnell, Michael E., Yurieva, Olga, Yuzhakov, Alexander.
Application Number | 20050100920 10/671412 |
Document ID | / |
Family ID | 34595732 |
Filed Date | 2005-05-12 |
United States Patent
Application |
20050100920 |
Kind Code |
A1 |
O'Donnell, Michael E. ; et
al. |
May 12, 2005 |
Nucleic acid encoding Bacillus stearothermophilus polc polymerase
subunit
Abstract
The present invention relates to an isolated DNA molecule from a
thermophilic bacterium which encodes a DNA polymerase III-type
enzyme subunit. Also encompassed by the present invention are host
cells and expression system including the heterologous DNA molecule
of the present invention, as well as isolated replication enzyme
subunits encoded by such DNA molecules. Also disclosed is a method
of producing a recombinant thermostable DNA polymerase III-type
enzyme, or subunit thereof, from a thermophilic bacterium, which is
carried out by transforming a host cell with at least one
heterologous DNA molecule of the present invention under conditions
suitable for expression of the DNA polymerase III-type enzyme, or
subunit thereof, and then isolating the DNA polymerase III-type
enzyme, or subunit thereof.
Inventors: |
O'Donnell, Michael E.;
(Hastings-on-Hudson, NY) ; Yuzhakov, Alexander;
(Malden, MA) ; Yurieva, Olga; (New York, NY)
; Jeruzalmi, David; (Cambridge, MA) ; Bruck,
Irina; (New York, NY) ; Kuriyan, John;
(Berkeley, CA) |
Correspondence
Address: |
Nixon Peabody LLP
Clinton Square
P.O. Box 31051
Rochester
NY
14603-1051
US
|
Family ID: |
34595732 |
Appl. No.: |
10/671412 |
Filed: |
September 25, 2003 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
10671412 |
Sep 25, 2003 |
|
|
|
09716964 |
Nov 21, 2000 |
|
|
|
09716964 |
Nov 21, 2000 |
|
|
|
09642218 |
Aug 18, 2000 |
|
|
|
09642218 |
Aug 18, 2000 |
|
|
|
09057416 |
Apr 8, 1998 |
|
|
|
60043202 |
Apr 8, 1997 |
|
|
|
Current U.S.
Class: |
435/6.18 ;
435/199; 435/252.31; 435/320.1; 435/69.3; 536/23.2 |
Current CPC
Class: |
C12N 9/1252 20130101;
C07H 21/04 20130101; C12Q 1/689 20130101 |
Class at
Publication: |
435/006 ;
435/069.3; 435/252.31; 435/199; 435/320.1; 536/023.2 |
International
Class: |
C12Q 001/68; C07H
021/04; C12N 009/22; C12N 015/74 |
Goverment Interests
[0002] The present invention was made with funding from National
Institutes of Health Grant No. GM38839. The United States
Government may have certain rights in this invention.
Claims
What is claimed:
1. An isolated DNA molecule from a Bacillus species encoding a PolC
subunit of a DNA polymerase III-type enzyme, the isolated DNA
molecule either: (i) comprising a nucleotide sequence of SEQ ID NO:
183; (ii) encoding an amino acid sequence of SEQ ID NO: 184; or
(iii) hybridizing to the complement of SEQ ID NO: 183 under
hybridization conditions comprising at most about 0.9M sodium
citrate buffer at a temperature of at least about 37.degree. C.
2. The isolated DNA molecule according to claim 1, wherein the
Bacillus species is Bacillus stearothermophilus.
3. The isolated DNA molecule according to claim 1, wherein the DNA
molecule encodes an amino acid sequence of SEQ ID NO: 184.
4. The isolated DNA molecule according to claim 1, wherein the DNA
molecule comprises a nucleotide sequence of SEQ ID NO: 183.
5. The isolated DNA molecule according to claim 1, wherein the DNA
molecule hybridizes to the complement of SEQ ID NO: 183 under
hybridization conditions comprising at most about 0.9M sodium
citrate buffer at a temperature of at least about 37.degree. C.
6. An expression system comprising an expression vector into which
is inserted a heterologous DNA molecule according to claim 1.
7. A host cell comprising a heterologous DNA molecule according to
claim 1.
8. A method of producing a recombinant thermostable PolC subunit of
a DNA polymerase III-type enzyme from a Bacillus species, said
method comprising: transforming a host cell with the heterologous
DNA molecule according to claim 1 under conditions suitable for
expression of the PolC subunit, and isolating the PolC subunit.
9. An isolated DNA molecule from Bacillus stearothermophilus
encoding a PoIC subunit of a DNA polymerase III enzyme, wherein the
PolC subunit can cooperate with a clamp loader to form a DNA
polymerase III-like particle.
Description
[0001] The present application is a continuation of U.S. patent
application Ser. No. 09/716,964, filed Nov. 21, 2000, which is a
continuation-in-part of U.S. patent application Ser. No.
09/642,218, filed Aug. 18, 2000, as a continuation of U.S. patent
application Ser. No. 09/057,416 filed Apr. 8, 1998, which claims
the benefit of U.S. Provisional Patent Application Ser. No.
60/043,202 filed Apr.8, 1997, all of which are hereby incorporated
by reference in their entirety.
FIELD OF THE INVENTION
[0003] The present invention relates to thermostable DNA
polymerases and, more particularly, to such polymerases as can
serve as chromosomal replicases and are derived from thermophilic
bacteria. More particularly, the invention extends to DNA
polymerase III-type enzymes from thermophilic bacteria, including
Aquifex aeolicus, Thermus thermophilus, Thermotoga maritima, and
Bacillus stearothermophilus, as well as purified, recombinant or
non-recombinant subunits thereof and their use, and to isolated DNA
coding for such polymerases and their subunits. Such DNA is
obtained from the respective genes (e.g., dnaX, holA, holB, dnaA,
dnaN, dnaQ, dnaE, ssb, etc.) of various thermophilic eubacteria,
including but not limited to Thermus thermophilus, Aquifex
aeolicus, Thermotoga maritima, and Bacillus stearothermophilus.
BACKGROUND OF THE INVENTION
[0004] Thermostable DNA polymerases have been disclosed previously
as set forth in U.S. Pat. No. 5,192,674 to Oshima et al., U.S. Pat.
Nos. 5,322,785 and 5,352,778 to Comb et al., U.S. Pat. No.
5,545,552 to Mathur, and others. All of the noted references recite
the use of polymerases as important catalytic tools in the practice
of molecular cloning techniques such as polymerase chain reaction
(PCR). Each of the references states that a drawback of the extant
polymerases are their limited thermostability, and consequent
useful life in the participation in PCR. Such limitations also
manifest themselves in the inability to obtain extended lenghts of
nucleotides, and in the instance of Taq polymerase, the lack of 3'
to 5' exonuclease activity, and the drawback of the inability to
excise misinserted nucleotides (Perino, 1990).
[0005] More generally, such polymerases, including those disclosed
in the referenced patents, are of the Polymerase I variety as they
are often 90-95 kDa in size and may have 5' to 3' exonuclease
activity. They define a single subunit with concomitant limits on
their ability to hasten the amplification process and to promote
the rapid preparation of longer strands of DNA.
[0006] Chromosomal replicases are composed of several subunits in
all organisms (Kornberg and Baker, 1992). In keeping with the need
to replicate long chromosomes, replicases are rapid and highly
processive multiprotein machines. Cellular replicases are
classically comprised of three components: a clamp, a clamp loader,
and the DNA polymerase (reviewed in Kelman and O'Donnell, 1995;
McHenry, 1991). For purposes of the present invention, the
foregoing components also serve as a broad definition of a "Pol
III-type enzyme".
[0007] DNA polymerase III holoenzyme (Pol III holoenzyme) is the
multi-subunit replicase of the E. coli chromosome. Pol III
holoenzyme is distinguished from Pol I type DNA polymerases by its
high processivity (>50 kbp) and rapid rate of synthesis (750
nts/s) (reviewed in Kornberg and Baker, 1992; Kelman and O'Donnell,
1995). The high processivity and speed is rooted in a ring shaped
subunit, called .beta., that encircles DNA and slides along it
while tethering the Pol III holoenzyme to the template (Stukenberg
et al., 1991; Kong et al., 1992). The ring shaped .beta. clamp is
assembled around DNA by the multisubunit clamp loader, called
.gamma. complex. The .gamma. complex couples the energy of ATP
hydrolysis to the assembly of the .beta. clamp onto DNA. This
.gamma. complex, which functions as a clamp loader, is an integral
component of the Pol III holoenzyme particle. A brief overview of
the organization of subunits within the holoenzyme and their
function follows.
[0008] Pol III holoenzyme consists of 10 different subunits, some
of which are present in multiple copies for a total of 18
polypeptide chains (Onrust et al., 1995). The organization of these
subunits in the holoenzyme particle is illustrated in FIG. 1. As
depicted in the diagram, the subunits of the holoenzyme can be
grouped functionally into three components: 1) the DNA polymerase
III core is the catalytic unit and consists of the .alpha. (DNA
polymerase), .epsilon.(3'-5' exonuclease), and .theta. subunits
(McHenry and Crow, 1979), 2) the .beta. "sliding clamp" is the ring
shaped protein that secures the core polymerase to DNA for
processivity (Kong et al., 1992), and 3) the 5 protein .gamma.
complex (.gamma., .delta..delta.'.chi..psi.) is the "clamp loader"
that couples ATP hydrolysis to assembly of .beta. clamps around DNA
(O'Donnell, 1987; Maki et al., 1988). A dimer of the .tau. subunit
acts as a "macromolecular organizer" holding together two molecules
of core (Studwell-Vaughan and O'Donnell, 1991; Low et al., 1976)
and one molecule of .gamma. complex forming the Pol III*
subassembly (Onrust et al., 1995). This organizing role of .tau. to
form Pol III* is indicated in the center of FIG. 1. Two .beta.
dimers associate with the two cores within Pol III* to form the
holoenzyme, which is capable of replicating both strands of duplex
DNA simultaneously (Maki et al., 1988).
[0009] The DNA polymerase III holoenzyme assembles onto a primed
template in two distinct steps. In the first step, the .gamma.
complex assembles the .beta. clamp onto the DNA. The .gamma.
complex and the core polymerase utilize the same surface of the
.beta. ring and they cannot both utilize it at the same time
(Naktinis et al., 1996). Hence, in the second step the .gamma.
complex moves away from .beta. thus allowing access of the core
polymerase to the .beta. clamp for processive DNA synthesis. The
.gamma. complex and core remain attached to each other during this
switching process by: the .tau. subunit organizers
[0010] The .gamma. complex consists of 5 different subunits
(.gamma..sub.2-4.delta..sub.1.delta.'.sub.1.chi..sub.1.psi..sub.1).
An overview of the mechanism of the clamp loading process follows.
The .delta. subunit is the major touch point to the .beta. clamp
and leads to ring opening, but .delta. is buried within .gamma.
complex such that contact with .beta. is prevented (Naktinis et
al., 1995). The .gamma. subunit is the ATP interactive protein but
is not an ATPase by itself (Tsuchihashi and Kornberg, 1989). The
.delta.' subunit bridges the .delta. and .gamma. subunits resulting
in a .gamma..delta..delta.' complex that exhibits DNA dependent
ATPase activity and is competent to assemble clamps on DNA (Onrust
et al., 1991). Upon binding of ATP to .gamma., a change in the
conformation of the complex exposes .delta. for interaction with
.beta. (Naktinis et al., 1995). The function of the smaller
subunits, .chi. and .psi., is to contact SSB (through .chi.) thus
promoting clamp assembly and high processivity during replication
(Kelman and O'Donnell, 1995).
[0011] The three component Pol III-type enzyme in eukaryotes
contains a clamp that has the same shape as E. coli .beta., but
instead of a homodimer it is a heterotrimer. This heterotrimeric
ring, called PCNA (proliferating cell nuclear antigen), has 6
domains like .beta., but instead of each PCNA monomer being
composed of 3 domains and dimerizing to form a 6 domain ring (e.g.,
like .beta.), the PCNA monomer has 2 domains and it trimerizes to
form a 6 domain ring (Krishna et al., 1994; Kuriyan and O'Donnell,
1993). The chain fold of the domains are the same in prokaryotes
(.beta.) and eukaryotes (PCNA); thus, the rings have the same
overall 6-domain ring shape. The clamp loader of the eukaryotic Pol
III-type replicase is called RFC (Replication factor C) and it
consists of subunits having homology to the .gamma. and .delta.'
subunits of the E. coli .gamma. complex (Cullmann et al., 1995).
The eukaryotic DNA polymerase III-type enzyme contains either of
two DNA polymerases, DNA polymerase .delta. and DNA polymerase
.epsilon. (Bambara and Jessee, 1991; Linn, 1991; Sugino, 1995). It
is entirely conceivable that yet other types of DNA polymerases can
function with either a PCNA or .beta. clamp to form a Pol III-type
enzyme (for example, DNA polymerase II of E. coli functions with
the .beta. subunit placed onto DNA by the .gamma. complex clamp
loader) (Hughes et al., 1991; Bonner et al., 1992). The
bacteriophage T4 also utilizes a Pol III-type 3-component
replicase. The clamp is a homotrimer like PCNA, called gene 45
protein (Young et al., 1992). The gene 45 protein forms the same
6-domain ring structure as .beta. and PCNA (Moarefi et al., 2000).
The clamp loader is a complex of two subunits called the gene 44/62
protein complex. The DNA polymerase is the gene 43 protein and it
is stimulated by the gene 45 sliding clamp when it is assembled
onto DNA by the 44/62 protein clamp loader. The Pol III-type enzyme
may be either bound together into one particle (e.g., E. coli Pol
III holoenlzyme); or its three components may function separately
(like the eukaryotic Pol III-type replicases).
[0012] There is an early report on separation of three DNA
polymerases from T.th. cells, however each polymerase form was
reminiscent of the preexisting types of DNA polymerase isolated
from thermophiles in that each polymerase was in the
110,000-120,000 range and lacked 3'-5' exonuclease activity
(Ruttimann et al., 1985). These are well below the molecular weight
of Pol III-type complexes that contain in addition to the DNA
polymerase subunit, other subunits such as .gamma. and .tau..
Although the three polymerases displayed some differences in
activity (column elution behavior, and optimum divalent cation,
template, and temperatures) it seems likely that these three forms
were either different repair type polymerases or derivatives of one
repair enzyme (e.g., Pol I) that was modified by post translational
modification(s) that altered their properties (e.g.
phosphorylation, methylation, proteolytic clipping of residues that
alter activity, or association with different ligands such as a
small protein or contaminating DNA). Despite this previous work, it
remained to be demonstrated that themiophiles harbor a Pol III-type
enzyme that contain multiple subunits such as .gamma. and/or .tau.,
functioned with a sliding clamp accessory protein, or could extend
a primer rapidly and processively over a long stretch (>5 kb) of
ssDNA (Ruttimann et al., 1985).
[0013] Previously, it was not known what polymerase thermophilic
bacteria used to replicate their chromosome since only Pol I type
enzymes have been reported from thermophiles. By distinction,
chromosomal replicases, such as Polymerase III, identified in E.
coli, if available in a thermostable bacterium, with all its
accessory subunits, could provide a great improvement over the
Polymerase I type enzymes, m that they are generally much more
efficient--about 5 times faster--and much more highly processive.
Hence, one may expect faster and longer chain production in PCR,
and higher quality of DNA sequencing ladders. Clearly, the ability
to practice such synthetic techniques as PCR would be enhanced by
these methods disclosed for how to obtain genes and subunits of DNA
polymerase III holoenzyme from thermophilic sources.
[0014] The present invention is directed to achieving these
objectives and overcoming the various deficiencies in the art.
SUMMARY OF THE INVENTION
[0015] In accordance with the present invention, DNA Polymerase
III-type enzymes as defined herein are disclosed that may be
isolated and purified from a thermophilic bacterial source, that
display rapid synthesis characteristic of a chromosomal replicase,
and that possesses all of the structural and processive advantages
sought and recited above. More particularly, the invention extends
to thermostable Polymerase III-type enzymes derived from
thermophilic bacteria that exhibit the ability to extend a primer
over a long stretch (>5 kb) of ssDNA at elevated temperature,
the ability to be stimulated by a cognate sliding clamp (e.g.,
.beta.) of the type that is assembled on DNA by a `clamp`
loader.(e.g., .gamma. complex), and have clamp loading subunits
that show DNA stimulated ATPase activity at elevated temperature
and/or ionic strength. Representative thermophile polymerases
include those isolated from the thermophilic eubacteria Aquifex
aeolicus (A.ae. polymerase) and other members of the Aquifex genus;
Thermus thermophilus (T.th. polymerase), Thermus favus (Tfl/Tub
polymerase), Thermus ruber (Tru polymerase), Thermus brockianus
(DYNAZYME.TM. polymerase), and other members of the Thermus genus;
Bacillus stearothermophilus (B.st. polymerase) and other members of
the Bacillus genus; Thermoplasma acidophilum (Tac polymerase) and
other members of the Thermoplasma genus; and Thermotoga neapolitana
(Tne polymerase; see WO 96/10640 to Chatterjee et al.), Thermotoga
maritima (Tma polymerase; see U.S. Pat. No. 5,374,553 to Gelfand et
al.), and other species of the Thermotoga genus (Tsp polymerase).
In a preferred embodiment, the thermophilic bacteria comprise
species of Aquifex, Thermus, Bacillus, and Thermotoga, and
particularly A.ae., T.th., B.st., and Tma.
[0016] A particular Polymerase III-type enzyme in accordance with
the invention may include at least one of the following
sub-units:
[0017] A. a .gamma. subunit having an amino acid sequence
corresponding to SEQ. ID. Nos. 4 or 5 (T.th.);
[0018] B. a .tau. subunit having an amino acid sequence
corresponding to SEQ. ID. No. 2 (T.th.), SEQ. ID. No. 120 (A.ae.),
SEQ. ID. No. 142 (T.ma) or SEQ. ID. No. 182 (B.st.);
[0019] C. a .epsilon. subunit having an amino acid sequence
corresponding to SEQ. ID. No. 95 (T.th.), SEQ. ID. No. 128 (A.ae.),
or SEQ. ID. No. 140 (T.ma.);
[0020] D. a .alpha. subunit including an amino acid sequence
corresponding to SEQ. ID. No. 87 (T.th.), SEQ. ID. No. 118 (A.ae.),
SEQ. ID. No. 138 (T.ma.), or SEQ. ID. Nos. 184 (PolC which has both
.alpha. and .epsilon. activity, B.st.);
[0021] E. a .beta. subunit having an amino acid sequence
corresponding to SEQ. ID. No. 107 (T.th.), SEQ. ID. No. 122
(A.ae.), SEQ. ID. No. 144 (T.ma.), or SEQ. ID. No. 174 (B.st.);
[0022] F. a .delta. subunit having an amino acid sequence
corresponding to SEQ. ID. No. 158 (T.th.), SEQ. ID. No. 124
(A.ae.), SEQ. ID. No. 146 (T.ma) or SEQ. ID. No. 178 (B.st.);.
[0023] G. a .delta.' subunit having an amino acid sequence
corresponding to SEQ. ID. No. 156 (T.th.), SEQ. ID. No. 126
(A.ae.), SEQ. ID. No. 148 (T.ma.) or SEQ. ID. No. 180 (B.st.);
[0024] variants, including allelic variants, muteins, analogs and
fragments of any of subparts (A) through (G), and compatible
combinations thereof, capable of functioning in DNA amplification
and sequencing.
[0025] The invention also extends to the genes that correspond to
and can code on expression for the subunits set forth above, and
accordingly includes the following: dnaX, holA, holB, dnaQ, dnaE,
dnaN, and ssb, as well as conserved variants and active fragments
thereof.
[0026] Accordingly, the Polymerase III-type enzyme of the present
invention comprises at least one gene encoding a subunit thereof,
which gene is selected from the group consisting of dnaX, holA,
holB, dnaQ, dnaE and dnaN, and combinations thereof. More
particularly, the invention extends to the nucleic acid molecule
encoding the .gamma. and .tau. subunits, and includes the dnaX gene
which has a nucleotide sequence as set forth herein, as well as
conserved variants, active fragments and analogs thereof. Likewise,
the nucleotide sequences encoding the .alpha. subunit (dnaE gene),
the .epsilon. subunit (dnaQ gene), the .beta. subunit (dnaN gene),
the .delta. subunit (holA gene), and the .delta.' subunit (holB
gene) each comprise the nucleotide sequences as set forth herein,
as well as conserved variants, active fragments and analogs
thereof. Those nucleotide sequences for T.th. are as follows: dnaX
(SEQ. ID. No. 3), dnaE (SEQ. ID. No. 86), dnaQ (SEQ. ID. No. 94),
dnaN (SEQ. ID. No. 106), holA (SEQ. ID. No. 157), and holB (SEQ.
ID. No. 155). Those nucleotide sequences for A.ae. are as follows:
dnaX(SEQ. ID. No. 119), dnaE (SEQ. ID. No. 117), dnaQ (SEQ. ID. No.
127), dnaN (SEQ. ID. No. 121), holA (SEQ. ID. No. 123), and holB
(SEQ. ID. No. 125). Those nucleotide sequences for T.ma. are as
follows: dnaX (SEQ. ID. No. 141), dnaE (SEQ. ID. No. 137), dnaQ
(SEQ. ID. No. 139), dnaN (SEQ. ID. No. 143), holA (SEQ. ID. No.
145), and holB (SEQ. ID. No. 147). Those nucleotide sequences for
B.st. are as follows: dnaX (SEQ. ID. No. 181), polC (SEQ. ID. Nos.
183), dnaN (SEQ. ID. No. 173), holA (SEQ. ID. No. 177), and holB
(SEQ. ID. No. 179).
[0027] The invention also provides methods and products for
identifying, isolating and cloning DNA molecules which encode such
accessory subunits encoded by the recited genes of the DNA
polymerase III-type enzyme hereof.
[0028] Yet farther, the invention extends to Polymerase III-type
enzymes prepared by the purification of an extract taken from,
e.g., the particular thermophile under examination, treated with
appropriate solvents and then subjected to chromatographic
separation on, e.g., an anion exchange column, followed by analysis
of long chain synthetic ability or Western analysis of the
respective peaks against antibody to at least one of the
anticipated enzyme subunits to confirm presence of Pol III, and
thereafter, peptide sequencing of subunits that co purify and
amplification to obtain the putative gene and its encoded
enzyme.
[0029] The present invention also relates to recombinant .gamma.,
.tau., .epsilon., .alpha. (as well as PolC), .delta.,.delta.' and
.beta. subunits and SSB from thermophiles. In the instance of the
.gamma. and .tau. subunits of T.th., the invention includes the
characterization of a frameshifting sequence that is internal to
the gene and specifies relative abundance of the .gamma. and .tau.
gene products of T.th. dnaX. From this characterization, expression
of either one of the subunits can be increased at the expense of
the other (i.e. mutant frameshift could make all .tau., simple
recloning at the end of the frameshift could make exclusively
.gamma. and
[0030] In a further aspect of the present invention, DNA probes can
be constructed from the DNA sequences coding for, e.g., the T.th.,
A.ae., T.ma., or B.st. dnaX, dnaQ, dnaE, dnaA, dnaN, holA, holB,
and ssb genes, conserved variants and active fragments thereof, all
as defined herein, and may be used to identify and isolate the
corresponding genes coding for the subunits of DNA polymerase III
holoenzyme from other thermophiles, such as those listed earlier
herein. Accordingly all chromosomal replicases (DNA Polymerase
III-type) from theromophilic sources are contemplated and included
herein.
[0031] The invention also extends to methods for identifying
Polymerase III-type enzymes by use of the techniques of long-chain
extension and elucidation of subunits with antibodies, as described
herein and with reference to the examples.
[0032] The invention further extends to the isolated and purified
DNA Polymerase III from T.th., A.ae., T.ma., and B.st., the amino
acid sequences of the .gamma., .tau., .epsilon., .alpha. (as well
as PolC), .delta., .delta.', and .beta. subunits and SSB, as set
forth herein, and the nucleotide sequences of the corresponding
genes from T.th., A.ae., T.ma, or B.st. set forth herein, as well
as to active fragments thereof, oligonucleotides and probes
prepared or derived therefrom and the transformed cells that may be
likewise prepared. Accordingly, the invention comprises the
individual subunits enumerated above and hereinafter, corresponding
isolated polynucleotides and respective amino acid sequences for
each of the .gamma., .tau., .epsilon., .alpha. (as well as PolC),
.delta., .delta.', and .beta. subunits and SSB, and to conserved
variants, fragments, and the like, as well as to methods of their
preparation and use in DNA amplification and sequencing. In a
particular embodiment, the invention extends to vectors for the
expression of the subunit genes of the present invention.
[0033] The invention also includes methods for the preparation of
the DNA Polymerase III-type enzymes and the corresponding subunit
genes of the present invention, and to the use of the enzymes and
constructs having active fragments thereof, in the preparation,
reconstitution or modification of like enzymes, as well as in
amplification and sequencing of DNA by methods such as PCR, and
like protocols, and to the DNA molecules amplified and sequenced by
such methods. In this regard, a Pol III-type enzyme that is
reconstituted in the absence of .epsilon., or using a mutated
.epsilon. with less 3'-5' exonuclease activity, may be a superior
enzyme in either PCR or DNA sequencing applications, (e.g. Tabor
et, al., 1995).
[0034] The invention is directed to methods for amplifying and
sequencing a DNA molecule, particularly via the polymerase chain
reaction (PCR), using the present DNA polymerase III-type enzymes
or complexes. In particular, the invention extends to methods of
amplifying and sequencing of DNA using thermostable pol III-type
enzyme complexes isolated from thermophilic bacteria such as
Thermotoga and Thermus species, or recombinant thermostable
enzymes. The invention also provides amplified DNA molecules made
by the methods of the invention, and kits for amplifying or
sequencing a DNA molecule by the methods of the invention.
[0035] In this connection, the invention extends to methods for
amplification of DNA that can achieve long chain extension of
primed DNA, as by the application and use of Polymerase III-type
enzymes of the present invention. An illustration of such methods
is presented in Examples 15 and 16, infra.
[0036] Likewise, kits for amplification and sequencing of such DNA
molecules are included, which kits contain the enzymes of the
present invention, including subunits thereof, together with other
necessary or desirable reagents and materials, and directions for
use. The details of the practice of the invention as set forth
above and later on herein, and with reference to the patents and
literature cited herein, are all expressly incorporated herein by
reference and made a part hereof.
[0037] As stated, and in accordance with a principal object of the
present invention, Polymerase III-type enzymes and their sub-units
are provided that are derived from thermophiles and that are
adapted to participate in improved DNA amplification and sequencing
techniques,, and, the consequent ability to prepare larger DNA
strands more rapidly and accurately.
[0038] It is a further object of the present invention to provide
DNA molecules that are amplified and sequenced using the Polymerase
III-type enzymes hereof.
[0039] It is a still further object of the present invention to
provide enzymes and corresponding methods for amplification and
sequencing of DNA that can be practiced without the participation
of the clamp-loading component of the enzyme.
[0040] It is a still further object of the present invention to
provide kits and other assemblies of materials for the practice of
the methods of amplification and sequencing as aforesaid, that
include and use the DNA polymerase III-type enzymes herein as part
thereof.
[0041] One goal of this invention is to fully reconstitute the
rapid and processive replicase from an extreme thermophilic
eubacterium from fully recombinant protein subunits. One might
think that the extreme heat in which these bacteria grow may have
resulted in a completely different solution to the problem of
chromosome replication. Prior to filing of the
previously-identified priority applications, it is believed that
Pol III had not been identified in any thermophile until the
present inventors found that Thermus thermophilus, which grows at a
rather high temperature of 70-80.degree. C., would appear to
contain a Pol III. Subsequent to this invention, the genome
sequence of A. aeolicus was published which shows dnaE, dnaN, and
dnaX genes. However, previous work did not fully reconstitute the
working replication machinery from fully recombinant subunits. A
holA gene and holB has not been identified previously in T.
thermophilus or A. aeolicus, and studies in the E. coli system show
that delta and delta prime, encoded by holA and holB, respectively,
are essential to loading the beta clamp onto DNA and, thus, is
essential for rapid and processive holoenzyme function (U.S. Pat.
Nos. 5,583,026 and 5,668,004 to O'Donnell, which are hereby
incorporated by reference).
[0042] This invention fully reconstitutes a functional DNA
polymerase III holoenzyme from the extreme thermophiles Thermus
thermophilus and Aquifex aeolicus. Aquifex aeolicus grows at an
even higher temperature than Thermus thermophilus, up to 85.degree.
C. In this invention, the genes of Thermus thermophilus, Aquifex
aeolicus, Thermotoga maritima, and Bacillus stearothermophilus that
are necessary to reconstitute the complete DNA polymerase III
machinery, which acts as rapid and processive polymerase, are
identified. Indeed, a delta prime (holB) and delta (holA) subunits
are needed.
[0043] The dnaE, dnaN, dnaX, dnaQ, holA, and holB genes are used to
express and purify the protein "gears", and the proteins are used
to reassemble the replication machine. The T.th. Pol III is similar
to E. coli. The A.ae. Pol III is slightly dissimilar from the
machinery of previously studied replicases. The A.ae. dnaX gene
encoded only one protein, tau, and in this fashion is similar to
the dnaX of the gram positive organism, Staphylococcus aureus. In
contrast, the dnaX of the gram negative cell, E. coli, produces two
proteins. The Aquifex aeolicus polymerase subunit, alpha (encoded
by dnaE) does not contain the 3'-5' proofreading exonuclease. In
this regard, A. aeolicus is similar to E. coli, but dissimilar to
the replicase of the gram positive organisms. In Gram positive
organisms, the PolC polymerase subunit of the replicase contains
the exonuclease activity in the same polypeptide chain as the
polymerase (Low et al., 1976; Barnes et al., 1994; Pacitti et al.,
1995). Further, the polymerase III of thermophilic bacteria retains
activity at high temperature.
[0044] Thermostable rapid and processive three component DNA
polymerases can be applied to several important uses. DNA
polymerases currently in use for DNA sequencing and DNA
amplification use enzymes that are much slower and thus could be
improved upon. This is especially true of amplification as the
three component polymerase is capable of speed and high
processivity making possible amplification of very long (tens of Kb
to Mb) lengths of DNA in a time-efficient manner. These three
component polymerases also function in conjunction with a
replicative helicase (DnaB), and thus are capable of amplification
at a single temperature, using the helicase to melt the DNA duplex.
This property could be useful in some methods of amplification, and
in polymerase chain reaction (PCR) methodology. For example, the
.alpha..tau..delta..delta.'/.beta. form of the E. coli DNA
polymerase III holoenzyme has been shown to function in both DNA
sequencing and PCR (U.S. Pat. Nos. 5,583,026 and 5,668,004 to
O'Donnell).
[0045] Other objects and advantages will become apparent from a
review of the ensuing description which proceeds with reference to
the following illustrative drawings.
DESCRIPTION OF THE DRAWINGS
[0046] FIG. 1 is a schematic depiction of the structure and
components of enzymes of the general family to which the enzymes of
the present invention belong.
[0047] FIG. 2 is an alignment of the N-terminal regions of E. coli
(SEQ. ID. No. 19) and B. subtilis (SEQ. ID. No. 20) dnaX gene
product. Asterisks indicate identities. The ATP binding consensus
sequence is indicated. The two regions used for PCR primer design
are shown in bold.
[0048] FIG. 3 is an image showing the Southern analysis of T.
thermophilus genomic DNA. Genomic DNA was analyzed for presence of
the dnaZ gene using the PCR radiolabeled probe. Enzymes used for
digestion are shown above each lane. The numbering to the right
corresponds to the length of DNA fragments (kb).
[0049] FIGS. 4A and 4B depict the full sequence of the dnaX gene of
T. thermophilus. DNA sequence (upper case, and corresponding to SEQ
ID No. 1) and predicted amino acid sequence (lower case, and
corresponding to SEQ ID No. 2) yields a 529 amino acid protein
(.tau.) of 58.0 kDa. A putative frameshifting sequence containing
several A residues 1478-1486 (underlined) may produce a smaller
protein (.gamma.) of 49.8 kDa. The potential Shine-Dalgarno (S.D.)
signal is bold and underlined. The start codon is in bold, and the
stop codon for .tau. is marked by an asterisk. The potential stop
codon for .gamma. is shown in bold after the frameshift site, and
two potential Shine-Dalgarno sequences upstream of the frameshift
site are indicated. Sequences of the primers used for PCR are shown
in italics above the nucleotide sequence of dnaX. The ATP binding
site is indicated, and the asterisks above the four Cys residues
near the ATP site indicate the putative Zn.sup.2+ finger. The
proline rich area is indicated above the sequence. Numbering of the
nucleotide sequence is presented to the right. Numbering of the
amino acid sequence of .tau. is shown in parenthesis to the
right.
[0050] FIG. 4C depicts the isolated DNA coding sequence for the
dnaX gene (also present in FIGS. 3A and 3B) in accordance with the
invention, which corresponds to SEQ. ID. No. 3.
[0051] FIG. 4D depicts the polypeptide sequence of the .gamma.
subunit of the Polymerase III of the present invention, which
corresponds to SEQ. ID. No. 4.
[0052] FIG. 4E depicts the polypeptide sequence of the .gamma.
subunit of the Polymerase III of the present invention defined by a
-1 frameshift, which corresponds to SEQ. ID. No. 4.
[0053] FIG. 4F depicts the polypeptide sequence of the .gamma.
subunit of the Polymerase III of the present invention defined by a
-2 frameshift, which corresponds to SEQ. ID. No. 5.
[0054] FIGS. 5A-B are alignments of the .gamma./.tau. ATP binding
domains for different bacteria. Dots indicate those residues that
are identical to the E. coli dnaX sequence. The ATP consensus site
is underlined, and the conserved cysteine residues that form the
zinc finger are indicated with asterisks. E. coli, Escherichia coli
(SEQ. ID. No. 21); H. inf., Haemophilus influenzae (SEQ. ID. No.
22); B. sub., Bacillus subtilis (SEQ. ID. No. 23); C. cres.,
Caulobacter crescentus (SEQ. ID. No. 24) M. gen., Mycoplasma
genitalium (SEQ. ID. No. 25); T. th., Thermus thermophilus (SEQ.
ID. No. 26). Alignments were produced using Clustal.
[0055] FIG. 6 is a diagram indicating a signal for
ribosomal-frameshifting in T.th. dnaX. The diagram shows part of
the sequence of the RNA (SEQ. ID. No. 27) around the frameshifting
site (SEQ. ID. No. 28), including the suspected slippery sequence
A9 (bold italic). The stop codon in the -2 reading frame is
indicated. Also indicated are potential step loop structures and
the nearest stop codons in the -1 reading frame.
[0056] FIG. 7 is an image showing a Western analysis of .gamma. and
.tau. in T.th. cells. Whole cells were lysed in SDS and
electrophoresed on a 10% SDS polyacrylamnide gel then transferred
to a membrane and probed with polyclonal antibody against E. coli
.gamma./.tau. as described in Experimental Procedures. Positions of
molecular weight size markers are shown to the left. Putative T.th.
.gamma. and .tau. are indicated to the right.
[0057] FIGS. 8A-B are images of E. coli colonies expressing T.th.
dnaX -1 and -2 frameshifts. The region of the dnaX gene slippery
sequence was cloned into the lacZ gene of pUC19 in three reading
frames, then transformed into E. coli cells and plated on LB plates
containing X-gal. The slippery sequence was also mutated by
inserting two G residues into the A9 sequence and then cloned into
pUC19 in all three reading frames. Color of colonies observed are
indicated by the plus signs. The picture shows the colonies, the
type of frameshift required for readthrough (blue color) is
indicted next to the sector.
[0058] FIG. 9 shows the construction of the T.th. .gamma./.tau.
expression vector. A genomic fragment containing a partial sequence
of dnaX was cloned into pALTER-1. This fragment was subcloned into
pUC19 (pUC19_dnaX). Then the N-terminal section of dnaX was
amplified such that the fragment was flanked by NdeI (at the
initiating codon) and the internal BamHI site. This fragment was
inserted to form the entire coding sequence of the dnaX gene in
pUC19 (pUC19dnaX). The dnaX gene was then cloned behind the
polyhistidine leader in the T7 based expression vector pET16 to
give pET16dnaX. Details are in "Experimental Procedures".
[0059] FIGS. 10A-C illustrate the purification of recombinant T.th.
.gamma. and .tau. subunits. T.th. .gamma. and .tau. subunits were
expressed in E. coli harboring pET16dnaX. Molecular size markers
are shown to the left of the gels, and the two induced proteins are
labeled as g and t to the right of the gel. Panel A) 10% SDS gel of
E. coli whole cell lysates before and after induction with IPTG.
Panel B) 8% SDS gel of the purification two steps after cell lysis.
First lane: the lysate was applied to a HiTrap Nickel
chromatography column. Second lane: the T.th. .gamma./.tau.
subunits were further purified on a Superose 12 gel filtration
column. Third lane, the E. coli .gamma. and .tau. subunits. Panel
C) Western analysis of the pure T.th. .gamma. and .tau. subunits
(first lane) and E. coli .gamma. and .tau. subunits (second
lane).
[0060] FIGS. 11A-B show the gel filtration of T.th. .gamma. and
.tau.. T.th. .gamma. and .tau. were gel filtered on a Superose 12
column. Column fractions were analyzed for ATPase activity and in a
Coomassie Blue stained 10% SDS polyacrylamide gel. Positions of
molecular weight markers are shown to the left of the gel. The
elution position of size standards analyzed in a parallel Superose
12 column under identical conditions are indicated above the gel.
Thyroglobin (670 kDa), bovine gamma globin (150 kDa), chicken
ovalbumin (44 kDa), equine myoglobin (17 kDa).
[0061] FIGS. 12A-C illustrate the characterization of the T.th.
.gamma. and .tau. ATPase activity. The T.th. .gamma./.tau. and E.
coli .tau. subunits are compared in their ATPase activity
characteristics. Due to the greater activity of E. coli .tau., the
values are plotted as percent for ease of comparison. Actual
specific activities for 100% values are given below as pmol ATP
hydrolyzed/30 min./pmol T.th. .gamma./.tau. (or pmol E. coli
.tau.). Panel A) T.th. .gamma. and .tau. ATPase is stimulated by
the presence of ssDNA. T.th. .gamma./.tau. was incubated at
65.degree. C. Specific activity was: 11.5 (+DNA); 2.5 (-DNA); E.
coli .tau. was assayed at 37.degree. C. Specific activity values
were: 112.5 (+DNA); (7.3-DNA). Panel B) Temperature stability of
DNA stimulated ATPase activity. T.th. .gamma./.tau., 11.3
(65.degree. C.); E. coli .tau., 97.5 (37.degree. C.). Panel C)
Stability of T.th. .gamma./.tau. ATPase to NaCl. T.th.
.gamma./.tau., 8.1 (100 mM added NaCl and 65.degree. C.); E. coli
.tau., 52.7 (0 M added NaCl and 37.degree. C.).
[0062] FIGS. 13A-13C are graphs that summarize the purification of
the DNA polymerase III from T.th. extracts. Panel A) shows the
activity and total protein in column fractions from the Heparin
Agarose column. Peak 1 fractions were chromatographed on ATP
agarose. Panel B) depicts the ATP-agarose column step, and Panel C)
shows the total protein and DNA polymerase activity eluted from the
MonoQ column.
[0063] FIGS. 14A-B are SDS polyacrylamide gels of T.th. subunits.
FIG. 14A is a 12% SDS polyacrylamide gel stained with Coomassie
Blue of the MonoQ column. Load stands for the material loaded onto
the column (ATP agarose bound fractions). FT stands for protein
that flowed through the MonoQ column. Fractions are indicated above
the gel. T.th. subunits in fractions 17-19 are indicated by the
labels placed between fractions 18 and 19. Additional small
subunits may be present but difficult to visualize, or may have run
off the gel. E. coli .gamma.,.delta. shows a mixture of the
.alpha., .gamma., and .delta. subunits of DNA polymerase III
holoenzyme (they are labeled to the right in the figure). FIG. 14B
shows the Western results of an SDS gel of the MonoQ fractions
probed with rabbit antiserum raised against the E. coli .alpha.
subunit. Load and FT are as described in Panel A. Fraction numbers
are shown above the gel. The band that comigrates with E. coli
.alpha., and the band in the Coomassie Blue stained gel in Panel A,
is marked with an arrow. This band was analyzed for microsequence
and the results are shown in FIG. 15.
[0064] FIGS. 15A-B show the alignments of the peptides obtained
from T.th. .alpha. subunit, TTH1 (shown in A) and TTH2 (shown in B)
with the amino acid sequences of the .alpha. subunits of other
organisms. The amino acid number of these regions within each
respective protein sequence are shown to the right. The
abbreviations of the organisms are as follows. E.coli--Escherichia
coli (SEQ ID NOS: 72 and 79 in 15A-B, respectively),
V.chol.--Vibrio cholerae (SEQ ID NOS: 73 and 80 in 15A-B,
respectively), H. inf--Haemophilus influenzae (SEQ ID NOS: 74 and
81 in 15A-B, respectively), R.prow.--Rickettsia prowazekii (SEQ ID
NOS: 75 and 82 in 15A-B, respectively), H. pyl.--Helicobacter
pylori (SEQ ID NOS: 76 and 83 in 15A-B, respectively),
S.sp.--Synechocystis sp. (SEQ ID NOS: 77 and 84 in 15A-B,
respectively), M.tub.--Mycobacterium tuberculosis (SEQ ID NOS: 78
and 85 in 15A-B, respectively), T.th.--Thermus thermophilus (SEQ ID
NOS: 61 and 60 in 15A-B, respectively).
[0065] FIGS. 16A-C show a nucleotide (Panels A-B, SEQ. ID. No. 86)
and amino acid (Panel C, SEQ. ID. No. 87) sequence of the dnaE gene
encoding the .alpha. subunit of DNA polymerase III replication
enzyme.
[0066] FIG. 17 shows an alignment of the amino acid sequence of
.epsilon. subunits encoded by dnaQ of several organisms. The amino
acid sequence of the Thermus thermophilus .epsilon. subunit of dnaQ
is also shown. T.th., Thermus thermophilus (SEQ. ID. No. 88);
D.rad., Deinococcus radiodurans (SEQ. ID. No. 89); Bac.sub.,
Bacillus subtilis (SEQ. ID. No. 90); H.inf:, Haemophilus influenzae
(SEQ. ID. No. 91); E.c., Escherichia coli (SEQ. ID. No. 92);
H.pyl., Helicobacter pylori (SEQ. ID. No. 93). The regions used to
obtain the inner part of the dnaQ gene are shown in bold. The
starts used for expression of the T.th. .epsilon. subunit are
marked.
[0067] FIGS. 18A-B show the nucleotide (Panel A, SEQ. ID. No. 94)
and amino acid (Panel B, SEQ. ID. No. 95) sequence of the dnaQ gene
encoding the .epsilon. subunit of DNA polymerase III replication
enzyme.
[0068] FIGS. 19A-B show an alignment of the DnaA protein of several
organisms. The amino acid sequence of the Thermus thermophilus DnaA
protein is also shown. P. mar., Pseudomonas marcesans (SEQ. ID. No.
96); Syn.sp., Synechocystis sp. (SEQ. ID. No. 97); Bac.sub.,
Bacillus subtilis (SEQ. ID. No. 98); M. tub; Mycobacterium
tuberculosis (SEQ. ID. No. 99); T.th., Thermus thermophilus (SEQ.
ID. No. 100); E.coli., Escherichia coli (SEQ. ID. No. 101); T.
mar., Thermatoga maritima (SEQ. ID. No. 102); and H.pyl.,
Helicobacter pylori (SEQ. ID. No. 103).
[0069] FIGS. 20A-B show the nucleotide (Panel A, SEQ. ID. No. 104)
and amino acid (Panel B, SEQ. ID. No. 105) sequence of the dnaA
gene of Thermus thermophilus.
[0070] FIGS. 21A-B show the nucleotide (Panel A, SEQ. ID. No. 106)
and amino acid (Panel B, SEQ. ID. No. 107) sequence of the dnaN
gene encoding the .beta. subunit of DNA polymerase III replication
enzyme.
[0071] FIGS. 22A-B show an alignment of the .beta. subunit of T.th.
to the .beta. subunits of other organisms. T.th., Thermus
thermophilus (SEQ. ID. No. 108); E. coii, Escherichia coli (SEQ.
ID. No. 109); P. mirab, Proteus mirabilis (SEQ. ID. No. 110); H.
infl, Haemophilus influenzae (SEQ. ID. No. 111); P. put.,
Pseudomonas putida (SEQ. ID. No. 112); and B. cap., Buchnera
aphidicola (SEQ. ID. No. 113).
[0072] FIG. 23 is a map of the pET24:dnaN plasmid. The functional
regions of the plasmid are indicated by arrows and italic,
restriction sites are marked with bars and symbols. The hatched
parts in the plasmid correspond to T.th. dnaN.
[0073] FIGS. 24A-B show the induction of T.th. .beta. in E. coli
cells harboring the T.th. .beta. expression vector. Panel A is the
cell induction. The first lane shows molecular weight markers (MW).
The second lane shows uninduced E. coli cells, and the third lane
shows induced E. coli. The induced T.th. .beta. is, indicated by
the arrow shown to the left. Induced cells were lysed then treated
with heat and the soluble portion was chromatographed on MonoQ.
Panel B shows the results of MonoQ purification of T.th.
.beta..
[0074] FIG. 25A is a schematic depiction of the use of the use of
the enzymes of the present invention in accordance with an
alternate embodiment hereof. In this scheme the clamp (.beta. or
PCNA) slides over the end of linear DNA to enhance the polymerase
(Pol III-type such as Pol III, Pol.beta. or Pol.delta..) In this
fashion the clamp loaderactivity is not needed.
[0075] FIG. 25B graphically demonstrates the results of the
practice of the alternate embodiment of the invention described and
set forth in Example 15, infra. Lane 1, E. coli Pol III without
.beta.; Lane 2, E. coli with .beta.; Lane 3, human Pol.delta.
without PCNA; Lane 4, human Pol.delta. with PCNA; Lane 5, T.th. Pol
III without T.th. .beta.; Lane 6, T.th. Pol III with T.th..beta..
The respective pmol synthesis in lanes 1-6 are: 6, 35, 2, 24, 0.6
and 1.9.
[0076] FIGS. 26A-B show the use of T.th. Pol III in extending
singly primed M13mp18 to an RFII form. The scheme in FIG. 26A shows
the primed template in which a DNA 57 mer was annealled to the
M13mp18 ssDNA circle. Then T.th. .beta. subunit (produced
recombinantly) and T.th. Pol III were added to the DNA in the
presence of radioactive nucleoside triphosphates. In FIG. 26B, the
products of the reaction were analyzed in a 0.8% native.agarose
gel. The position of ssDNA starting material, the RFII product, and
of intermediate species, are shown to the sides of the gel. Lane 1,
use of Pol III. Lane 2, use of the non-Pol III DNA polymerase.
[0077] FIG. 27 is an SDS polyacrylamide gel of the proteins of the
A. aeolicus replication machinery.
[0078] FIG. 28 is an SDS polyacrylamide gel analysis of the MonoQ
fractions of the method used to reconstitute and purify the A.
aeolicus .tau..delta..delta.' complex.
[0079] FIG. 29 is an SDS polyacrylamide gel analysis of the gel
filtration column fractions used in the preparation of the A.
aeolicus .alpha..tau..delta..delta.' complex. The bottom gel
analysis shows the profile obtained using the A. aeolicus .alpha.
subunit (polymerase) in the absence of the other subunits.
[0080] FIG. 30 is an alkaline agarose gel analysis of reaction
products for extension of a single primer around a 7.2 kb M13mp18
circular ssDNA genome that has been coated with A. aeolicus SSB.
The time course on the left are produced by
.alpha..tau..delta..delta.'/.beta., and the time course on the
right is produced by .alpha..tau..delta..delta.' in the absence of
.beta..
[0081] FIG. 31 is a graph illustrating the optimal temperature for
activity of the alpha subunit of Thermus replicase using a calf
thymus DNA replication assay. Reactions were shifted to the
indicated temperature for 5 minutes before detecting the level of
DNA synthesis activity.
[0082] FIG. 32 is a graph illustrating the optimal temperature for
activity of the alpha subunit of the Aquifex replicase using a calf
thymus DNA replication assay. Reactions were shifted to the
indicated temperature for 5 minutes before detecting the level of
DNA synthesis activity.
[0083] FIGS. 33A-E illustrate the heat stability of Aquifex
components. Assays of either .alpha. (FIG. 33A), .beta. (FIG. 33B),
.tau..delta..delta.' complex (FIG. 33C), SSB (FIG. 33D) and
.alpha..tau..delta..delta.' complex (FIG. 33E) were performed after
heating samples at the indicated temperatures. Components were
heated in buffer containing the following: 0.1% Triton X-100
(filled diamonds); 0.05% Tween-20 and 0.01% NP-40 (filled circles);
4 mM CaCl.sub.2 (filled triangles); 40% Glycerol (inverted filled
triangles); 0.01% Triton X-100, 0.05% Tween-20, 0.01% NP-40, 4 mM
CaCl.sub.2 (half-filled square); 40% Glycerol, 0.1% Triton X-100
(open diamonds); 40% Glycerol, 0.05% Tween-20, 0.01% NP-40 (open
circles); 40% Glycerol, 4 mM CaCl.sub.2 (open triangles); 40%
Glycerol, 0.01% Triton X-100, 0.05% Tween-20, 0.01% NP-40, 4 mM
CaCl.sub.2 (half-filled diamonds).
[0084] FIGS. 34A-B show the nucleotide sequence (SEQ. ID. No. 117)
of the dnaE gene of A. aeolicus.
[0085] FIG. 35 shows the amino acid sequence (SEQ. ID. No. 118) of
the a subunit of A. aeolicus.
[0086] FIG. 36 shows the nucleotide sequence (SEQ. ID. No. 119) of
the dnaX gene of A. aeolicus.
[0087] FIG. 37 shows the arnino acid sequence (SEQ. ID. No. 120) of
the tau subunit of A. aeolicus.
[0088] FIG. 38 shows the nucleotide sequence (SEQ. ID. No. 121) of
the dnaN gene of A. aeolicus.
[0089] FIG. 39 shows the amino acid sequence (SEQ. ID. No. 122) of
the .beta. subunit of A. aeolicus.
[0090] FIG. 40 shows the partial nucleotide sequence (SEQ. ID. No.
123) of the holA gene of A. aeolicus.
[0091] FIG. 41 shows the partial amino acide sequence (SEQ. ID. No.
124) of the .delta. subunit of A. aeolicus.
[0092] FIG. 42 shows the nucleotide sequence (SEQ. ID. No. 125) of
the holB gene of A. aeolicus.
[0093] FIG. 43 shows the amino acid sequence (SEQ. ID. No. 126) of
the .delta.' subunit of A. aeolicus.
[0094] FIG. 44 shows the nucleotide sequence (SEQ. ID. No. 127) of
the dnaQ of A. aeolicus.
[0095] FIG. 45 shows the amino acid sequence (SEQ. ID. No. 128) of
the .epsilon. subunit of A. aeolicus.
[0096] FIG. 46 shows the nucleotide sequence (SEQ. ID. No. 129) of
the ssb gene of A. aeolicus.
[0097] FIG. 47 shows the amino acid sequence (SEQ. ID. No. 130) of
the single-strand binding protein of A. aeolicus.
[0098] FIG. 48 shows the nucleotide sequence (SEQ. ID. No. 131) of
the dnaB gene of A. aeolicus.
[0099] FIG. 49 shows the amino acid sequence (SEQ. ID. No. 132) of
the DnaB helicase of A. aeolicus.
[0100] FIG. 50 shows the nucleotide sequence (SEQ. ID. No. 133) of
the dnaG gene of A. aeolicus.
[0101] FIG. 51 shows the amino acid sequence (SEQ. ID. No. 134) of
the DnaG priinase of A. aeolicus.
[0102] FIG. 52 shows the nucleotide sequence (SEQ. ID. No. 135) of
the dnaC gene of A. aeolicus.
[0103] FIG. 53 shows the amino acid sequence (SEQ. ID. No. 136) of
the DnaC protein of A. aeolicus.
[0104] FIG. 54A-B shows the nucleotide sequence (SEQ. ID. No. 137)
of the dnaE gene of T. maritima.
[0105] FIG. 55 shows the amino acid sequence (SEQ. ID. No. 138) of
the .alpha. subunit of T. maritima.
[0106] FIG. 56 shows the nucleotide sequence (SEQ. ID. No. 139) of
the dnaQ gene of T. maritima.
[0107] FIG. 57 shows the amino acid sequence (SEQ. ID. No. 140) of
the .epsilon. subunit of T. maritima.
[0108] FIG. 58 shows the nucleotide sequence (SEQ. ID. No. 141) of
the dnaX gene of T. maritima.
[0109] FIG. 59 shows the amino acid sequence (SEQ. ID. No. 142) of
the tau subunit of T. maritima.
[0110] FIG. 60 shows the nucleotide sequence (SEQ. ID. No. 143) of
the dnaN gene of T. maritima.
[0111] FIG. 61 shows the amino acid sequence (SEQ. ID. No. 144) of
the .beta. subunit of T. maritima.
[0112] FIG. 62 shows the nucleotide sequence (SEQ. ID. No. 145) of
the holA gene of T. maritima.
[0113] FIG. 63 shows the amino acid sequence (SEQ. ID. No. 146) of
the .delta. subunit of T. maritima.
[0114] FIG. 64 shows the nucleotide sequence (SEQ. ID. No. 147) of
the holB gene of T. maritima.
[0115] FIG. 65 shows the amino acid sequence (SEQ. ID. No. 148) of
the .delta.' subunit of T. maritima.
[0116] FIG. 66 shows the nucleotide sequence (SEQ. ID. No. 149) of
the ssb gene of T. maritima.
[0117] FIG. 67 shows the amino acid sequence (SEQ. ID. No. 150) of
the single-strand binding protein of T. maritima.
[0118] FIG. 68 shows the nucleotide sequence (SEQ. ID. No. 151) of
the dnaB gene of T. maritima.
[0119] FIG. 69 shows the amino acid sequence (SEQ. ID. No. 152) of
the DnaB helicase of T. maritima.
[0120] FIG. 70 shows the nucleotide sequence (SEQ. ID. No. 153) of
the dnaG gene of T. maritima.
[0121] FIG. 71 shows the amino acid sequence (SEQ. ID. No. 154) of
the DnaG priniase of T. maritima.
[0122] FIG. 72 shows the nucleotide sequence (SEQ. ID. No. 155) of
the holB gene of T. thermophilus.
[0123] FIG. 73 shows the amino acid sequence (SEQ. ID. No. 156) of
the .delta.' subunit of T. thermophilus.
[0124] FIG. 74 shows the nucleotide sequence (SEQ. ID. No. 157) of
the holA gene of T. thermophilus.
[0125] FIG. 75 shows the amino acid sequence (SEQ. ID. No. 158) of
the .delta. subunit of T. thermophilus.
[0126] FIG. 76 shows the nucleotide sequence (SEQ. ID. No. 171) of
the ssb gene of T. thermophilus.
[0127] FIG. 77 shows the amino acid sequence (SEQ. ID. No. 172) of
the single-strand binding protein of T. thermophilus.
[0128] FIG. 78 shows the partial nucleotide sequence (SEQ. ID. No.
173) of the dnaN gene of B. stearothermophilus.
[0129] FIG. 79 shows the partial amino acid sequence (SEQ. ID. No.
174) of the .beta. subunit of B. stearothermophilus.
[0130] FIG. 80 shows the nucleotide sequence (SEQ. ID. No. 175) of
the ssb gene of B. stearothermophilus.
[0131] FIG. 81 shows thearnino acid sequence (SEQ. ID. No. 176) of
the single-strand binding protein of B. stearothermophilus.
[0132] FIG. 82 shows the nucleotide sequence (SEQ. ID. No. 177) of
the holA gene of B. stearothermophilus.
[0133] FIG. 83 shows the amino acidsequence (SEQ. ID. No. 178) of
the .delta. subunit of B. stearothermophilus.
[0134] FIG. 84 shows the nucleotide sequence (SEQ. ID. No. 179) of
the holB gene of B. stearothermophilus.
[0135] FIG. 85 shows the amino acid sequence (SEQ. ID. No. 180) of
the .delta.' subunit of B. stearothermophilus.
[0136] FIGS. 86A-B show the partial nucleotide sequence (SEQ. ID.
No. 181) of the dnaX gene of B. stearothermophilus.
[0137] FIG. 87 shows the partial amino acid sequence (SEQ. ID. No.
182) of the tau subunit of B. stearothermophilus.
[0138] FIGS. 88A-B show the nucleotide sequence (SEQ. ID. No. 183)
of the polC gene of B. stearothermophilus.
[0139] FIG. 89 shows the amino acid sequence (SEQ. ID. No. 184) of
the PolC or .alpha.-large subunit of B. stearothermophilus.
DETAILED DESCRIPTION OF THE INVENTION
[0140] In accordance with the present invention there may be
employed conventional molecular biology, microbiology, and
recombinant DNA techniques within the skill of the art. Such
techniques are explained fully in the literature. See, e.g.,
Sambrook et al., "Molecular Cloning: A Laboratory Manual" (1989);
"Current Protocols in Molecular Biology" Volumes I-III (Ausubel, R.
M., ed.) (1994); "Cell Biology: A Laboratory Handbook" Volumes
I-III (Celis, J. E., ed.) (1994); "Current Protocols in Immunology"
Volumes I-III (Coligan, J. E., ed.) (1994); "Oligonucleotide
Synthesis" (M. J. Gait, ed.) (1984); "Nucleic Acid Hybridization"
(B. D. Hames & S. J. Higgins, eds.) (1985); "Transcription And
Translation" (B. D. Hames & S. J. Higgins, eds.) (1984);
"Animal Cell Culture" (R. I. Freshney, ed.) (1986); "Immobilized
Cells And Enzymes" (IRL Press) (1986); B. Perbal, "A Practical
Guide To Molecular Cloning" (1984), each of which is hereby
incorporated by reference.
[0141] Therefore, if appearing herein, the following terms shall
have the definitions set out below.
[0142] The terms "DNA Polymerase III," "Polymerase III-type
enzyme(s)", "Polymerase III enzyme complex(s)", "T.th. DNA
Polymerase III", "A.ae. DNA Polymerase III", "T.ma. DNA Polymerase
III", and any variants not specifically listed, may be used herein
interchangeably, as are .beta. subunit and sliding clamp and clamp
as are also .gamma. complex, clamp loader, and RFC, as used
throughout the present application and claims refer to
proteinaceous material including single or multiple proteins, and
extends to those proteins having the amino acid sequence data
described herein and presented in the Figures and corresponding
Sequence Listing entries, and the corresponding profile of
activities set forth herein and in the Claims. Accordingly,
proteins displaying substantially equivalent or altered activity
are likewise contemplated. These modifications may be deliberate,
for example, such as modifications obtained through site-directed
mutagenesis, or may be accidental, such as those obtained through
mutations in hosts that are producers of the complex or its named
subunits. Also, the terms "DNA Polymerase III," "T.th. DNA
Polymerase III," and ".gamma. and .tau. subunits", ".beta.
subunit", ".alpha. subunit", ".epsilon. subunit", ".delta.
subunit", ".delta.' subunit", "SSB protein", "sliding clamp" and
"clamp loader" are intended to include within their scope proteins
specifically recited herein as well as all substantially homologous
analogs and allelic variations. As used herein .gamma. complex
refers to a particular type of clamp loader that includes a .gamma.
subunit.
[0143] Also as used herein, the term "thermolabile enzyme" refers
to a DNA polymerase which is not resistant to inactivation by heat.
For example, T5 DNA polymerase, the activity of which is totally
inactivated by exposing the enzyme to a temperature of 90.degree.
C. for 30 seconds, is considered to be a thermolabile DNA
polymerase. As used herein, a thermolabile DNA polymerase is less
resistant to heat inactivation than in a thermostable DNA
polymerase. A thermolabile DNA polymerase typically will also have
a lower optimum temperature than a thermostable DNA polymerase.
Thermolabile DNA polymerases are typically isolated from mesophilic
organisms, for example mesophilic bacteria or eukaryotes, including
certain animals.
[0144] As used herein, the term "thermostable enzyme" refers to an
enzyme which is stable to heat and is heat resistant and catalyzes
(facilitates) combination of the nucleotides in the proper manner
to form the primer extension products that are complementary to
each nucleic acid strand. Generally, the synthesis will be
initiated at the 3' end of each primer and will proceed in the 5'
direction along the template strand, until synthesis terminates,
producing molecules of different lengths.
[0145] The thermostable enzyme herein must satisfy a single
criterion to be effective for the amplification reaction, i.e., the
enzyme must not become irreversibly denatured (inactivated) when
subjected to the elevated temperatures for the time necessary to
effect denaturation of double-stranded nucleic acids. Irreversible
denaturation for purposes herein refers to permanent and complete
loss of enzymatic activity. The heating conditions necessary for
denaturation will depend, e.g., on the buffer salt concentration
and the length and nucleotide composition of the nucleic acids
being denatured, but typically range from about 90.degree. C. to
about 96.degree. C. for a time depending mainly on the temperature
and the nucleic acid length, typically about 0.5 to four minutes.
Higher temperatures may be tolerated as the buffer salt
concentration and/or GC compositionof the nucleic acid is
increased. Preferably, the enzyme will not become irreversibly
denatured at about 90.degree.-100.degree. C.
[0146] The thermostable enzymes herein preferably have an optimum
temperature at which they function that is higher than about
40.degree. C., which is the temperature below which hybridization
of primer to template is promoted, although, depending on (1)
magnesium and salt concentrations and (2) composition and length of
primer hybridization can occur at higher temperature (e.g.,
45.degree.-70.degree. C.). The higher the temperature optimum for
the enzyme, the greater the specificity and/or selectivity of the
primer-directed extension process. However, enzymes that are active
below 40.degree. C., e.g., at 37.degree. C., are also within the
scope of this invention provided they are heat-stable. Preferably,
the optimum temperature ranges from about 50.degree. to about
90.degree. C., more preferably about 60.degree. to about 80.degree.
C. In this connection, the term "elevated temperature" as used
herein is intended to cover sustained temperatures of operation of
the enzyme that are equal to or higher than about 60.degree. C.
[0147] The term "template" as used herein refers to a
double-stranded or single-stranded DNA molecule which is to be
amplified, synthesized, or sequenced. In the case of a
double-stranded DNA molecule, denaturation of its strands to form a
first and a second strand is performed before these molecules may
be amplified, synthesized or sequenced. A primer, complementary to
a portion of a DNA template is hybridized under appropriate
conditions and the DNA polymerase of the invention may then
synthesize a DNA molecule complementary to said template or a
portion thereof The newly synthesized DNA molecule, according to
the invention, may be equal or shorter in length than the original
DNA template. Mismatch incorporation during the synthesis or
extension of the newly synthesized DNA molecule may result in one
or a number of mismatched base pairs. Thus, the synthesized DNA
molecule need not be exactly complementary to the DNA template.
[0148] The term "incorporating" as used herein means becoming a
part of a DNA molecule or primer.
[0149] As used herein "amplification" refers to any in vitro method
for increasing the number of copies of a nucleotide sequence, or
its complimentary sequence, with the use of a DNA polymerase.
Nucleic acid amplification results in the incorporation of
nucleotides into a DNA molecule or primer thereby forming a new DNA
molecule complementary to a DNA template. The formed DNA molecule
and its template can be used as templates to synthesize additional
DNA molecules. As used herein, one amplification reaction may
consist of many rounds of DNA replication. DNA amplification
reactions include, for example, polymerase chain reactions (PCR).
One PCR reaction may consist of about 20 to 100 "cycles" of
denaturation and synthesis of a DNA molecule. In this connection,
the use of the term "long stretches of DNA" as it refers to the
extension of primer along DNA is intended to cover such extensions
of an average length exceeding 7 kilobases. Naturally, such length
will vary, and all such variations are considered to be included
within the scope of the invention.
[0150] As used herein, the term "holoenzyme" refers to a
multi-subunit DNA polymerase activity comprising and resulting from
various subunits which each may have distinct activities but which
when contained in an enzyme reaction operate to carry out the
function of the polymerase (typically DNA synthesis) and enhance
its activity over use of the DNA polymerase subunit alone. For
example, E. coli DNA polymerase III is a holoenzyme comprising
three components of one or more subunits each: (1) a core component
consisting of a heterotrimer of .alpha., .epsilon. and .theta.
subunits; (2) a .beta. component consisting of a .beta. subunit
dimer; and (3) a .gamma. complex component consisting of a
heteropentamer of .gamma., .delta., .delta.', .chi. and .psi.
subunits (see Studwell and O'Donnell, 1990). These three
components, and the various subunits of which they consist, are
linked non-covalently to form the DNA polymerase III holoenzyme
complex. However, they also function when not linked in
solution.
[0151] As used herein, "enzyme complex" refers to a protein
structure consisting essentially of two or more subunits of a
replication enzyme, which may or may not be identical,
noncovalently linked to each other to form a multi-subunit
structure. An enzyme complex according to this definition ideally
will have a particular enzymatic activity, up to and including the
activity of the replication enzyme. For example, a "DNA pol III
enzyme complex" as used herein means a multi-subunit protein
activity comprising two or more of the subunits of the DNA pol III
replication enzyme as defined above, and having DNA polymerizing or
synthesizing activity. Thus, this term encompasses the native
replication enzyme, as well as an enzyme complex lacking one or
more of the subunits of the replication enzyme (e.g., DNA pol III
exo-, which lacks the .epsilon. subunit).
[0152] The amino acid residues described herein are preferred to be
in the "L" isomeric form. However, residues in the "D" isomeric
form can be substituted for any L-amino acid residue, as long as
the desired functional property of immunoglobulin-binding is
retained by the polypeptide. NH.sub.2 refers to the free amino
group present at the amino terminus of a polypeptide. COOH refers
to the free carboxy group present at the carboxy terminus of a
polypeptide. In keeping with standard polypeptide nomenclature, J.
Biol. Chem., 243:3552-59 (1969), abbreviations for amino acid
residues are shown in the following Table of Correspondence:
1 TABLE OF CORRESPONDENCE SYMBOLS 1-Letter 3-Letter AMINO ACID Y
Tyr tyrosine G Gly glycine F Phe phenylalanine M Met methionine A
Ala alanine S Ser serine I Ile isoleucine L Leu leucine T Thr
threonine V Val valine P Pro proline K Lys lysine H His histidine Q
Gln glutamine E Glu glutamic acid W Trp tryptophan R Arg arginine D
Asp aspartic acid N Asn asparagine C Cys cysteine
[0153] It should be noted that all amino-acid residue sequences are
represented herein by formulae whose left and right orientation is
in the conventional direction of amino-terminus to
carboxy-terminus. Furthermore, it should be noted that a dash at
the beginning or end of an amino acid residue sequence indicates a
peptide bond to a further sequence of one or more amino-acid
residues. The above Table is presented to correlate the
three-letter and one-letter notations which may appear alternately
herein.
[0154] A "replicon" is any genetic element (e.g., plasmid,
chromosome, virus) that functions as an autonomous unit of DNA
replication in vivo; i.e., capable of replication under its own
control.
[0155] A "vector" is a replicon, such as plasmid, phage or cosmid,
to which another DNA segment may be attached so as to bring about
the replication of the attached segment.
[0156] A "DNA molecule" refers to the polymeric form of
deoxyribonucleotides (adenine, guanine, thymine, or cytosine) in
its either single stranded form, or a double-stranded helix. This
term refers only to the primary arid secondary structure of the
molecule, and does not limit it to any particular tertiary forms.
Thus, this term includes double-stranded DNA found, inter alia, in
linear DNA molecules (e.g., restriction fragments), viruses,
plasmids, and chromosomes. In discussing the structure of
particular double-stranded DNA molecules, sequences may be
described herein according to the normal convention of giving only
the sequence in the 5' to 3' direction along the nontranscribed
strand of DNA (i.e., the strand having a sequence homologous to the
mRNA).
[0157] An "origin of replication" refers to those DNA sequences
that participate in DNA, synthesis.
[0158] A DNA "coding sequence" is a double-stranded DNA sequence
which is transcribed and translated into a polypeptide in vivo when
placed under the control of appropriate regulatory sequences. The
boundaries of the coding sequence are determined by a start codon
at the 5' (amino) terminus and a translation stop codon at the 3'
(carboxyl) terminus. A coding sequence can include, but is not
limited to, prokaryotic sequences, cDNA from eukaryotic mRNA,
genomic DNA sequences from eukaryotic (e.g., mammalian) DNA, and
even: synthetic DNA sequences. A polyadenylation signal and
transcription termination sequence will usually be located 3' to
the coding sequence.
[0159] Transcriptional and translational control sequences are DNA
regulatory sequences, such as promoters, enhancers, polyadenylation
signals, terminators, and the like, that provide for the expression
of a coding sequence in a host cell.
[0160] A "promoter sequence" is a DNA regulatory region capable of
binding RNA polymerase in a cell and initiating transcription of a
downstream (3' direction) coding sequence. For purposes of defining
the present invention, the promoter sequence is bounded at its 3 '
terminus by the transcription initiation site and extends upstream
(5' direction) to include the minimum number of bases or elements
necessary to initiate transcription at levels detectable above
background. Within the promoter sequence will be found a
transcription initiation site (conveniently defined by mapping with
nuclease S1), as well as protein binding domains (consensus
sequences) responsible for the binding of RNA polymerase.
Eukaryotic promoters will often, but not always, contain "TATA"
boxes and "CAT" boxes. Prokaryotic promoters contain Shine-Dalgarno
sequences in addition to the -10 and -35 consensus sequences.
[0161] An "expression control sequence" is a DNA sequence that
controls and regulates the transcription and translation of another
DNA sequence. A coding sequence is "under the control" of
transcriptional and translational control sequences in a cell when
RNA polymerase transcribes the coding sequence into mRNA, which is
then translated into the protein encoded by the coding
sequence.
[0162] A "signal sequence" can be included before the coding
sequence. This sequence encodes a signal peptide, N-terminal to the
polypeptide, that communicates to the host cell to direct the
polypeptide to the cell surface or secrete the polypeptide into the
media, and this signal peptide is clipped off by the host cell
before the protein leaves the cell. Signal sequences can be found
associated with a variety of proteins native to prokaryotes and
eukaryotes.
[0163] The term "oligonucleotide," as used generally herein, such
as in referring to probes prepared and used in the present
invention, is defined as a molecule comprised of two or more
(deoxy)ribonucleotides, preferably more than three. Its exact size
will depend upon many factors which, in turn, depend upon the
ultimate function and use of the oligonucleotide.
[0164] The term "primer" as used herein refers to an
oligonucleotide, whether occurring naturally as in a purified
restriction digest or produced synthetically, which is capable of
acting as a point of initiation of synthesis when placed under
conditions in which synthesis of a primer extension product, which
is complementary to a nucleic acid strand, is induced, i.e., in the
presence of nucleotides and an inducing agent such as a DNA
polymerase and at a suitable temperature and pH. The primer may be
either single-stranded or double-stranded and must be sufficiently
long to prime the synthesis of the desired extension product in the
presence of the inducing agent. The exact length of the primer will
depend upon many factors, including temperature, source of primer
and use of the method. For example, for diagnostic applications,
depending on the complexity of the target sequence, the
oligonucleotide primer typically contains 15-25 or more
nucleotides, although it may contain fewer nucleotides.
[0165] The primers herein are selected to be "substantially"
complementary to different strands of a particular target DNA
sequence. This means that the primers must be sufficiently
complementary to hybridize with their respective strands.
Therefore, the primer sequence need not reflect the exact sequence
of the template. For example, a non-complementary nucleotide
fragment may be attached to the 5' end of the primer, with the
remainder of the primer sequence being complementary to the strand.
Alternatively, non-complementary bases or longer sequences can be
interspersed into the primer, provided that the primer sequence has
sufficient complementarity with the sequence of the strand to
hybridize therewith and thereby form the template for the synthesis
of the extension product.
[0166] As used herein, the terms "restriction endonucleases" and
"restriction enzymes" refer to bacterial enzymes, each of which cut
double-stranded DNA at or near a specific, nucleotide sequence.
[0167] A cell has been "transformed" by exogenous or heterologous
DNA when such DNA has been introduced inside the cell. The
transforming DNA may or may not be integrated (covalently linked)
into chromosomal DNA making up the genome of the cell. In
prokaryotes, yeast, and mammalian cells for example, the
transforming DNA may be maintained on an episomal element such as a
plasmid. With respect to eukaryotic cells, a stably transformed
cell is one in which the transforming DNA has become integrated
into a chromosome so that it is inherited by daughter cells through
chromosome replication. This stability is demonstrated by the
ability of the eukaryotic cell to establish cell lines or clones
comprised of a population of daughter cells containing the
transforming DNA. A "clone" is a population of cells derived from a
single cell or common ancestor by mitosis. A "cell line" is a clone
of a primary cell that is capable of stable growth in vitro for
many generations.
[0168] Two DNA sequences are "substantially homologous" when at
least about 75% (preferably at least about 80%, and most preferably
at least about 90 or 95%) of the nucleotides match over the defined
length of the DNA sequences. Sequences that are substantially
homologous can be identified by comparing the sequences using
standard software available in sequence data banks, or in a
Southern hybridization experiment under, for example, stringent
conditions as defined for that particular system. Suitable
conditions include those characterized by a hybridization buffer
comprising 0.9M sodium citrate ("SSC") buffer at a temperature of
about 37.degree. C. and washing in SSC buffer at a temperature of
about 37.degree. C.; and preferably in a hybridization buffer
comprising 20% formamide in 0.9M SSC buffer at a temperature of
about 42.degree. C. and washing with 0.2.times.SSC buffer at about
42.degree. C. Stringency conditions can be further varied by
modifying the temperature and/or salt content of the buffer, or by
modifying the length of the hybridization probe as is known to
those of skill in the art. Defining appropriate hybridization
conditions is within the skill of the art. See, e.g., Maniatis et
al., 1982; Glover, 1985; Hames and Higgins, 1984.
[0169] It should be appreciated that also within the scope of the
present invention are degenerate DNA sequences. By "degenerate" is
meant that a different three-letter codon is used to specify a
particular amino acid. It is well known in the art that the
following codons can be used interchangeably to code for each
specific amino acid:
2 Phenylalanine (Phe or F) UUU or UUC Leucine (Leu or L) UUA or UUG
or CUU or CUC or CUA or CUG Isoleucine (Ile or I) AUU or AUC or AUA
Methionine (Met or M) AUG Valine (Val or V) GUU or GUC of GUA or
GUG Serine (Ser or S) UCU or UCC or UCA or UCG or AGU or AGC
Proline (Pro or P) CCU or CCC or CCA or CCG Threonine (Thr or T)
ACU or ACC or ACA or ACG Alanine (Ala or A) GCU or GCG or GCA or
GCG Tyrosine (Tyr or Y) UAU or UAC Histidine (His or H) CAU or CAC
Glutamine (Gln or Q) CAA or CAG Asparagine (Asn or N) AAU or AAC
Lysine (Lys or K) AAA or AAG Aspartic Acid (Asp or D) GAU or GAC
Glutamic Acid (Glu or E) GAA or GAG Cysteine (Cys or C) UGU or UGC
Arginine (Arg or R) CGU or CGC or CGA or CGG or AGA or AGG Glycine
(Gly or G) GGU or GGC or GGA or GGG Tryptophan (Trp or W) UGG
Termination codon UAA (ochre) or UAG (amber) or UGA (opal)
[0170] It should be understood that the codons specified above are
for RNA sequences. The corresponding codons for DNA have a T
substituted for U.
[0171] Mutations can be made, e.g., in SEQ. ID. No. 1, or any of
the nucleic acids set forth herein, such that a particular codon is
changed to a codon which codes for a different amino acid. Such a
mutation is generally made by making the fewest nucleotide changes
possible. A substitution mutation of this sort can be made to
change an amino acid in the resulting protein in a non-conservative
manner (i.e., by changing the codon from an amino acid belonging to
a grouping of amino acids having a particular size or
characteristic to an amino acid belonging to another grouping) or
in a conservative manner (i.e., by changing the codon from an amino
acid belonging to a grouping of amino acids having a particular
size or characteristic to an amino acid belonging to the same
grouping). Such a conservative change generally leads to less
change in the structure and function of the resulting protein. A
non-conservative change is more likely to alter the structure,
activity or function of the resulting protein. The present
invention should be considered to include sequences containing
conservative changes which do not significantly alter the activity
or binding characteristics of the resulting protein.
[0172] The following is one example of various groupings of amino
acids:
[0173] Amino Acids with Nonpolar R Groups
[0174] Alanine
[0175] Valine
[0176] Leucine
[0177] Isoleucine
[0178] Proline
[0179] Phenylalanine
[0180] Tryptophan
[0181] Methionine
[0182] Amino Acids with Uncharted Polar R Groups
[0183] Glycine
[0184] Serine
[0185] Threonine
[0186] Cysteine
[0187] Tyrosine
[0188] Asparagine
[0189] Glutamine
[0190] Amino Acids with Charged Polar R Groups (Negatively Charged
at pH 6.0)
[0191] Aspartic acid
[0192] Glutamic acid
[0193] Basic Amino Acids (Positively Charged at pH 6.0)
[0194] Lysine
[0195] Arginine
[0196] Histidine (at pH 6.0).
[0197] Amino Acids with 1Phenyl Groups:
[0198] Phenylalanine
[0199] Tryptophan
[0200] Tyrosine
[0201] Another grouping may be according to molecular weight (i.e.,
size of R groups):
3 Glycine 75 Alanine 89 Serine 105 Proline 115 Valine 117 Threonine
119 Cysteine 121 Leucine 131 Isoleucine 131 Asparagine 132 Aspartic
acid 133 Glutamine 146 Lysine 146 Glutamic acid 147 Methionine 149
Histidine (at pH 6.0) 155 Phenylalanine 165 Arginine 174 Tyrosine
181 Tryptophan 204
[0202] Particularly preferred substitutions are:
[0203] Lys for Arg and vice versa such that a positive charge may
be maintained;
[0204] Glu for Asp and vice versa such that a negative charge may
be maintained;
[0205] Ser for Thr such that a free --OH can be maintained; and
[0206] Gln for Asn such that a free NH.sub.2 can be maintained.
[0207] Amino acid substitutions may also be introduced to
substitute an amino acid with a particularly preferable property.
For example, a Cys may be introduced into a potential site for
disulfide bridges with another Cys. A His may be introduced as a
particularly "catalytic" site (i.e., His can act as an acid or base
and is the most common amino acid in biochemical catalysis). Pro
may be introduced because of its particularly planar structure,
which induces .beta.-turns in the protein's structure.
[0208] Two amino acid sequences are "substantially homologous" when
at least about 70% of the amino acid residues (preferably at least
about 80%, and most preferably at least about 90 or 95%) are
identical, or represent conservative substitutions.
[0209] A "heterologous" region of the DNA construct is an
identifiable segment of DNA within a larger DNA molecule that is
not found in association with the larger molecule in nature. Thus,
when the heterologous region encodes a mammalian gene, the gene
will usually be flanked by DNA that does not flank the mammalian
genomic DNA in the genome of the source, organism. Another example
of a heterologous coding sequence is a construct where the coding
sequence itself is not found in nature (e.g., a cDNA where the
genomic coding sequence contains, introns, or synthetic sequences
having codons different than the native gene). Allelic variations
or naturally-occurring mutational events do not give rise to a
heterologous region of DNA as defined herein.
[0210] An "antibody" is any immunoglobulin, including antibodies
and fragments thereof, that binds a specific epitope. The term
encompasses polyclonal, monoclonal, and chimeric antibodies, the
last mentioned described in further detail in U.S. Pat. Nos.
4,816,397 to Boss et al. and U.S. Pat. No. 4,816,567 to Cabilly et
al.
[0211] An "antibody combining site" is that structural portion of
an antibody molecule comprised of heavy and light chain variable
and hypervariable regions that specifically binds antigen.
[0212] The phrase "antibody molecule" in its various grammatical
forms as used herein contemplates both an intact immunoglobulin
molecule and an immunologically active portion of an immunoglobulin
molecule. Exemplary antibody molecules are intact immunuoglobulin
molecules, substantially intact immunoglobulin molecules and those
portions of an immunoglobulin molecule that contains the paratope,
including those portions known in the art as Fab, Fab',
F(ab').sub.2 and F(v), which portions are preferred for use in the
therapeutic methods described herein. Fab and F(ab').sub.2 portions
of antibody molecules are prepared by the proteolytic reaction of
papain and pepsin, respectively, on substantially intact antibody
molecules by methods that are well-known. See for example, U.S.
Paten. No. 4,342,566 to Theofilopolous et al. Fab' antibody
molecule portions are also well-known and are produced from
F(ab').sub.2 portions followed by reduction of the disulfide bonds
linking the two heavy chain portions as with mercaptoetbanol, and
followed by alkylation of the resulting protein mercaptan with a
reagent such as iodoacetarnide. An antibody containing intact
antibody molecules is preferred herein.
[0213] The phrase "monoclonal antibody" in its various grammatical
forms refers to an antibody having only one species of antibody
combining site capable of immunoreacting with a particular antigen.
A monoclonal antibody thus typically displays a single binding
affinity for any antigen with which it immunoreacts. A monoclonal
antibody may therefore contain an antibody molecule having a
plurality of antibody combining sites, each immunospecific for a
different antigen; e.g., a bispecific (chimeric) monoclonal
antibody.
[0214] A DNA sequence is "operatively linked" to an expression
control sequence when the expression control sequence controls and
regulates the transcription and translation of that DNA sequence.
The term "operatively linked" includes having an appropriate start
signal (e.g.,ATG) in front of the DNA sequence to be expressed and
maintaining the correct reading frame to permit expression of the
DNA sequence under the control of the expression control sequence
and production of the desired product encoded by the DNA sequence.
If a gene that one desires to insert into a recombinant DNA
molecule does not contain an appropriate start signal, such a start
signal can be inserted in front of the gene.
[0215] The term "standard hybridization conditions" refers to salt
and temperature conditions substantially equivalent to 5.times.SSC
arid 65.degree. C. for both hybridization and wash. However, one
skilled in the art will appreciate that such "standard
hybridization conditions" are dependent on particular conditions
including the concentration of sodium and magnesium in the buffer,
nucleotide sequence length and concentration, percent mismatch,
percent formamide, and the like. Also important in the
determination of "standard hybridization conditions" is whether the
two sequences hybridizing are RNA-RNA, DNA-DNA or RNA-DNA. Such
standard hybridization conditions are easily determined by one
skilled in the art according to well known formulae, wherein
hybridization is typically 10-20.degree. C. below the predicted or
determined T.sub.m with washes of higher stringency, if
desired.
[0216] In its primary aspect, the present invention concerns the
identification of a class of DNA Polymerase III-type enzymes or
complexes found in thermophilic bacteria such as Thermus
thermophilus (T.th.), Aquifex aeolicus (A.ae.), Thermotoga maritima
(T.ma.), Bacillus stearothermophilus (B.st.) and other eubacteria
which exhibit the following characteristics, among their
properties: the ability to extend a primer over a long stretch of
ssDNA at elevated temperature, stimulation by its cognate sliding
clamp of the type that is assembled on DNA by a clamp loader,
accessory subunits that exhibit DNA-stimulated ATPase activity at
elevated temperature and/or ionic strength, and an associated 3'-5'
exonuclease activity. In a particular aspect, the invention extends
to Polymerase III-type enzymes derived from a broad class of
thermophilic eubacteria that include polymerases isolated from the
thermophilic bacteria Aquifex aeolicus (A.ae. polymerase) and other
members of the Aquifex genus; Thermus thermophilus (T.th.
polymerase), Thermus favus (Tfl/Tub polymerase), Thermus ruber (Tru
polymerase), Thermus brockianus (DYNAZYME.TM. polymerase) and other
members of the Thermus genus; Bacillus stearothermophilus (Bst
polymerase) and other members of the Bacillus genus; Thermoplasma
acidophilum (Tac polymerase) and other members of the Thermoplasma
genus; and Thermotoga neapolitana (Tne polymerase; See WO 96/10640
to Chatterjee et al.), Thermotoga maritima (Tma polymerase; See
U.S. Pat. No. 5,374,553 to Gelfand et al.), and other members of
the Thermotoga genus. The particular polymerase discussed herein by
way of illustration and not limitation, is the enzyme derived from
T.th., A.ae., T.ma., or B.st.
[0217] Polymerase III-type enzymes covered by the invention include
those that may be prepared by purification from cellular material,
as described in detail in the Examples infra, as well as enzyme
assemblies or complexes that comprise the combination of
individually prepared enzyme subunits or components. Accordingly,
the entire enzyme may be prepared by purification from cellular
material, or may be constructed by the preparation of the
individual components and their assembly into the functional
enzyme. A representative and non-limitative protocol for the
preparation of an enzyme by this latter route is set forth in U.S.
Pat. No. 5,583,026 to O'Donnell, and the disclosure thereof is
incorporated herein in its entirety for such purpose.
[0218] Likewise, individual subunits may be modified, e.g. as by
incorporation therein of single residue substitutions to create
active sites therein, for the purpose of imparting new or enhanced
properties to enzymes containing the *modified subunits (see, e.g.,
Tabor, 1995). Likewise, individual subunits prepared in accordance
with the invention, may be used individually and for example, may
be substituted for their counterparts in other enzymes, to improve
or particularize the properties of the resultant modified enzyme.
Such modifications are within the skill of the art and are
considered to be included within the scope of the present
invention.
[0219] Accordingly, the invention includes the various subunits
that may comprise the enzymes, and accordingly extends to the genes
and corresponding proteins that may be encoded thereby, such as the
.alpha. (as well as PolC), .beta., .gamma., .epsilon., .tau.,
.delta. and .delta.' subunits, respectively. More particularly, in
Thermus thermophilus the .alpha. subunit corresponds to dnaE, the
.beta. subunit corresponds to dnaN, the .epsilon. subunit
corresponds to dnaQ, and the .gamma. and .tau. subunits correspond
to dnaX, the .delta. subunit corresponds to holA, and the .delta.
subunit corresponds to holB. In Aquifex aeolicus and Thermotoga
maritima, the .alpha. subunit corresponds to dnaE, the .beta.
subunit corresponds to dnaN, the .epsilon. subunit corresponds to
dnaQ, the .tau. subunit corresponds to dnaX, the .delta. subunit
corresponds to holA, and the .delta.' subunit corresponds to holB.
In Bacillus stearothermophilus, the PolC which has both .alpha. and
.epsilon. activities corresponds to polC, the .beta. subunit
corresponds to dnaN, the .epsilon. subunit corresponds to dnaQ, the
.tau. subunit corresponds to dnaX, the .delta. subunit corresponds
to holA, and the .delta.' subunit corresponds to holB.
[0220] Accordingly, the Polymerase III-type enzyme of the present
invention comprises at least one gene encoding a subunit thereof,
which gene is selected from the group consisting of dnaX, dnaQ,
dnaE, dnaN, holA, holB, and combinations thereof. More
particularly, the invention extends to the nucleic acid molecule
encoding them and their encoded subunits.
[0221] In the T.th. Pol III enzyme, this includes the following
nucleotide sequences: dnaX (SEQ. ID. No. 3), dnaE (SEQ. ID. No.
86), dnaQ (SEQ. ID. No. 94), dnaN (SEQ. ID. No. 106), holA (SEQ.
ID. No. 157), and holB (SEQ. ID. No. 155).
[0222] In the A.ae. Pol III enzyme, this includes the following
nucleotide sequences: dnaX (SEQ. ID. No. 119), dnaE (SEQ. ID. No.
117), dnaQ (SEQ. ID. No. 127), dnaN (SEQ. ID. No. 121), holA (SEQ.
ID. No. 123), and holB (SEQ. ID. No. 125).
[0223] In the T.ma. Pol III enzyme, this includes the following
nucleotide sequences: dnaX (SEQ. ID. No. 141), dnaE (SEQ. ID. No.
137), dnaQ (SEQ. ID. No. 139), dnaN (SEQ. ID. No. 143), holA (SEQ.
ID. No. 145), and holB (SEQ. ID. No. 147).
[0224] In the B.st. Pol III enzyme, this includes the following
nucleotide sequences: dnaX (SEQ. ID. No. 181), dnaN (SEQ. ID. No.
173), holA (SEQ. ID. No. 177), holB (SEQ. ID. No. 179), and polC
(SEQ. ID. Nos. 183).
[0225] In each of the Pol III type enzymes of the present
invention, not only are each of the above-identified coding
sequences contemplated, but also conserved variants, active
fragments and analogs thereof.
[0226] A particular T.th. Polymerase III-type enzyme in accordance
with the invention may include at least one of the following
sub-units: a .gamma. subunit having an amino acid sequence
corresponding to SEQ. ID. Nos. 4 and 5; a .tau. subunit having an
amino acid sequence corresponding to SEQ. ID. No. 2; a .epsilon.
subunit having an amino acid sequence corresponding to SEQ. ID. No.
95; a .alpha. subunit including an amino acid sequence
corresponding SEQ. ID. No. 87; a .beta. subunit having an amino
acid sequence corresponding to SEQ. ID. No. 107; a .delta. subunit
having an amino acid sequence corresponding to SEQ. ID. No. 158; a
.delta.' subunit having an amino acid sequence corresponding to
SEQ. ID. No. 156; as well as variants, including allelic variants,
muteins, analogs and fragments of any of the subunits, and
compatible combinations thereof, capable of functioning in DNA
amplification and sequencing.
[0227] A particular A.ae. Polymerase III-type enzyme in accordance
with the invention may include at least one of the following
sub-units: .tau. subunit having an amino acid sequence
corresponding to SEQ. ID. No. 120; a .epsilon. subunit having an
amino acid sequence corresponding to SEQ. ID. No. 128; a .alpha.
subunit including an amino acid sequence corresponding to SEQ. ID.
No. 118; a .beta. subunit having an amino acid sequence
corresponding to SEQ. ID. No. 122; a .delta. subunit having an
amino acid sequence corresponding to SEQ. ID. No. 124; a .delta.'
subunit having an amino acid sequence corresponding to SEQ. ID. No.
126; as well as variants, including allelic variants, muteins,
analogs and fragments of any of the subunits, and compatible
combinations thereof, capable of functioning in DNA amplification
and sequencing.
[0228] A particular T.ma Polymerase III-type enzyme in accordance
with the invention may include at least one of the following
sub-units: a .tau. subunit having an amino acid sequence
corresponding to SEQ. ID. No. 142; a .epsilon. subunit having an
amino acid sequence corresponding to SEQ. ID. No. 140; a .alpha.
subunit including an amino acid sequence corresponding to SEQ. ID.
No. 138; a .beta. subunit having an amino acid sequence
corresponding to SEQ. ID. No. 144; a .delta. subunit having an
amino acid sequence corresponding to SEQ. ID. No. 146; a .delta.'
subunit having an amino acid sequence corresponding to SEQ. ID. No.
148; as well as variants, including allelic variants, muteins,
analogs and fragments of any of the subunits, and compatible
combinations thereof,.capable of functioning in DNA amplification
and sequencing.
[0229] A particular B.st. Polymerase III-type enzyme in accordance
with the invention may include at least one of the following
subunits: a .tau. subunit having a partial amino acid sequence
corresponding to SEQ. ID. No. 182; a .beta. subunit having an amino
acid sequence corresponding to SEQ ID. No. 174; a .delta. subunit
having an amino acid sequence corresponding to SEQ. ID. No. 178; a
.delta.' subunit having an amino acid sequence corresponding to
SEQ. ID. No. 180; a PolC subunit having an amino acid sequence
corresponding to SEQ. ID. Nos. 184; as well as variants, including
allelicvariants, muteins, analogs and fragments of any of the
subunits, and compatible combinations thereof, capable of
functioning in DNA amplification and sequencing.
[0230] The invention also includes and extends to the use and
application of the enzyme and/or one or more of its components for
DNA molecule amplification and sequencing by the methods set forth
hereinabove, and in greater detail later on herein.
[0231] One of the subunits of the invention is the T.th.
.gamma./.tau. subunit encoded by a dnaX gene, which frameshifts as
much as -2 with high efficiency, and that, upon frameshifting,
leads to the addition of more than one extra amino acid residue to
the C-terminus (to form the .gamma. subunit). Further, the
invention likewise extends to a dnaX gene derived from a
thermophile such as T.th., that possesses the frameshift defined
herein and that codes for expression of the .gamma. and .tau.
subunits of DNA Polymerase III.
[0232] The present invention provides methods for amplifying or
sequencing a nucleic acid molecule comprising contacting the
nucleic acid molecule with a composition comprising a DNA
polymerase III enzyme (DNA pol III) complex (for sequencing,
preferably a DNA pol III complex that is substantially reduced in
3'-5' exonuclease activity). DNA pol III complexes used in the
methods of the present invention are thermostable.
[0233] The invention also provides DNA molecules amplified by the
present methods, methods of preparing a recombinant vector
comprising inserting a DNA molecule amplified by the present
methods into a vector, which is preferably an expression vector,
and recombinant vectors prepared by these methods.
[0234] The invention also provides methods of preparing a
recombinant host cell comprising inserting a DNA molecule amplified
by the present methods into a host cell, which preferably a
bacterial cell, most preferably an Escherichia coli cell; a yeast
cell; or an animal cell, most preferably an insect cell, a nematode
cell or a mammalian cell. The invention also provides and
recombinant host cells prepared by these methods.
[0235] In additional preferred embodiments, the present invention
provides kits for amplifying or sequencing a nucleic acid molecule.
DNA amplification kits according to the invention comprise a
carrier means having in close confinement therein two or more
container means, wherein a first container means contains a DNA
polymerase III enzyme complex and a second container means contains
a deoxynucleoside triphosphate. DNA sequencing kits according to
the present invention comprise a multi-protein Pol III-type enzyme
complex and a second container means contains a dideoxynucleoside
triphosphate. The DNA pol III contained in the container means of
such kits is preferably substantially reduced in 5'-3' exonuclease
activity, may be thermostable, and may be isolated from the
thermophilic cellular sources described above.
[0236] DNA pol III-type enzyme complexes for use in the present
invention may be isolated from any organism that produced the DNA
pol III-type enzyme complexes naturally or recombinantly. Such
enzyme complexes may be thermostable, isolated from a variety of
thermophilic organisms.
[0237] The thermostable DNA polymerase III-type enzymes or
complexes that are an important aspect of this invention, may be
isolated from a variety of thermophilic bacteria that are available
commercially (for example, from American Type Culture Collection,
Rockville, Md.). Suitable for use as sources of thermostable
enzymes are the thermophilic eubacteria Aquifex aeolicus and other
species of the Aquifex genus; Thermus aquaticus, Thermus
thermophilus, Thermus flavus, Thermus ruber, Thermus brockianus,
and other species of the Thermus genus; Bacillus
stearothermophilus, Bacillus subtilis, and other species of the
Bacillus genus; Thermoplasma acidophilum and other species of the
Thermoplasma genus; Thermotoga neapolitana, Thermotoga maritima and
other species of the Thermotoga genus; and mutants of each of these
species. It will be understood by one of ordinary skill in the art,
however, that any thermophilic microorganism might be used as a
source of thermostable DNA pol III-type enzymes and polypeptides
for use in the methods of the present invention. Bacterial cells
maybe grown according to standard microbiological techniques, using
culture media and incubation conditions suitable for growing active
cultures of the particular thermophilic species that are well-known
to one of ordinary skill in the art (see, e.g., Brock et al., 1969;
Oshima et al., 1974). Thermostable DNA pol III complexes may then
be isolated from such thermophilic cellular sources as described
for thermolabile complexes above.
[0238] Several methods are available for identifying homologous
nucleic acids and protein subunits in other thermophilic
eubacteria, either those listed above or otherwise. These methods
include the following:
[0239] (1) The following procedure was used to obtain the genes
encoding T.th. .epsilon. (dnaQ), .tau./.gamma. (dnaX), DnaA (dnaA),
and .beta. (dnaN). Protein sequences encoded by genes of
non-thermophilic bacteria (i.e., mesophiles) are aligned to
identify highly conserved amino acid sequences. PCR primers at
conserved positions are designed using the codon usage of the
organism of interest to amplify an internal section of the gene
from genomic DNA extracted from the organism. The PCR product is
sequenced. New primers are designed near the ends of the sequence
to obtain new sequence that flanks the ends using circular PCR
(also called inversed PCR) on genomic DNA that has been cut with
the appropriate restriction enzyme and ligated into circles. These
new PCR products are sequenced. The procedure is repeated until the
entire gene sequence has been obtained. Also, dnaN (encoding
.beta.) is located next to dnaA in bacteria and, therefore, dnaN
can be obtained by cloning DNA flanking the. dnaA gene by the
circular PCR procedure starting within dnaA. Once the gene is
obtained, it is cloned into an expression vector for protein
production.
[0240] (2) The following procedure was used to obtain the genes
encoding T.th a polymerase (dnaE gene). The DNA polymerase III can
be, purified directly from the organism of interest and amino acid
sequence of the subunit(s) obtained directly. In the case of T.th.,
T.th. cells were lysed and proteins were fractionated. An antibody
against E. coli .alpha. was used to probe column fractions by
Western analysis, which reacted with T.th. .alpha. The T.th.
.alpha. was transferred to a membrane, proteolyzed, and fragments
were sequenced. The sequence was used to design PCR primers for
amplification of an internal section of the dnaE gene. Remaining
flanking sequences are then obtained by circular PCR
[0241] (3) The following procedure can be used to identify
published nucleictide sequences which have not yet been identified
as to their function. This method was used to obtain T.th. .delta.
(holA) and .delta.' (holB), although they could presumably also
have been obtained via Methods 1 and 2 above. Discovery of T.th.
dnaE (.alpha.), dnaN (.beta.) and dnaX (.tau./.gamma.) indicates
that thermophiles use a class III type of DNA polymerase (.alpha.)
that utilize a clamp (.beta.) and must also use a clamp loader
since they have .tau./.gamma.. Also, the biochemical experiments in
the Examples infra show that the T.th. polymerase functions with
the T.th. .beta. clamp. Having demonstrated that a thermophile
(e.g., T.th.) does indeed utilize a class III type of polymerase
with a clamp and clamp loader, it can be assumed that they may have
.delta. and .delta.' subunits needed to form a complex with
.tau./.gamma. for functional clamp loading activity (i.e., as shown
in E. coli, .delta. and .delta.' bind either .tau. or .gamma. to
form .tau..delta..delta.' or .gamma..delta..delta.' complex, both
of which are functional clamp loaders). The .delta. subunit is not
very well conserved, but does give a match in the sequence
databases for A.ae., T.ma, and T.th. The T.th. database provided
limited information on the amino acid sequence of .delta. subunit,
although one can easily obtain the complete sequence of T.th. holA
by PCR and circular PCR as outlined above in Method 1. The A.ae.
and T.ma. databases are complete and, therefore, the entire holA
sequence from these genomes are identified. Neither database
recognized these sequences as _67 encoded by holA. The .delta.'
subunit (holB) is fairly well conserved. Again the incomplete T.th.
database provided limited .delta.' sequence, but as with .delta.,
it is a straight forward process for anyone experienced in the area
to obtain the rest of the holB sequence using PCR and circular PCR
as described in Method 1. Neither the A.ae. nor T.ma. databases
recognized holB encoding .delta.'. Nevertheless, holB was
identified as encoding .delta.' by searching the databases with
.delta.' sequence. In each case, the Thermatoga maritima and
Aquifex aeolicus holB gene and .delta.' sequence were obtained in
their entirety. Neither database had previously annotated holA or
holB encoding .delta. and .delta.'.
[0242] As stated above and in accordance with the present
invention, once nucleic acid molecules have been obtained, they may
be amplified according to any of the literature-described manual or
automated amplification methods. Such methods includes, but are not
limited to, PCR (U.S. Pat. No. 4,683,195 to Mullis et al. and U.S.
Pat. No. 4,683,202 to Mullis), Strand Displacement Amplification
(SDA) (U.S. Pat. No. 5,455,166 to Walker), and Nucleic Acid
Sequence-Based Amplification (NASBA) (U.S. Pat. No. 5,409,818 to
Davey et al.; EP 329,822 to Davey et al.). Most preferably, nucleic
acid molecules are amplified by the methods of the present
invention using PCR-based amplification techniques.
[0243] In the initial steps of each of these amplification methods,
the nucleic acid molecule to be amplified is contacted with a
composition comprising a DNA polymerase belonging to the
evolutionary "family A" class (e.g., Taq DNA pol I or E. coli pol
I) or the "family "B" class (e.g., Vent and Pfu DNA
polymerases--see Ito and Braithwaite, 1991). All of these DNA
polymerases are present as single subunits and are primarily
involved in DNA repair. In contrast, the DNA pol III-type enzymes
are multisubunit complexes that mainly function in the replication
of the chromosome, and the subunit containing the DNA polymerase
activity is in the "family C" class.
[0244] Thus, in amiplifying a nucleic acid molecule according to
the methods of the present invention, the nucleic acid molecule is
contacted with a composition comprising a thermostable DNA pol
III-type enzyme complex.
[0245] Once the nucleic acid molecule to be amplified is contacted
with the DNA pol III-type complex, the amplification reaction may
proceed according to standard protocols for each of the
above-described techniques. Since most of these techniques comprise
a high-temperature denaturation step, if a thermolabile DNA pol
III-type enzyme complex is used in nucleic acid amplification by
any of these techniques the enzyme would need to be added at the
start of each amplification cycle, since it would be
heat-inactivated at the denaturation step. However, a thermostable
DNA pol III-type complex used in these methods need only be added
once at the start of the amplification (as for Taq DNA polymerase
in traditional PCR amplifications), as its activity will be
unaffected by the high temperature of the denaturation step. It
should be noted, however, that because DNA pol III-type enzymes may
have a much more rapid rate of nucleotide incorporation than the
polymerases commonly used in these amplification techniques, the
cycle times may need to be adjusted to shorter intervals than would
be standard.
[0246] In an alternative preferred embodiment, the invention
provides methods of extending primers for several kilobases, a
reaction that is central to amplifying large nucleic acid
molecules, by a technique commonly referred to as "long chain PCR"
(Barnes, 1994; Cheng, 1994).
[0247] In such a method the target primed DNA can contain a single
strand stretch of DNA to be copied into the double strand form of
several or tens of kilobases. The reaction is performed in a
suitable buffer, preferably Tris, at a pH of between 5.5-9.5,
preferably 7.5. The reaction also contains MgCl.sub.2 in the range
1 mM to 10 mM, preferably 8 mM, and may contain a suitable salt
such as NaCl, KCl or sodium or potassium acetate. The reaction also
contains ATP in the range of 20 .mu.M to 1 mM, preferably 0.5 mM,
that is needed for the clamp loader to assemble the clamp onto the
primed template, and a sufficient concentration of deoxynucleoside
triphosphates in the range of 50 .mu.M to 0.5 mM, preferably 60
.mu.M for chain extension. The reaction contains a sliding clamp,
such as the .beta. subunit, in the range of 20 ng to 200 ng,
preferably 100 ng, for action as a clamp to stimulate the DNA
polymerase. The chain extension reaction contains a DNA polymerase
and a clamp loader, that could be added either separately or as a
single Pol III*--like particle, preferably as a Pol III* like
particle that contains the DNA polymerase and clamp loading
activities. The Pol III-type enzyme is added preferably at a
concentrations of about 0.0002-200 units per milliliter, about
0.002-100 units per milliliter, about 0.2-50 units per milliliter,
and most preferably about 2-50 units per milliliter. The reaction
is incubated at elevated temperature, preferably 60.degree. C. or
more, and could include other proteins to enhance activity such as
a single strand DNA binding protein.
[0248] In another preferred embodiment, the invention provides
methods of extending primers on linear templates in the absence of
the clamp loader. In this reaction, the primers are annealled to
the linear DNA, preferably at the ends such as in standard PCR
applications. The reaction is performed in a suitable buffer,
preferably Tris, at a pH of between 5.5-9.5, preferably 7.5. The
reaction also contains MgCl.sub.2 in the range of 1 mM to 10 mM,
preferably 8 mM; and may contain a suitable salt such as NaCl, KCl
or sodium or potassium acetate. The reaction also contains a
sufficient concentration of deoxynucleoside triphosphates in the
range of 50 .mu.M to 0.5 mM, preferably 60 .mu.M for chain
extension. The reaction contains a sliding clamp, such as the
.beta. subunit, in the range of 20 ng to 20 .mu.g, preferably about
2 .mu.g, for ability to slide on the end of the DNA and associate
with the polymerase for action as a clamp to stimulate the DNA
polymerase. The chain extension reaction also contains a Pol
III-type polymerase subunit such as .alpha., core, or a Pol
III*--like particle. The Pol III-type enzyme is added preferably at
a concentrations of about 0.0002-200 units per milliliter, about
0.002-100 units per milliliter, about 0.2-50 units per milliliter,
and most preferably about 2-50 units per milliliter. The reaction
is incubated at elevated temperature, preferably 60.degree. C. or
more, and could include other proteins to enhance activity such as
a single strand DNA binding protein.
[0249] The methods of the present invention thus will provide
high-fidelity amplified copies of a nucleic acid molecule in a more
rapid fashion than traditional amplification methods using the
repair-type enzymes.
[0250] These amplified nucleic acid molecules may then be
manipulated according to standard recombinant DNA techniques. For
example, a nucleic acid molecule amplified according to the present
methods may be inserted into a vector, which is preferably an
expression vector, to produce a recombinant vector comprising the
amplified nucleic acid molecule. This vector may then be inserted
into a host cell, where it may, for example, direct the host cell
to produce a recombinant polypeptide encoded by the amplified
nucleic acid molecule. Methods for inserting nucleic acid molecules
into vectors, and inserting these vectors into host cells, are
well-known to one of ordinary skill in the art (see, e.g.,
Maniatis, 1992).
[0251] Alternatively, the amplified nucleic acid molecules may be
directly inserted into a host cell, where it may be incorporated
into the host cell, genome or may exist as an extrachromosomal
nucleic acid molecule, thereby producing a recombinant host cell.
Methods for introduction of a nucleic acid molecule into a host
cell, including calcium phosphate transfection, DEAE-dextran
mediated transfection, cationic lipid-mediated transfection,
electroporation, transduction, infection or other methods, are
described in many standard laboratory manuals (see, e.g., Davis,
1986).
[0252] For each of the above techniques wherein an amplified
nucleic acid molecule is introduced into a host cell via a vector
or via direct introduction, preferred host cells include but are
not limited to a bacterial cell, a yeast cell, or an animal cell.
Bacterial host cells preferred in the present invention are E.
coli, Bacillus spp., Streptomyces spp., Erwinia spp., Klebsiella
spp. and Salmonella typhimurium. Preferred as a host cell is E.
coli, and particularly preferred are E. coli strains DH10B and
Stb12, which are available commercially (Life Technologies, Inc.
Gaithersburg, Md.). Preferred animal host cells are insect cells,
nematode cells and mammalian cells. Insect host cells preferred in
the present invention are Drosophila spp. cells, Spodoptera Sf9 and
Sf21 cells, and Trichoplusa High-Five cells, each of which is
available commercially (e.g., from Invitrogen; San Diego, Calif.).
Preferred nematode host cells are those derived from C. elegans,
and preferred mammalian host cells are those derived from rodents,
particularly rats, mice or hamsters, and primates, particularly
monkeys and humans. Particularly preferred as mammalian host cells
are CHO cells, COS cells and VERO cells.
[0253] By the present invention, nucleic acid molecules may be
sequenced according to any of the literature-described manual or
automated sequencing methods. Such methods include, but are not
limited to, dideoxy sequencing methods such as "Sanger sequencing"
(Sanger and Coulson, 1975; Sanger et al., 1977; U.S. Pat. No.
4,962,022 to Fleming et al.; and U.S. Pat. No. 5,498,523 to Tabor
et al.), as well as more complex PCR-based nucleic acid
fingerprinting techniques such as Random Amplified Polymorphic DNA
(RAPD) analysis (Williams et al., 1990). Arbitrarily Primed PCR
(AP-PCR) (Welsh and McClelland, 1990), DNA Amplification
Fingerprinting (DAF) (Caetano-Anolls, 1991), microsatellite PCR or
Directed Amplification of Minisatellite-region DNA (DAMD) (Heath et
al., 1993), and Amplification Fragment Length Polymorphism (AFLP)
analysis (EP 534,858 to Vos et al.; Vos et al., 1995; Lin and Kuo,
1995).
[0254] As described above for amplification methods, the nucleic
acid molecule to be sequenced by these methods is typically
contacted with a composition comprising a type A or type B DNA
polymerase. By contrast, in sequencing a nucleic acid molecule
according to the methods of the present invention, the nucleic acid
molecule is contacted with a composition comprising a thermostable
DNA pol III-type enzyme complex instead of necessarily using a DNA
polymerase of the family A or B classes. As for amplification
methods, the DNA pol III-type complexes used in the nucleic acid
sequencing methods of the present invention are preferably
substantially reduced in 3'-5' exonuclease activity; most
preferable for use in the present methods is a DNA polymerase
III-type complex which lacks the .epsilon. subunit. DNA pol
III-type complexes used for nucleic acid sequencing according to
the present methods are used at the same preferred concentration
ranges described above for long chain extension of primers.
[0255] Once the nucleic acid molecule to be sequenced is contacted
with the DNA pol III complex, the sequencing reactions may proceed
according to the protocols disclosed in the above-referenced
techniques.
[0256] As discussed above, the invention extends to kits for use in
nucleic acid amplification or sequencing utilizing DNA polymerase
III-type enzymes according to the present methods. A DNA
amplification kit according to the present invention may comprise a
carrier means, such as vials, tubes, bottles and the like. A first
such container means may contain a DNA polymerase III-type enzyme
complex, and a second such container means may contain a
deoxynucleoside triphosphate. The amplification kit encompassed by
this aspect of the present invention may further comprise
additional reagents and compounds necessary for carrying out
standard nucleic amplification protocols (See U.S. Pat. No.
4,683,195 to Mullis et al. and U.S. Pat. No. 4,683,202 to Mullis,
which are directed to methods of DNA amplification by PCR).
[0257] Similarly, a DNA sequencing kit according to the present
invention comprises a carrier means having in close confinement
therein two or more container means, such as vials, tubes, bottles
and the like. A first such container means may contain a DNA
polymerase III-type enzyme complex, and a second such container
means may contain a dideoxynucleoside triphosphate. The sequencing
kit may further comprise additional reagents and compounds
necessary for carrying out standard nucleic sequencing protocols,
such as pyrophosphatase, agarose or polyacrylamide media for
formulating sequencing gels, and other components necessary for
detection of sequenced nucleic acids (See U.S. Pat. No. 4,962,020
to Fleming et al. and U.S. Pat. No. 5,498,523 to Tabor et al.,
which are directed to methods of DNA sequencing).
[0258] The DNA polymerase III-type complex contained in the first
container means of the amplification and sequencing kits provided
by the invention is preferably a thermostable DNA polymerase
III-type enzyme complex and more preferably a DNA polymerase
III-type enzyme complex that is reduced in 3-5' exonuclease
activity. Naturally, the foregoing methods and kits are presented
as illustrative and not restrictive of the use and application of
the enzymes of the invention for DNA molecule amplification and
sequencing. Likewise, the applications of specific embodiments of
the enzymes, including conserved variants and active fragments
thereof are considered to be disclosed and included within the
scope of the invention.
[0259] As discussed earlier, individual subunits could be modified
to customize enzyme construction and corresponding use and
activity. For example, the region of .alpha. that interacts with
.beta. could be subcloned onto another DNA polymerase, thereby
causing .beta. to enhance the activity of the recombinant
polymerase. Alternatively, the .beta. clamp could be modified to
function with another protein or enzyme thereby enhancing its
activity or acting to localize its action to a particular targeted
DNA. Finally, the polymerase active site could be modified to
enhance its action, for example changing Tyrosine enabling more
equal site stoppage with the four ddNTPs (Tabor et al., 1995). This
represents a particular non-limiting illustration of the scope and
practice of the present invention with reference to the utility of
individual subunits hereof.
[0260] Accordingly and as stated above, the present invention also
relates to a recombinant DNA molecule or cloned gene, or a
degenerate variant thereof, which encodes any one or all of the
subunits of the DNA Polymerase III-type enzymes of the present
invention, or active fragments thereof. In the instance of the
.tau. subunit, a predicted molecular weight of about 58 kD and an
amino acid sequence set forth in SEQ ID Nos. 4 or 5 is
comprehended; preferably a nucleic acid molecule, in particular a
recombinant DNA molecule or cloned gene, encoding the 58 kD subunit
of the Polymerase III of the invention, that has a nucleotide
sequence or is complementary to a DNA sequence shown in FIGS. 4A
and 4B (SEQ ID No. 1), and the coding region for dnaX set forth in
FIG. 4C (SEQ ID No. 3). The .gamma. subunit is smaller, and is
approximately 50 kD, depending upon the extent of the frameshift
that occurs. More particularly, and as set forth in FIG. 4E (SEQ ID
No. 4), the .gamma. subunit defined by a -1 frameshift possesses a
molecular weight of 50.8 kD, while the .gamma. subunit defined by a
-2 frameshift, set forth in FIG. 4F (SEQ ID No. 5), possesses a
molecular weight of 49.8 kD.
[0261] As discussed above, the invention also extends to the genes
including holA, holB, dnaX, dnaQ, dnaE, and dnaN from thermophilic
eubacteria (i.e., T.th. and A.ae.) that have been isolated and/or
purified, to corresponding vectors for the genes, and particularly,
to the vectors disclosed herein, and to host cells including such
vectors. In this connection, probes have been prepared which
hybridize to the DNA polymerase III-type enzymes of the present
invention, and which are selected from the various oligonucleotide
probes or primers set forth in the present application. These
include, without limitation, the oligonucleotide defined in SEQ ID
No. 6 the oligonucleotide defined in SEQ ID No. 8 the
oligonucleotide defined in SEQ ID No. 10 the oligonucleotide
defined in SEQ ID No. 11 the oligonucleotide defined in SEQ ID No.
12 the oligonucleotide defined in SEQ ID No. 13 the oligonucleotide
defined in SEQ ID No. 14 the oligonucleotide defined in SEQ ID No.
15, and the oligonucleotide defined in SEQ ID No. 16.
[0262] The methods of the invention include a method for producing
a * recombinant thermostable DNA polymerase III-type enzyme from a
thermophilic bacterium, such as T.th., A.ae., Th.ma., or B. st.
which comprises culturing a host cell transformed with a vector of
the invention under conditions suitable for the expression of the
present DNA polymerase III. Another method includes a method for
isolating a target DNA fragment consisting essentially of a DNA
coding for a thermostable DNA polymerase III-type enzyme from a
thermophilic bacterium comprising the steps of:
[0263] (a) forming a genomic library from the bacterium;
[0264] (b) transforming or transfecting an appropriate host cell
with the library of step (a);
[0265] (c) contacting DNA from the transformed or transfected host
cell with a DNA probe which hybridizes to a DNA fragment selected
from the group consisting of the DNA fragments defined in SEQ ID
No. 6 and the DNA fragments defined in SEQ ID No. 8 or the
oligonucleotides set forth above; wherein hybridization is
conducted under the following conditions:
[0266] i) hybridization: 1% crystalline BSA (fraction V) (Sigma), 1
mM EDTA, 0.5 M NaHPO4 (pH 7.2), 7% SDS at 65.degree. C. for 12
hours and;
[0267] ii) wash: 5.times.20 minutes with wash buffer consisting of
0.5% BSA, fraction V), 1 mM Na2EDTA, 40 mM NaHP04 (pH 7.2), and 5%
SDS;.
[0268] (d) assaying the transformed or transfected cell of step (c)
which hybridizes to the DNA probe for DNA polymerase III-type
activity; and
[0269] (e) isolating a target DNA fragment which codes for the
thermostable DNA polymerase III-type enzyme.
[0270] Also, antibodies including both polyclonal and monoclonal
antibodies, and the DNA Polymerase III-like enzyme complex and/or
their .gamma. and .tau. subunits, .alpha. subunit(s), .delta.
subunit, .delta.' subunit, .beta. subunit, .epsilon. subunit may be
used in the preparation of the enzymes of the present invention as
well as other enzymes of similar thermophilic origin. For example,
the DNA Polymerase III-type complex or its subunits may be used to
produce both polyclonal and monoclonal antibodies to themselves in
a variety of cellular media, by known techniques such as the
hybridoma technique utilizing, for example, fused mouse spleen
lymphocytes and myeloma cells.
[0271] The general methodology for making monoclonal antibodies by
hybridomas is well known. Immortal, antibody-producing cell lines
can also be created by techniques other than fusion, such as
directtransformation of B lymphocytes with oncogenic DNA, or
transfection with Epstein-Barr virus. See, e.g., Schreier et al.,
1980; Hammerling et al., 1981; Kennett et al., 1980; see also: U.S.
Pat. No. 4,341,761 to Ganfield et al.; U.S. Pat. No. 4,399,121 to
Albarella et al.; U.S. Pat. No. 4,427,783 to Newman et al.; U.S.
Pat. No. 4,444,887 to Hoffman; U.S. Pat. No. 4,451,570 to Royston
et al.; U.S. Pat. No. 4,466,917 to Nussenzweig et al.; U.S. Pat.
No. 4,472,500 to Milstein et al.; U.S. Pat. No. 4,491,632 to Wands
et al.; and U.S. Pat. No. 4,493,890 to Morris.
[0272] Methods for producing polyclonal anti-polypeptide antibodies
are well-known in the art. See U.S. Pat. No. 4,493,795 to Nestor et
al. A monoclonal antibody, typically containing Fab and/or
F(ab').sub.2 portions of useful antibody molecules, can be prepared
using the hybridoma technology described in Antibodies--A
Laboratory Manual, Harlow and Lane, eds., Cold Spring Harbor
Laboratory, New York (1988), which is incorporated herein by
reference. Briefly, to form the hybridoma from which the monoclonal
antibody composition is produced, a myeloma or other
self-perpetuating cell line is fused with lymphocytes obtained from
the spleen of a mammal hyperimmunized with an elastin-binding
portion thereof.
[0273] A monoclonal antibody useful in practicing the present
invention can be produced by initiating a monoclonal hybridoma
culture comprising a nutrient medium containing a hybridoma that
secretes antibody molecules of the appropriate antigen specificity.
The culture is maintained under conditions and for a time period
sufficient for the hybridoma to secrete the antibody molecules into
the medium. The antibody-containing medium is then collected. The
antibody molecules can then be further isolated by well-known
techniques.
[0274] Media useful for the preparation of these compositions are
both well-known in the art and commercially available and include
synthetic culture media, inbred mice and the like. An exemplary
synthetic medium is Dulbecco's minimal essential medium (DMEM)
(Dulbecco et al., 1959) supplemented with 4.5 gm/1 glucose, 20 mm
glutamine, and 20% fetal calf serum. An exemplary inbred mouse
strain is the Balb/c.
[0275] Another feature of this invention is the expression of the
DNA sequences disclosed herein. As is well known in the art, DNA
sequences may be expressed by operatively linking them to an
expression control sequence in an appropriate expression vector and
employing that expression vector to transform an appropriate
unicellular host.
[0276] Such operative linking of a DNA sequence of this invention
to an expression control sequence, of course, includes, if not
already part of the DNA sequence, the provision of an initiation
codon, ATG, in the correct reading frame upstream of the DNA
sequence.
[0277] A wide variety of host/expression vector combinations may be
employed in expressing the DNA sequences of this invention. Useful
expression vectors, for example, may consist of segments of
chromosomal, non-chromosomal and synthetic DNA sequences. Suitable
vectors include derivatives of SV40 and known bacterial plasmids,
e.g., E. coli plasmids col El, pCR1, pBR322, pMB9 and their
derivatives, plasmids such as RP4; phage DNAS, e.g., the numerous
derivatives of phage .lambda., e.g., NM989, and other phage DNA,
e.g., M13 and filamentous single stranded phage DNA; yeast plasmids
such as the 2.mu. plasmid or derivativees thereof; vectors useful
in eukaryotic cells, such as vectors useful in insect or mammalian
cells; vectors derived from combinations of plasmids and phage
DNAs, such as plasmids that have been modified to employ phage DNA
or other expression control sequences, and the like.
[0278] Any of a wide variety of expression control
sequences--sequences that control the expression of a DNA sequence
operatively linked to it--may be used in these vectors to express
the DNA sequences of this invention. Such useful expression control
sequences include, for example, the early or late promoters of
SV40, CMV, vaccinia, polyoma or adenovirus, the lac system, the trp
system, the TAC system, the TRC system, the LTR system, the major
operator and promoter regions of phage .lambda., the control
regions of fd coat protein, the promoter for 3-phosphoglycerate
kinase or other glycolytic enzymes, the promoters of acid
phosphatase (e.g., Pho5), the promoters of the yeast .alpha.-mating
factors, and other sequences known to control the expression of
genes of prokaryotic or eukaryotic cells or their viruses, and
various combinations thereof.
[0279] A wide variety of unicellular host cells are also useful in
expressing the DNA sequences of this invention. These hosts may
include well known eukaryotic and prokaryotic hosts, such as
strains of E. coli, Pseudomonas, Bacillus, Streptomyces, fungi such
as yeasts, and animal cells, such as CHO, R1.1, B-W and L-M cells,
African Green Monkey kidney cells (e.g., COS 1, COS 7, BSC1, BSC40,
and BMT10 ), insect cells (e.g., Sf9), and human cells and plant
cells in tissue culture.
[0280] It will be understood that not all vectors, expression
control sequences and hosts will function equally well to express
the DNA sequences of this invention. Neither will all hosts
function equally well with the same expression system. However, one
skilled in the art will be able to select the proper vectors,
expression control sequences, and hosts without undue
experimentation to accomplish the desired expression without
departing from the scope of this invention. For example, in
selecting a vector, the host must be considered because the vector
must function in it. The vector's copy number, the ability to
control that copy number, and the expression of any other proteins
encoded by the vector, such as antibiotic markers, will also be
considered.
[0281] In selecting an expression control sequence, a variety of
factors will normally be considered. These include, for example,
the relative strength of the system, its controllability, and its
compatibility with the particular DNA sequence or gene to be
expressed, particularly with regard to potential secondary
structures. Suitable unicellular hosts will be selected by
consideration of, e.g., their compatibility with the chosen vector,
their secretion characteristics, their ability to fold proteins
correctly, and their fermentation requirements, as well as the
toxicity to the host of the product encoded by the DNA sequences to
be expressed, and the ease of purification of the expression
products.
[0282] Considering these and other factors a person skilled in the
art will be able to construct a variety of vector/expression
control sequence/host combinations that will express the DNA
sequences of this invention on fermentation or in large scale
animal culture.
[0283] It is further intended that analogs may be prepared from
nucleotide sequences of the protein complex/subunit derived within
the scope of the present invention. Analogs, such as fragments, may
be produced, for example, by pepsin digestion of bacterial
material. Other analogs, such as muteins, can be produced by
standard site-directed mutagenesis of dnaX, dnaE, dnaQ, dnaN, holA,
or holB coding sequences. Especially useful may be a mutation in
dnaE that provides the polymerase with the ability to incorporate
all four ddNTPs with equal efficiency thereby. producing an even
binding pattern in sequencing gels, as discussed above and with
reference to Tabor et al., 1995.
[0284] As mentioned above, a DNA sequence corresponding to dnX
dnaQ, holA,holB, dnaE, or dnaN, or encoding the subunits of the DNA
Polymerase III of the invention can be prepared synthetically
rather than cloned. The DNA sequence can be designed with the
appropriate codons for the amino acid sequence of the subunit(s) of
interest. In general, one will select preferred codons for the
intended host if the sequence will be used for expression. The
complete sequence is assembled from overlapping oligonucleotides
prepared by standard methods and assembled into a complete coding
sequence (Edge, 1981; Nambair et al., 1984; Jay et al., 1984).
[0285] Synthetic DNA sequences allow convenient construction of
genes which will express DNA Polymerase III analogs or "muteins".
Alternatively, DNA encoding muteins can be made by site-directed
mutagenesis of native dnaX, dnaQ, holA, holB, dnaE or dnaN genes or
their corresponding cDNAs, and muteins can be made directly using
conventional polypeptide synthesis.
[0286] A general method for site-specific, incorporation of
unnatural amino acids into proteins is described in Noren et al.,
1989. This method may be used to create analogs with unnatural
amino acids.
GENERAL DESCRIPTION OF THE INVENTION
[0287] As discussed above, the present invention has as one of its
characterizing features, that a Polymerase III-type enzyme as
defined hereinabove, has been discovered in a thermophile, that has
the structure and function of a chromosomal replicase. This
structure and function confers significant benefit when the enzyme
is employed in procedures such as PCR where speed and accuracy of
DNA reconstruction is crucial.
[0288] Chromosomal replicase are composed of several subunits in
all organisms (Kornberg and Baker, 1992). In keeping with the need
to replicate long chromosomes, replicases are rapid and highly
processive multiprotein machines. All cellular replicases examined
to date derive their processivity from one subunit that is shaped
like a ring and completely encircles DNA (Kuriyan and O'Donnell,
1993; Kelman and O'Donnell, 1994). This "sliding clamp" subunit
acts as a mobile tether for the polymrerase machine (Stukenberg, et
al., 1991). The sliding clamp does not assemble onto the DNA by
itself, but requires a complex of several proteins, called a "clamp
loader" which couples ATP hydrolysis to the assembly of sliding
clamps onto DNA (O'Donnell et al., 1992). Hence, Pol III-type
cellular replicases are comprised of three components: a, clamp, a
clamp loader, and the DNA polymerase.
[0289] An overall goal is to identify and isolate all of the genes
encoding the replicase subunits from a thermophile for expression
and purification in large quantity. Following this, the replication
apparatus can be reassembled from individual subunit components for
use in kits, PCR, sequencing and diagnostic applications (Onrust et
al., 1995).
[0290] As a beginning to identify and characterize the replicase of
a thermophile, we started by looking for a homologue to the
prokaryotic dnaX gene which encode subunits (.gamma. and .tau.) of
the replicase. The dnaX gene has another homologue, holB, which
encodes yet another subunit (.delta.') of the replicase. The amino
acid sequence of .delta.' (encoded by holA) and .tau./.gamma.
subunits (encoded by dnaX) are particularly highly conserved in
evolution from prokaryotes to eukaryotes (Chen et al., 1992;
O'Donnell et al., 1993; Onrust et al., 1993; Carter et al., 1993;
Cullman et al., 1995);.
[0291] One organism chosen for study and exposition herein is the
exemplary extreme thermophile Thermus thermophilus (T.th.). It is
understood that other members of the class such as the eubacterium
Thermatoga are expected to be analogous in both structure and
function. Thus, the investigation of T.th. proceeded and initially,
a T.th. homologue of dnaX was identified. The gene encodes a full
length protein of 529 amino acids. The amino terminal third of the
sequence shares over 50% homology to dnaX genes as divergent as E.
coli (gram negative) and B. subtilis (gram positive). The T.th.
dnaX gene contains a DNA sequence that provides a translational
frameshift signal for production of two proteins from the same
gene. Such frameshifting has been documented only in the case of E.
coli (Tsuchihashi and Kornberg, 1990; Flower and McHenry, 1990;
Blinkowa and Walker, 1990). No frameshifting has been documented to
occur in the dnaX homologues (RFC subunit genes) of yeast and
humans (Eukaryotic kingdom).
[0292] The presence of a dnaX gene that produces two subunits
implies that T.th. has a clamp loader (.gamma.) and may be
organized by .tau. into a PolIII*-type replicase like the
replicative DNA polymerase of Escherichia coli, DNA polymerase III
holoenzyme. The E. coli DNA p6 lymerase III holoenzyme-contains 10
different subunits, some in copies of two or more for a total
composition of 18 polypeptide chains (Komberg and Baker, 1992;
Onrust et al., 1995). The holoenzyme is composed of three major
activities: the 3-subunit DNA polymerase core
(.alpha..epsilon..theta.), the .beta. subunit DNA sliding clamp,
and the 5-subunit .gamma. complex clamp loader
(.gamma..delta..delta.'.chi..psi.). This 3 component strategy
generalizes to eukaryotes which utilize a clamp (PCNA) and a
5-subunit RFC clamp loader (RFC) which provide processivity to DNA
polyrnerase .delta. (reviewed in Kelman and O'Donnell, 1994).
[0293] In E. coli, the polymerase and clamp loader components are
organized into one PolIII* particle by the .tau. subunit, that acts
as a "glue" protein (Onrust et al., 1995). One dimer of .tau. holds
together two core polymerases in the particle which are utilized
for the coordinated and simultaneous replication of both strands of
duplex DNA (McHenry, 1982; Maki et al., 1988; Yuzhakov et al.,
1996). The "glue" protein .tau. subunit also binds one clamp loader
(called .gamma. complex) thereby acting as a scaffold for a large
superstructure assembly called DNA polymerase III*. The gene
encoding .tau., called dnaX, also encodes the .gamma. subunit of
DNA polymerase III. The .beta. subunit then associates with Pol
III* to form the DNA polymerase III holoenzyme. The .gamma. subunit
is approximately 2/3 the length of .tau.. .gamma. shares the
N-terminus of .tau., but is truncated by a translational
frameshifting mechanism that, after the shift, encounters a stop
codon within two amino acids (Tsuchihashi and Kornberg, 1990;
Flower and McHenry, 1990; Blinkowa and Walker, 1990). Hence,
.gamma. is the N-terminal 453 amino acids of .tau., but contains
one unique residue at the C-terminus (the penultimate codon encodes
a Lys residue which is the same sequence as if the frameshift did
not take place). This frameshift is highly efficient and occurs
approximately 50% of the time.
[0294] The sequence of the .gamma. and .tau. subunits encoded by
the dnaX gene are homologous to the clamp loading subunits in all
other organisms extending from gram negative bacteria through gram
positive bacteria, the Archeae Kingdom and the Eukaryotic Kingdom
from yeast to humans (O'Donnell et al., 1993). All of these
organisms utilize a three component replicase (DNA polymerase,.
clamp and clamp loader) and in these cases the 3 components appear
to behave as independent units in solution rather than forming a
large holoenzyme superstructure. For example, in eukaryotes from
yeast to humans, the clamp loader is the five subunit RFC, the
clamp is PCNA, and the polymerases .delta. and .epsilon. are all
stimulated by the PCNA clamp assembled onto primed DNA by RFC
(reviewed in Kelman and O'Donnell 1994).
[0295] The discovery of a dnaX gene in T.th. provided confidence
that thermophilicbacteria would contain a three component Pol
III-type enzyme. Hence, we proceeded to identify the dnaQ and dnaN
genes encoding, respectively, the proofreading 3'-5' exonuclease,
and the .beta. DNA sliding clamp subunits of a Pol III-type enzyme.
Following this, we purified from extracts of T.th. cells, a Pol
III-type enzyme. This enzyme preparation had the unique property of
extending a single primer around a long 7.2 kb single strand DNA
genome of M13mp18 bacteriophage. Such a primer extension assay
serves as a tool to detect and identify the Pol III-type of enzyme
in cell extracts. The enzyme was confirmed to be a Pol III-type
enzyme based on its reactivity with antibody directed against the
E. coli .alpha. subunit (the DNA polymerase subunit) and antibody
directed against E. coli .gamma. subunit. Proteins corresponding to
.alpha., .tau., .gamma., .delta. and .delta.' were easily visible
and lend themselves to identification of the genes through use of
peptide microsequencing followed by primer design for PCR
amplification. For example, from this DNA pol III-type preparation,
the peptide sequence of the .alpha. subunit was obtained, which
then allowed the dnaE gene encoding the .alpha. subunit (DNA
polymerase) of the Pol III-type enzyme to be obtain.
[0296] These methods should be widely applicable to other
thermophilic bacteria. Additional antibody reagents against other
Pol III-type enzyme components, such as RFC subunits, DNA
polymerase delta, epsilon or beta, and the PCNA clamp from known
organisms can be made quite easily as polyclonal or monoclonal
antibody preparations using as antigen either naturally purified
sequence, recombinant sequence, or synthetic peptide sequence.
Examples of known sequences of these Pol III-type enzymes are to be
found in: DNA polymerases (Braithwaite and Ito, 1993), RFC clamp
loaders (Cullman et al., 1995) and PCNA (Kelman and O'Donnell,
1995).
[0297] The remaining genes of T.th. Pol III needed for efficient
extension of primed templates, holA and holB, are now identified.
The holA coding sequence (SEQ. ID. No. 157) encodes the .delta.
subunit (SEQ. ID. No. 158) and the holB coding sequence (SEQ. ID.
No. 155) encodes the .delta.' subunit (SEQ. ID. No. 156). The holA
and holB coding sequences and the .delta. and .delta.' subunits
were identified via BLAST search (Altschul et al., 1997), and
subsequently isolated following circular PCR. These genes will
provide the subunit preparations through use of standard
recombinant techniques and protein purification protocols. The
protein subunits can then be used to reconstitute the enzyme
complexes as they exist in the cell. This type of reconstitution of
Pol III has been demonstrated using the protein subunits of DNA
polymerase III holoenzyme from E. coli to assemble the entire
particle. See, e.g., U.S. Pat. Nos. 5,583,026 and 5,668,004 to
O'Donnell; and Onrust et al., 1995. The disclosures of these
references are incorporated herein in their entireties.
[0298] Another organism chosen for study and exposition herein is
the extreme thermophile Aquifex aeolicus. Thus, the present
invention also relates to various isolated DNA molecules from
Aquifex aeolicus, in particular the DNA molecules encoding various
replication proteins. These include dnaE, dnAx, dnaN, holA, holB,
ssb DNA molecules from A. aeolicus. These DNA moleculescan be
inserted into an expression system or used to transform host cells
from which isolated proteins can be obtained. The isolated proteins
encoded by these DNA molecules are also disclosed.
[0299] Unless otherwise indicated below, the Aquifex aeolicus
sequences were obtained by sequence comparisons using the Thermus
thermophilus counterparts as query against the genome of Aquifex
aeolicus (Deckert et al., 1998).
[0300] The A. aeolicus dnaE gene has a nucleotide coding sequence
according to SEQ. ID. No. 117 and encodes the .alpha. subunit of
the of DNA Polymerase III, which has an amino acid sequence
according to SEQ. ID. No. 118. The A.ae. .alpha. subunit has
approximately 41% aa identity to the T.th. .alpha. subunit.
[0301] The A. aeolicus dnaX gene has a nucleotide coding sequence
according to SEQ. ID. No. 119 and encodes the .tau. subunit of the
of DNA Polymerase III, which has an amino acid sequence according
to SEQ. ID. No. 120. The A.ae. .tau. subunit has approximately 51%
aa identity to the T.th. .tau. subunit.
[0302] The A. aeolicus dnaN gene has a nucleotide coding sequence
according to SEQ. ID. No. 121 and encodes the .beta. subunit of DNA
Polymerase III, which has an amino acid sequence according to SEQ.
ID. No. 122. The A.ae. .beta. subunit has approximately 27% aa
identity to the T.th. .beta. subunit.
[0303] The A. aeolicus dnaQ gene has a nucleotide coding sequence
according to SEQ. ID. No. 127 and encodes the .epsilon. subunit of
the of DNA Polymerase III, which has an amino acid sequence
according to SEQ. ID. No. 128. The A.ae. .epsilon. subunit has
approximately 26% aa identity to the T.th. .epsilon. subunit.
[0304] The A. aeolicus ssb gene has a nucleotide coding sequence
according to SEQ. ID. No. 129 and encodes the SSB protein, which
has an amino acid sequence according to SEQ. ID. No. 130. The A.ae
SSB protein has approximately 22% aa identity to the T.th. SSB
protein.
[0305] Further, the coding sequences of A. aeolicus genes encoding
the helicase (dnaB), helicase loader (dnaC), and primase (dnaG) are
also disclosed. The A. aeolicus dnaB gene has a nucleotide coding
sequence according to SEQ. ID. No. 131 and encodes the DnaB
protein, which functions as a helicase and has an amino acid
sequence according to SEQ. ID. No. 132. The A. aeolicus dnaG gene
has a nucleotide coding sequence according to SEQ. ID. No. 133 and
encodes the DnaG protein, which functions as a primase and has an
amino acid sequence according to SEQ. ID. No. 134. The A. aeolicus
dnaC gene has a nucleotide coding sequence according to SEQ. ID.
No. 135 and encodes the DnaC protein, which functions as a helicase
loader and has an amino acid sequence according to SEQ. ID. No.
136.
[0306] The A. aeolicus holA and holB genes were previously
unidentified by Deckert et al., 1998. Using Thermus thermophilus
.delta.' subunit amino acid sequence and the Thermatoga maritima
.delta. subunit amino acid sequence (SEQ. ID. No. 146 which itself
was obtained using the T.th. .delta. subunit amino acid sequence of
SEQ. ID. No. 158) in separate BLAST searches (Altschul et al.,
1997), corresponding polypeptide products in Aquifex aeolicus were
identified. The A. aeolicus holA gene has a nucleotide coding
sequence according to SEQ. ID. No. 123 and encodes the .delta.
subunit of the of DNA Polymerase III, which has an amino acid
sequence according to SEQ. ID. No. 124. The A.ae. .delta. subunit
has approximately 21% aa identity to the T.m. .delta. subunit. The
A. aeolicus holB gene has a nucleotide coding sequence according to
SEQ. ID. No. 125 and encodes the .delta.' subunit of the of DNA
Polymerase III, which has an amino acid sequence according to SEQ.
ID. No. 126. The A.ae. .delta.' subunit has approximately 24% aa
identity to the T.th. .delta.' subunit.
[0307] This invention also clones at least the coding regions of a
set of A. aeolicus genes which encode proteins that assemble into
an A. aeolicus DNA polymerase III replication enzyme. These genes
(dnaE, dnaN, dnaX, dnaQ, holA, holB, ssb) were cloned into
expression vectors, the proteins were expressed in E. coli, and the
corresponding protein subunits were purified (alpha, beta, tau,
delta, delta prime, SSB). This invention identifies the major
protein-protein contacts among these subunits, shows how these
proteins can be assembled into higher order multiprotein complexes,
and how to form a rapid and processive DNA polymerase III
holoenzyme.
[0308] In contrast to the E. coli and T. thermophilus dnaX genes
which encode both .tau. and .gamma. subunits, the A. aeolicus dnaX
gene produces only the full length .tau. subunit when expressed in
E. coli. The A. aeolicus .tau. is intermediate in length between
the .gamma. and .tau. subunits of E. coli DNA polymerase III
holoenzyzne. The E. coli .tau. binds .alpha., the .gamma. subunit
does not bind .alpha.. Due to the intermediate size of A. aeolicus
.tau., it was not known whether the A. aeolicus .tau. would bind
the .alpha. subunit. This invention shows that indeed, the A.
aeolicus .tau. binds to .alpha., as well as .delta. and .delta.',
thereby forming an A. aeolicus .alpha..tau..delta..delta.' complex.
Until the identification of the .delta. and .delta.' subunits by
the present invention, their existence, let alone their interaction
with .tau. and .alpha., was not even known.
[0309] The A. aeolicus .alpha..tau..delta..delta.'/.beta. Pol III
can be applied in several useful DNA handling techniques. For
example, the thermophilic Pol III will be useful in DNA sequencing,
especially at high temperature. Also, use of a thermal resistant
rapid and processive Pol III is an important improvement to
polymerase chain reaction technology. The ability of the A.
aeolicus Pol III to extend primers for multiple kilobases makes
possible the amplification of very long segments of DNA (long chain
PCR).
[0310] Another organism chosen for study and exposition herein is
the extreme thermophile Thermotoga maritima. Thus, the present
invention also relates to various isolated DNA molecules from
Thermotoga maritima, in particular the DNA molecules encoding
various replication proteins. These include dnaE, dnaX, dnaN, dnaQ,
holA, holB, ssb DNA molecules from Thermotoga maritima. These DNA
molecules can be inserted into an expression system or used to
transform host cells from which isolated proteins can be obtained.
The isolated proteins encoded by these DNA molecules are also
disclosed.
[0311] Unless otherwise indicated below, the Thermotoga maritima
sequences were obtained by sequence comparisons using the Thermus
thermophilus counterparts as query against the genome of Thermotoga
maritima (Nelson et al., 1999).
[0312] The T. maritima dnaE gene has a nucleotide coding sequence
according to SEQ. ID. No. 137 and encodes the .alpha. subunit of
the of DNA Polymerase III, which has an amino acid sequence
according to SEQ. ID. No. 138. The T.m. .alpha. subunit has
approximately 33% aa identity to the T.th. .alpha. subunit.
[0313] The T. maritima dnaQ gene has a nucleotide coding sequence
according to SEQ. ID. No. 139 and encodes the .epsilon. subunit of
the of DNA Polymerase III, which has an amino acid sequence
according to SEQ. ID. No. 140. The T.m. .epsilon. subunit has
approximately 34% aa identity to the T.th. .epsilon. subunit.
[0314] The T. maritima dnaX gene has a nucleotide coding sequence
according to SEQ. ID. No. 141 and encodes the .tau. subunit of the
of DNA Polymerase III, which has an amino acid sequence according
to SEQ. ID. No. 142. The T.m. .tau. subunit has approximately 48%
aa identity to the T.th. .tau. subunit.
[0315] The T. maritima dnaN gene has a nucleotide coding sequence
according to SEQ. ID. No. 143 and encodes the .beta. subunit of DNA
Polymerase III, which has an amino acid sequence according to SEQ.
ID. No. 144. The T.m. .beta. subunit has approximately 28% aa
identity to the T.th. .beta. subunit.
[0316] The T. maritima ssb gene has a nucleotide coding sequence
according to SEQ. ID. No. 149 and encodes the SSB protein, which
has an amino acid sequence according to SEQ. ID. No. 150. The T.m.
SSB protein has approximately 18% aa identity to the T.th. SSB
protein.
[0317] Further, the coding sequences of T. maritima genes encoding
the helicase (dnaB) and primase (dnaG) are also disclosed. The T.
maritima dnaB gene has a nucleotide coding sequence according to
SEQ. ID. No. 151 and encodes the DnaB protein, which functions as a
helicase and has an amino acid sequence according to SEQ. ID. No.
152. The T. maritima dnaG gene has a nucleotide coding sequence
according to SEQ. ID. No. 153 and encodes the DnaG protein, which
functions as a primase and has an amino acid sequence according to
SEQ. ID. No. 154.
[0318] The T. maritima holA and holB genes were previously
unidentified by Nelson et al., 1999). Using the Thermus
thermophilus .delta. and .delta.' subunit amino acid sequences
(SEQ. ID. Nos. 158 and 156, respectively) in separate BLAST
searches (Altschul et al., 1997), corresponding polypeptide
products in T. maritima were identified. The T. maritima holA gene
has a nucleotide coding sequence according to SEQ. ID. No. 145 and
encodes the .delta. subunit of the of DNA Polymerase III, which has
an amino acid sequence according to SEQ. ID. No. 146. The T.m.
.delta. subunit has approximately 37% aa identity to the T.th.
.delta. subunit. The T.m. holB gene has a nucleotide coding
sequence according to SEQ. ID. No. 147 and encodes the .delta.'
subunit which has an amino acid sequence according to SEQ. ID. No.
148. The T.m. .delta.' subunit has approximately 25% aa identity to
the T.th. .delta.' subunit.
[0319] Yet another organism chosen for study and exposition herein
is the extreme thermophile Bacillus stearothermophilus. Thus, the
present invention also relates to various isolated DNA molecules
from Bacillus stearothermophilus, in particular the DNA molecules
encoding various replication proteins. These include dnaE, dnaX,
dnaN, dnaQ, holA, holB, ssb DNA molecules from Bacillus
stearothermophilus. These DNA molecules can be inserted into an
expression system or used to transform host cells from which
isolated proteins can be obtained. The isolated proteins encoded by
these DNA molecules are also disclosed.
[0320] Unless otherwise indicated below, the Bacillus
stearothermophilus sequences were obtained by searching the
database of this organism (at http://www.genome.ou.edu);
[0321] The B. stearothermophilus polC gene has a nucleotide coding
sequence according to SEQ. ID. No. 183 and encodes the PolC or
.alpha.-large subunit of the DNA Polymerase III, which has an amino
acid sequence according to SEQ. ID. No. 184. The B.st. PolC
subunit, like the PolC subunits of other Gram positive organisms,
contains both polymerase and 3'-5' exonuclease activity. This
subunit, therefore, is essentially a fusion of .alpha. and
.epsilon..
[0322] The B. stearothermophilus dnaX gene has a partial nucleotide
coding sequence according to SEQ. ID. No. 181 and encodes the .tau.
subunit of the of DNA Polyrmerase III, which has a partial amino
acid sequence according to SEQ. ID. No. 182. The B.st. .tau.
subunit has approximately 31% aa identity to the T.th. .tau.
subunit.
[0323] The B. stearothermophilus dnaN gene has a partial nucleotide
coding sequence according to SEQ. ID. No. 173 and encodes the
.beta. subunit of DNA Polymerase III, which has a partial amino
acid sequence according to SEQ. ID. No. 174. The B.st. .beta.
subunit has approximately 21% aa identity to the T.th. .beta.
subunit.
[0324] The B. stearothermophilus ssb gene has a nucleotide coding
sequence according to SEQ. ID. No.175 and encodes the SSB protein,
which has an amino acid sequence according to SEQ. ID. No. 176. The
B.st. SSB protein has approximately 23% aa identity to the T.th.
SSB protein.
[0325] The B. stearothermophilus holA gene has a nucleotide coding
sequence according to SEQ. ID. No. 177 and encodes the .delta.
subunit of DNA Polymerase III, which has an amino acid sequence
according to SEQ. ID. No. 178. The B.st. .delta. subunit has
approximately 26% aa identity to the T.th. .delta. subunit.
[0326] The B. stearothermophilus holB gene has a nucleotide coding
sequence according to SEQ. ID. No. 179 and encodes the .delta.'
subunit of DNA Polymerase III, which has an amino acid sequence
according to SEQ. ID. No. 180. The B.st. .delta.' subunit has
approximately 25% aa identity to the T.th. .delta.' subunit.
[0327] By conducting BLAST searches of unidentified genomic DNA
from other thermophiiic eubacteria, it is possible to identify
coding regions which encode various functional subunits of other
Pol III replicative machinery.
[0328] Although it is generally appreciated that proteins isolated
from a thermophiie should retain activity at high temperature,
there is no guarantee that they will retain temperature resistance
when isolated in pure form. This invention shows that the A.
aeolicus Pol III, like the T. thermophilus Pol III, is resistant to
high temperature. It is expected that the Th. maritima and B.
stearothermophilus Pol III enzymes will similalry be resistant to
high temperature.
[0329] The following experiments illustrate the identification and
characterization of the enzymes and constructs of the present
invention. Accordingly, in Examples 1-8 below, the identification
and expression of the .gamma. and .tau. is presented, as the first
step in the elucidation of the Thermus thermophilus Polymerase III
reflective of the present invention. Examples 9-12 which follow set
forth the protocol for the purification of the remainder of the
sub-units of the enzyme that represent substantial entirety of the
functional replicative machinery of the enzyme. Examples 18-30
demonstrate the preparation of isolated A. aeolicus sequences Pol
III subunits and their thermostable use.
EXAMPLE 1
Experimental Procedures
[0330] Materials
[0331] DNA modification enzymes were from New England Biolabs.
Labelled nucleotides were from Amersham, and unlabeled nucleotides
were from New England Biolabs The Alter-1 vector was from Promega.
pET plasmids and E. coli strains, BL21 (DE3) and BL21 (DE3)pLysS
were from Novagen. Oligonucleotides were from Operon. Buffer A is
20 mM Tris-HCl (pH 7.5), 0.1 mM EDTA, 5 mMDTT, and 10%
glycerol.
[0332] Genomic DNA
[0333] Thermus thermophilus (strain HB8) was obtained from the
American Type Tissue Collection. Genomic DNA was prepared from
cells grown in 0.1 l of Thermnus medium N697 (ATCC: 4 g yeast
extract, 8.0 g polypeptone (BBL 11910), 2.0 g NaCl, 30.0 g agar,
1.0 L distilled water) at 75.degree. C. overnight. Cells were
collected by centrifugation at 4.degree. C. and the cell pellet was
resuspended in 25 ml of 100 mM Tris-HCl (pH 8.0), 0.05 M EDTA, 2
mg/ml lysozyme and incubated at room temperature for 10 min. Then
25 ml 0.10 M EDTA (pH 8.0), 6% SDS was added and mixed followed by
60 ml of phenol. The mixture was shaken for 40 min. followed by
centrifugation at 10,000.times.G for 10 min. at room temperature.
The upper phase (50 ml) was removed and mixed with 50 ml of
phenol:chloroform (50:50 v/v) for 30 min. followed by
centrifugation for 10 min. at room temperature. The upper phase was
decanted and the DNA was precipitated upon addition of {fraction
(1/10)}th volume 3 M sodium acetate (pH 6.5) and 1 volume ethanol.
The precipitate was collected by centrifugation and washed twice
with 2 ml of 80% ethanol, dried and resuspended in 1 ml T.E. buffer
(10 mM Tris Hcl (pH 7.5), 1 mM EDTA).
[0334] Cloning of dnaX
[0335] DNA oligonucleotides for amplification of T.th. genomic DNA
were as follows. The upstream 32mer
(5'-CGCAAGCTTCACGCSTACCTSTTCTCCGGSAC 3', S indicating a mixture of
G and C) (SEQ. ID. No. 6) consists of a Hind III site within the
first 9 nucleotides (underlined) followed by codons (SEQ. ID. No.
29) encoding the following amino acid sequence (HAYLFSGT) (SEQ. ID.
No. 7). The downstream 34 mer
(5'-CGCGAATTCGTGCTCSGGSGGCTCCTCSAGSGTC-- 3') (SEQ. ID. No. 8)
consists of an EcoRI site (underlined) followed by codons (SEQ. ID.
No. 30) encoding the sequence KTLEEPPEH (SEQ. ID. No. 9) on the
complementary strand. The amplification reactions contained 10 ng
T.th. genomic DNA, 0.5 mM of each primer, in a volume of 100 .mu.l
of Vent polymerase reaction mixture according to the manufacturers
instructions (10 .mu.l ThermoPol Buffer, 0.5 mM each dNTP and 0.5
mM MgSO.sub.4). Amplification was performed using the following
cycling scheme: 5 cycles of: 30sec. at 95.5.degree. C., 30 sec. at
40.degree. C., 2 min. at 72.degree. C.; 5 cycles of: 30 sec. at
95.5.degree. C., 30 sec. at 45.degree. C., and 2 min. at 72.degree.
C.; and 30 cycles of: 30 sec. at 95.5.degree. C., 30 sec. at
50.degree. C., and 30 sec. at 72.degree. C. Products were
visualized in a 1.5% native agarose gel.
[0336] Genomic DNA was digested with either XhoI, XbaI, StuI, PstI,
NcoI, MluI, KpnI, HindIII, EcoRI, EagI, BglI, or BamHI, followed by
Southern analysis in a native agarose gel (Maniatis et al., 1982).
Approximately 0.5 .mu.g of digest was analyzed in each lane of a
0.8% native agarose gel followed by transfer to an MSI filter
(Micron Separations Inc.). The transfer included the following
steps:
[0337] 1. The agarose gel was soaked in 500 ml of 1% HCl with
gentle shaking for 10 min.
[0338] 2. Then the gel was soaked in 500 ml of 0.5 M NaOH+1.5 M
NaCl for 40 min.
[0339] 3. After that the gel was soaked in 500 ml of 1M ammonium
acetate for 1 h.
[0340] 4. The DNA was transferred to the MSI filter with the use of
blotting paper for 4 h.
[0341] 5. The filter was kept at 80.degree. C. for 15 min. in the
oven.
[0342] 6. The pre-hybridization step was run in 10 ml of
Hybridization solution (1% crystalline BSA (fractionV) (Sigma), 1
mM EDTA, 0.5 M NaHPO4 (pH 7.2), 7% SDS) at 65.degree. C. for 30
min.
[0343] 7. The probe, radiolabelled by the random priming method
(see below), was added to the pre-hybridization solution and kept
at 65.degree. C. for 12 h.
[0344] 8. The filter was washed with low stringency with 200 ml of
the wash buffer (0.5% BSA, fractionV), 1 mM Na2EDTA, 40 mM NaHPO4
(pH 7.2), 5% SDS with gentle shaking for 20 min. This step was
repeated 5 times, followed by exposure to X-ray film (XAR-5,
Kodak).
[0345] As a probe, the PCR product was radiolabelled by random as
follows.
[0346] 1. 14 ml of the mixture containing 0.2 .mu.g of PCR product
DNA, 1 .mu.g ofthe pd(N6) (Promega) and 2.5 ml of the 10.times.
Klenow reaction buffer (100 mM Tris-HCl (pH 7.5), 50 mM MgCl.sub.2,
75 mM dithiothreitol) were boiled for 10 min. and then kept at
4.degree. C.
[0347] 2. The reaction volumne was increased up to 25 .mu.l,
containing in addition 33 .mu.M of each dNTP, except dATP, 10
.mu.Ci [.alpha.-.sup.32P] dATP (800 Ci/mM), and 2 units of Klenow
enzyme. The reaction mixture was incubated 1.5 h.
[0348] 3. 2 mg of sonicated herring sperm DNA (GibcoBRL) was added
to the reaction and the volume was increased to 2 ml using
hybridization solution. The sample was then boiled for 10 min.
[0349] A genomic library of XbaI digested DNA was prepared upon
treating 1 .mu.g genomic T.th. DNA with 10 units of XbaI in 100
.mu.l of NEBuffer N2 (50 mM NaCl, 10 mM Tris-HCl (pH 7.9), 10 mM
MgCl2, 1 mM DTT) for 2 h at 37.degree. C. The digested DNA was
purified by phenol chloroform extraction and ethanol precipitation.
The Alter-1 vector (0.5 .mu.g)(Promega) was digested with 1 unit of
XbaI in NEBuffer N2 and then purified by phenol/chloroform
extraction and ethanol precipitation. One microgram of genomic
digest was incubated with 0.05 .mu.g of digested Alter-1 and 20 U
of T4 ligase in 30 .mu.l of ligase buffer (50 mM Tris-HCl (pH 7.8),
10 mM MgCl2, 10 mM DTT and 1 mM ATP) at 15.degree. C. for 12 h. The
ligation reaction was transformed into the DH5.alpha. strain of E.
coli and transformants were plated on LB plates contaiining
ampicillin and screened for the dnaX insert using the radiolabelled
PCR probe as follows:
[0350] 1. The colonies tested were lifted onto MSI filters,
approximately 100 colonies to each filter.
[0351] 2. The filters, removed from the LB/Tc plates, were placed
side up on a sheet of Whatman 3 MM paper soaked with 0.5 M NaOH for
5 min.
[0352] 3. The filters were transferred to a sheet of paper soaked
with 1 M. Tris-HCl (pH 7.5) for 5 min.
[0353] 4. The filters were placed on a sheet of paper soaked in 0.5
M Tris-HCl (pH 7.5), 1.25 M NaCl for 5 min.
[0354] 5. After drying by air, the filters were heated in the oven
80.degree. C. for 15 min. and then were analyzed by Southern
hybridization.
[0355] Plasmid DNA was prepared from 20 positive colonies; of these
6 contained the expected 4 kb insert when digested with XbaI.
Sequencing of the insert was performed by the Sanger method using
the Vent polymerase sequencing kit according to the manufacturers
instructions (New England Biolabs).
[0356] Identification of the dnaX Gene
[0357] The dnaX genes of the gram negative E. coli and the gram
positive B. subtilis share more than 50% identity in amino acid
sequence within the N-terminal 180 residues containing the
ATP-binding domain (FIG. 2). Two highly conserved regions (shown in
bold in FIG. 2) were used to design oligonucleotide primers for
application of the polymerase chain reaction to T.th. genomic DNA.
The expected PCR product, including the restriction sites (i.e.
before cutting) is 345 nucleotides. Use of these primers with
genomic T.th. DNA resulted in a product of the expected size. The
PCR product was then radiolabelled and used to probe genomic DNA in
a Southern analysis (FIG. 3). Genomic DNA was digested with several
different restriction endonucleases, electrophoresed in a native
agarose gel and then probed with the PCR fragment. The Southern
analysis showed an XbaI fragment of approximately 4 kb, more than
sufficient length to encode the dnaX gene. Other restriction
nucleases produced fragments thatwere significantly longer, or
produced two or more fragments indicating presence of a site within
the coding sequence of dnaX.
[0358] To obtain full length dnaX, genomic DNA was digested with
XbaI and ligated into XbaI digested Alter-1 vector. Ligated DNA was
transformed into DH5 alpha cells, and colonies were screened with
the labeled PCR probe. Plasmid DNA was prepared from 20 positive
colonies and analyzed for the appropriate sized insert using XbaI.
Six of the twenty clones contained the expected 4 kb XbaI fragment
as an insert, the sequence of which is shown in FIGS. 4A and
4B.
[0359] The Frameshift Site
[0360] The dnaX gene of E. coli produces two proteins, the .gamma.
and .tau. subunits, by a -1 frameshift (Tsuchihashi and Kornberg,
1990; Flower and McHenry, 1990; Blinkowa and Walker, 1990). The
full length product yields .tau., and the frameshift results in
addition of one amino acid before encountering a stop codon to
produce .gamma.. The -1 frameshift site in the E. coli dnaX gene
contains the sequence, A AAA AAG, which follows the X XXY YYZ rule
found in retroviral genes (Jacks et al., 1988). This "slippery
sequence" preserves the initial two residues of the tRNAs in the
aminoacyl and peptidyl sites both before and after the frameshift.
Mutagenesis of the E. coli dnaX frameshifting site has shown that
the first three residues can be, nucleotides other than A, but that
A's in the second set of three nucleotides is important to
frameshifting (Tsuchihashi and Brown, 1992).
[0361] Immediately downstream of the stop codon is a potential
stem-loop, structure which enhances frameshifting, presumably by
causing the fibosome to pause. Further, the AAG codon lacks a
cognate tRNA in E. coli and thus the G residue may facilitate the
pause, and has been shown to aid the vigorous frameshifting
observed in the E. coli dnaX gene (Tsuchihashi and Brown, 1992). A
fourth component of frameshifting in the E. coli dnaX gene is
presence of an upstream Shine-Dalgarno sequence which is thought to
pair with the 16S rRNA to increase the frequency of frameshifting
still further (Larsen. et al., 1994).
[0362] Examination of the T.th. dnaX sequence reveals a single site
that fulfills the X XXY YYZ rule in which positions 4-7 are A
residues. The site is unique from that in E. coli as all seven
residues are A, and the heptanucleotide sequence is flanked by
another A residue on each side (i.e. A9). Surprisingly, the stop
codon immediately downstream of this site is in the -2 frame,
although there is a stop codon in the -1 frame 28 nucleotides
downstream of the -2 stop codon. Indeed, a -2 frameshift would
fulfill the requirement that the first two nucleotides of each
codon in the peptidyl and aminoacyl sites be conserved during
either a -1 or a -2 frameshift. As with the case of E. coli dnaX,
there are secondary structure step loop structures immediately
downstream. Finally, there is a Shine-Dalgarno sequence immediately
adjacent to the frameshift site, as well as another Shine-Dalgarno
sequence 22 inucleotides upstream of the frameshift site.
[0363] Assuming the first stop codon is utilized (i.e. -2
frameshift), the predicted size of the .gamma. subunit in T.th. is
454 amino acids for a mass of 49.8 kDa, over 2 kDa larger than the
431 residue .gamma. subunit (47.5 kDa) of E. coli. This would
result in 2 residues after the -2 frameshift (i.e. after the
GluLysLys, the residues LysAla would be added) to be compared to
the result of the -1 frameshift in E. coli which also results in 2
residues (LysGlu). In the event that a -1 frameshift were utilized
in the T.th. dnaX gene, then an additional 12 residues would be
added following the frameshift for a molecular mass of 50.8 kDa
(i.e. after the GluLysLys, the residues
LysProAspProLysAlaPiroProGlyProThrSer would be added at aa 453-464
of SEQ. ID. No. 4). As explained later, this nucleotide sequence
was found to promote both -1 and -2 frameshifing in E. coli (FIG.
8). But first, we examined T th. cells by Western analysis for the
presence of two subunits homologous to E. coli .gamma. and
.tau..
EXAMPLE 2
[0364] Frameshifting Analysis of the T.th. dnaX Gene
[0365] Frameshifting was analyzed by inserting the frameshift site
into lacZ in the three different reading frames, followed by
plating on X-gal and scoring for blue or white colony formation
(Weiss et al., 1987). The frameshifting region within T.th dnaX was
subcloned into the EcoRI/BamHI sites of pUC19. These sites are
within the polylinker inside of the .beta.-galactosidase gene.
Three constructs were produced such that the insert was either in
frame with the downstream coding sequence of .beta.-galactosidase,
or were out of frame (either -1 or -2). An additional three
constructs were designed by mutating the frameshift sequence and
then placing this insert into the three reading frames of the
.beta.-galactosidase gene. These six plasmids were constructed as
described below.
[0366] The upstream primer for the shifty sequences was 5'-gcg cgg
atc cgg agg gag aaa aaa aaa gcc tca gcc ca-3' (SEQ. ID. No. 10).
The BamHI site for cloning into pUC is underlined. Also, the stop
codon, tga, has been mutated to tca (also underlined). The upstream
primer for the mutant shifty sequence was: 5'-gcg cgg atc cgg agg
gag aga aga aaa gcc tca gcc ca-3' (SEQ. ID. No. 11). The mutant
sequence contains two substitutions of a G for an A residue in the
polyA stretch (underlined). Three downstream primers were utilized
with each upstream primer to create two sets of three inserts in
the 0 frame, -1 frame and -2 frame. The sequence of these primers,
and the length of insert (after cutting with EcoRI and BanHI, and
inserting into pUC19) are as follows: 5'-gaa tta aat tcg cgc ttc
ggg agg tgg g-3' (0 frameshift, total 58 nucleotide insert) (SEQ.
ID. No. 12); 5'-gcg cga att cgc gct tcg gga ggt ggg-3' (-1 frame,
54mer insert) (SEQ. ID. No. 13); and 5'-gcg cga att cgg gcg ctt cag
gag gtg gg-3' (-2 frame, 56mer insert) (SEQ. ID. No. 14). The
downstream primers have an EcoRI site (underlined); the EcoRI site
of the 0 frame insert was blunt ended to produce the greater length
insert (converting the EcoRI site to an aattaatt sequence). Also,
the tcg sequence, which produces the tga stop codon (underlined)
was mutated to tca in the -2 downstream primer so that readthrough
would be allowed after the frameshift occurred.
[0367] In summary, a region surrounding the frameshift site and
ending at least 5 nutcleotides past the -1 frarneshift stop codon
was inserted into the .beta.-galactosidase gene of pUC19 in the
three different reading frames (stop codons were mutated to prevent
stoppage following a frameshift). These three plasmids were
introduced into E. coli and plated with X-gal. The results, in FIG.
8, show that blue colonies were observed after 24 h incubation with
all three plasmids and therefore both -1 and -2 frameshifting had
occurred.
[0368] To further these results, two .gamma. residues were
introduced into the polyA tract which should disrupt the ability of
this sequence to direct frameshifts. The mutated slippery sequence
was inserted into pUC19 followed by transformation into E. coli and
plating on X-gal. The results showed that both -1 and -2
frameshifting was prevented, further supporting the fact that
frameshifting requires the polyA tract as expected (FIG. 8).
EXAMPLE 3
[0369] Expression Vector for T.th. .gamma. and .tau.
[0370] The dnaX gene was cloned into the pET16 expression vector in
the steps shown in FIG. 9. First, the bulk of the gene was cloned
into pET16 by removing the PmlI/XbaI fragment from pAlterdnaX, and
placing it into SmaI/XbaI digested Puc19 to yield Puc19dnaXCterm.
The N-terminal sequence of the dnaX gene was then reconstructed to
position an NdeI site at the N-terminus. This was performed by
amplifying the 5' region encoding the N-terminal section of
.gamma./.tau. using an upstream primer containing an NdeI site that
hybridizes to the dnaX gene at the initiating gtg codon (i.e. to
encode Met where the Met is created by the PCR primer, and the Val
is the initiating gtg start codon of dnaX). The primer sequence for
this 5' end was: 5'-gtggtgcatatg gtg agc gcc ctc tac cgc c-3' (SEQ.
ID. No. 15) (where the NdeI site is underlined, and the coding
sequence of dnaX follows). The downstreamn primer hybridizes past
the Pmll site at nucleotide positions 987-1004 downstream of the
initiating gtg (primer sequence: 5'-gtggtggtcgac cca gga ggg cca
cct cca g-3' (SEQ. ID. No. 16) where the initial 12 nucleotides
contain a SalGI restriction site, followed by the sequence from the
region downstream the stop codon). The 1.1 kb. nucleotide PCR
product was digested with PmlI/NdeI and the PmlI/NdeI fragment was
ligated into NdeI/PmlI digested Puc19dnaXCterm to form Puc19dnaX.
The Puc19dnaX plasmid was then digested with NdeI and SalI and the
1.9 kb fragment containing the dnaX gene was purified using the
Sephaglas BandPrep Kit (Pharmacia-LKB). pET16b was digested with
NdeI and XhoI. Then the full length dnaX gene was ligated into the
digested pET16b to form pETdnaX.
EXAMPLE 4
[0371] Expression of T.th. .gamma. and .tau.
[0372] As discussed in the previous example, the dnaX gene was
engineered into the T7 based IPTG inducible pET16 vector such that
the initiation codon was placed precisely following the Met residue
N-terminal leader sequence (FIG. 9). This should produce a protein
containing the entire sequence of .gamma. and .tau., along with a
21 residue leader containing 10 contiguous His residues
(tagged-.tau.=60.6 kDa; tagged-.gamma.=52.4 kDa for -2 frameshift).
The pETdnaX plasmid was introduced into BL21(DE3)pLysS cells
harboring the gene encoding T7. RNA polymerase under control of the
lac repressor. Log phase cells were induced with IPTG and analyzed
before anid after induction in an. SDS polyacrylamide gel (FIG. 10,
lanes 1 and 2). The result shows that upon induction, two new
proteins are expressed with the approximate sizes expected of the
T.th. .gamma. and .tau. subunits (larger than E. coli .gamma., and
smaller than E. coli .tau.). The two proteins are produced in
nearly equal amounts, similar to the case of the E. coli .gamma.
and .tau. subunits. Western analysis using antibodies against the
E. coli .gamma. and .tau. subunits cross-reacted with the induced
proteins further supporting their identity as T.th. .gamma. and
.tau. (data not shown, but repeated with the pure subunits shown in
FIG. 10, lane 6).
EXAMPLE 5
[0373] Purification of T.th. .gamma. and .tau.
[0374] The His-tagged T.th. .gamma. and .tau. proteins were
purified from 6 L of induced E. coli cells containing the pETdnaX
plasmid. Cells were lysed, clarified from cell debris by
centrifugation and the supernatant was applied to a HiTrap chelate
affinity column. Elution of the chelate affinity column yielded
approximately 35 mg of protein in which the two predominant bands
migrated in a region consistent with the molecular weight predicted
from the dnaX gene (FIG. 10, lane 3), and produced a positive
signal by Western analysis using polyclonal antibody directed
against the E. coli .gamma. and .tau. subunits. (lane 4). The
.gamma. and .tau. subunits are present in nearly equal amounts
consistent with the nearly equal expression of these proteins in E.
coli cells harboring the pETdnaX plasmid.
[0375] The .gamma. and .tau. subunits were further purified by gel
filtration on a Superose 12 column (FIG. 10, lane 4; FIG. 11).
Recovery of T.th. .gamma. and .tau. subunits through gel filtration
was 81%. The E. coli .gamma. and .tau. subunits, when separated
from one another, elute during gel filtration as tetramers. A
mixture of E. coli .gamma./.tau. results in a mixed tetramer of
.gamma.2.tau.2 along with .gamma.4 and .tau.4 tetramers (Onrust et
al., 1995). The mixture of T.th. .gamma./.tau. elutes ahead of the
150 kDa marker, and thus is consistent with the expected mass of a
.gamma.2.tau.2 tetramer (225 kDa) and .gamma.4 and .tau.4
tetramers.
[0376] As described earlier, the dnaX frameshifting sequence could
produce either a -1 or -2 framehift to yield a His-tagged .gamma.
subunit of mass either 53.3 kDa or 52.4 kDa, respectively. The
difference in these two possible products is too close to determine
from migration in SDS gels. It also remains possible that two
.gamma. products are present and do not resolve under the
conditions used. The exact protocol for this purification is
described below.
[0377] Six liters of BL21(DE3)pLysSpETdnaX cells were grown in LB
media containing 50 .mu.g/ml ampicillin and 25 .mu.g/ml
chloramphenicol at 37.degree. C. to an O.D. of 0.8 and then IPTG
was added to a concentration of 2 mM. After a further 2 h at
37.degree. C., cells were harvested by centrifugation and stored at
-70.degree. C. The following steps were performed at 4.degree. C.
Cells (15 g wet weight) were thawed and resuspended in 45 ml
1.times. binding buffer (5 mM imidizole, 0.5 M NaCl, 20 mM Tris HCl
(final pH 7.5)) using a dounce homogenizer to complete cell lysis
and 450 ml of 5% polyamine P (Sigma) was added. Cell debris was
removed by centrifugation at 18,000 rpm for 30 min. in a Sorvall
SS24 rotor at 4.degree. C. The supernatant (Fraction I, 40 ml, 376
mg protein) was applied to a 5 ml HiTrap Chelating Separose column
(Pharmacia-LKB). The column was washed with 25 ml of binding
buffer, then with 30 ml of binding buffer containing 60 mM
imidizole, and then eluted with 30 ml of 0.5 M iimidizole, 0.5 M
NaCl, 20 mM Tris-HCl (pH 7.5). Fractions of 1 ml were collected and
analyzed on an 8% Coomassie Blue stained SDS polyacrylamide gel.
Fractions containing subunits migrating at the T.th .gamma. and
.tau. positions, and exhibiting cross reactivity with antibody to
E. coli .gamma. and .tau. in a Western analysis, were pooled and
dialyzed against buffer A (20 mM Tris-HCl (pH 7.5), 0.1 mM EDTA, 5
mM DTT and 10% glycerol) containing 0.5 M NaCl (Fraction II, 36 mg
in 7 ml). Fraction II was diluted 2-fold with buffer A and passed
through a 2 ml ATP agarose column equilibrated in buffer A
containing 0.2 M NaCl to remove any E. coli .gamma. complex
contaminant. Then 0.18 mg (300 ml) Fraction II was gel filtered on
a 24 ml Superose 12 column (Pharmacia-LKB) in buffer A containing
0.5 M NaCl. After the first 216 drops, fractions of 200 .mu.l were
collected (Fraction III) and analyzed by Western analysis (by
procedures similar to those described in Example 6), by ATPase
assays and by Coomassie Blue staining of an 8% Coomassie Blue
stained SDS polyacrylamide gel. The Coomassie stained gels and
Western analysis of recombinant T.th. gamma and tau for these
purification steps are summarized in FIG. 10.
EXAMPLE 6
[0378] Western Analysis of T.th. Cells for Presence of .gamma. and
.tau. Subunits
[0379] Polyclonal antibody to E. coli .gamma./.tau.-E. coli .gamma.
subunit was prepared as described (Studwell-Vaughan and O'Donnell,
1991). Pure .gamma. subunit (100 .mu.g) was brought up in Freund's
adjuvant and injected subcutaneously into a New Zealand Rabbit
(Poccono Rabbit Farms). After two weeks, a booster consisting of 50
.mu.g .gamma. in Freund's adjuvant was administered, followed after
two weeks by a third injection (50 .mu.g).
[0380] The homology between the amino terminal regions of T.th. and
E. coli .gamma./.tau. subunits suggested that there may be some
epitopes in common between them. Hence, polyclonal antibody
directed against the E. coli .gamma./.tau. subunits was raised in
rabbits for use in probing T.th. cells by Western analysis. FIG. 7
shows the results of a Western analysis of whole T.th. cells lysed
in SDS. The results show that in T.th. cells, the antibody is
rather specific for two high molecular proteins which migrate in
the vicinity of the molecular masses of E. coli .gamma. and .tau.
subunits.
[0381] Procedure for Western Analysis
[0382] Samples were. analyzedin duplicate 10% SDS polyacrylamide
gels by the Western method (Towbin et al. 1979). One gel was
Coomassie stained to evaluate the pattern of proteins present, and
the other gel was then electroblotted onto a nitrocellulose
membrane (Schleicher and Schuell). For molecular size markers, the
kaliedoscope molecular weight markers (Bio-Rad) were used to verify
by visualization that transfer of proteins onto the blotted
membrane had occurred. The gel used in electroblotting was also
stained after electroblotting to confirm that efficient transfer of
protein had occured. Membranes were blocked using 5% non-fat milk,
washed with 0.05% Tween in TBS (TBS-T) and then incubated for over
1 h with a 1/5000 dilution of rabbit polyclonal antibody directed
against E. coli .gamma. and .tau. in 1% gelatin in TBS-T at room
temperature. Membranes were washed using TBS-T buffer and then
antibody was detected on X-ray film (Kodak) by using the ECL kit
from (Amersham) and the manufactures reccommended procedures.
[0383] Samples included: 1) a mixture of E. coli .gamma. (15 ng)
and .tau. (15 ng) subunits; 2) T.th. whole cells (100 .mu.l)
suspended in cracking buffer; and 3) purified T.th. .gamma. and
.tau. fraction II (0.6 .mu.g as a mixture).
EXAMPLE 7
[0384] Characterizabtion of the ATPase Activitv of
.gamma./.tau.
[0385] The E. coli .tau. subunit is a DNA dependent ATPase (Lee and
Walker, 1987; Tsuchihashi and Komberg, 1989). The .gamma. subunit
binds ATP but does not hydrolyze it even in the presence of DNA
unless other subunits of the DNA polymerase III holoenzyme are also
present (Onrust et al., 1991). Next we examined the T.th.
.gamma./.tau. subunits for DNA dependent ATPase. activity. The
.gamma./.tau. preparation was, in fact, a DNA stimulated ATPase
(FIG. 11, top panel). The specific activity of the T.th.
.gamma./.tau. was 11.5 mol ATP hydrolyzed/mol .gamma./.tau. (as
monomer and assuming an equal mixture of the two). Furthermore,
analysis of the gel filtration column fractions shows that the
ATPase activity coelutes with the T.th. .gamma./.tau. subunits,
supporting evidence that the weak ATPase activity is intrinsic to
the .gamma./.tau. subunits (FIG. 11). The specific activity of the
.gamma./.tau. preparation before gel filtration was the same as
after gel filtration (within 10%), further indicating that the DNA
stimulated ATPase is an inherent activity of the .gamma./.tau.
subunits. Presumably, only the .tau. subunit contains ATPase
activity, as in the case of E. coli. Assuming only T.th. .tau.
contains ATPase activity, its specific activity is twice the
observed rate (after factoring out the weight of .gamma.). This
rate is still only one-fifth that of E. coli .tau..
[0386] The T.th. .gamma./.tau. ATPase activity is lower at
37.degree. C. than at 65.degree. C. (middle panel), consistent with
the expectedbehavior of protein activity from a thernophilic
source. However, there is no apparent increase in activity in
proceeding from 50.degree. C. to 65.degree. C. (the rapid breakdown
of ATP above. 65.degree. C. precluded measurement of ATPase
activity at temperatures above 65.degree. C.). In contrast, the E.
coli .tau. subunit lost most of its ATPase activity upon elevating
the temperature to 50.degree. C. (middle panel). These reactions
contain no stabilizers such as a nonionic detergent or gelatin, nor
did they include substrates such as ATP, DNA or magnesium.
[0387] Last, the relative stability of T.th. .gamma./.tau. and E.
coli .gamma./.tau. to addition of NaCl (FIG. 12, bottom panel) was
examined. Whereas the E. coli .tau. subunit rapidly lost activity
at even 0.2 M NaCl, the T.th. .gamma./.tau. retained full activity
in 1.0 M NaCl and was still 80% active in 1.5 M NaCl. The detailed
procedure for the ATPase activity assay is described below.
[0388] ATPase Assays
[0389] ATPase assays were performed in 20 .mu.l of 20 mM Tris-HCl
(pH 7.5), 8 mM MgCl2 containing 0.72 .mu.g of M13mp18 ssDNA (where
indicated), 100 mM [.gamma.-.sup.32P]-ATP (specific activity of
2000-4000 cpm/pmol), and the indicated protein. Some reactions
contained additional NaCl where indicated. Reactions were incubated
at the temperatures indicated in the figure legends for 30 min. and
then were quenched with an equal volume of 25 mM EDTA (final). The
aliquots were analyzed by spotting them (1 .mu.l each) onto thin
layer chromatography (TLC) sheets coated with Cel-300
polyethyleneimine (Brinkmann Instruments Co.). TLC sheets were
developed in 0.5 M lithium chloride, 1 M formic acid. An
autoradiogram of the TLC chromatogram was used to visualize Pi at
the solvent front and ATP near the origin which were then cut from
the TLC sheet and quantitated by liquid scintillation. The extent
of ATP hydrolyzed was used to calculate the mol of Pi released per
mol of protein per min. One mol of E. coli .tau. was calculated
assuming a mass of 71 kDa per monomer. The T.th. .gamma. and .tau.
preparation was treated as an equal mixture and thus one mole of
protein as monomer was the average of the predicted masses of the
.gamma. and .tau. subunits (54 kDa).
EXAMPLE 8
[0390] Homolog of T.th. .gamma./.tau. to dnaX Gene Products of
Other Organism
[0391] The XbaI insert encoded an open reading frame, starting with
a GTG. codon, of 529 amino acids in length (58.0 kDa), closer to
the predicted length of the B. subtilis .tau. subunit (563 amino
acids, 62.7 kDa mass)(Alonso et al., 1990) than the E. coli .tau.
subunit (71.1 kDa)(Yin et al., 1986). The dnaX gene encoding the
.gamma./.tau. subunits of E. coli DNA polymerase III holoenzyme is
homologous to the holB gene encoding the .delta.' subunit of the
.gamma. complex clamp: loader, and this homology extends to all 5
subunits of the eukaryotic RFC clamp loader as well as the
bacteriophage gene protein 44 of the gp44/62 clamp loading complex
(O'Donnell et al., 1993). These gene products show greatest
homology over the N-terminal 166 amino acid residues (of E. coli
dnaX); the C-terminal regions are more divergent. FIG. 4 shows an
alignment of the amino acid sequence of the N-terminal regions of
the T.th. dnaX gene product to those of several other bacteria. The
consensus GXXGXGKT (SEQ. ID. No. 17) motif for nucleotide binding
is conserved in all these protein products. Further, the E. coli
.delta.' crystal structure reveals one atom of zinc coordinated to
four Cys residues (Guenther, 1996). These four Cys residues are
conserved in the E. coli dnaX gene, and the .gamma. and .tau.
subunits encoded by E. coli dnaX bind one atom of zinc. These Cys
residues are also conserved in T.th. dnaX (shown in FIG. 4).
Overall, the level of amino acid identity relative to E. coli dnaX
in the N-termninal 165 residues of T.th. dnaX is 53%. The T.th.
dnaX gene is just as homologous to the B. subtilis dnaX (53%
identity) gene relative to E. coli dnaX. After this region of
homology, the C-terminal region of T.th. dnaX shares 26% and 20%
identity to E. coli and B. subtilis dnaX, respectively. A proline
rich region, downstream of the conserved region, is also present in
T.th. dnaX (residues 346-375), but not in the B. subtilis dnaX (see
FIGS. 3A and 3B). The overall identity between E. coli dnaX and
T.th. dnaX over the entire gene is 34%. Identity of T.th. dnaX to
B. subtilis dnaX over the entire gene is 28%.
[0392] Comparison of dnaX Genes from T.th. and E. coli
[0393] The above identifies a homologue of the dnaX gene of E. coli
in Thermus thermophilus. Like the E. coli gene, T.th. dnaX encodes
two related proteins through use of a highly efficient
translational frameshift. The T.th. .gamma./.tau. subunits are
tetramers, or mixed tetramers, similar to the .gamma. and .tau.
subunits of E. coli. Further, the .gamma./.tau. subunit is a DNA
stimulated ATPase like its E. coli counterpart. As expected for
proteins from a thermophile, the T.th. .gamma./.tau. ATPase
activity is thermostabile and resistant to added salt.
[0394] In E. coli, .gamma. is a component of the clamp loader, and
the .tau. subunit serves the function of holding the clamp loading
apparatus together with two DNA polymerases for coordinated
replication of duplex DNA. The presence of .gamma. in T.th.
suggests it has a clamp loading apparatus and thus a clamp as well.
The presence of the .tau. subunit of T.th. implies that T.th.
contains a replicative polymerase with a structure similar to that
of E. coli DNA polymerase III holoenzyme.
[0395] A significant difference between E. coli and T.th. dnaX
genes is in the translational frameshift sequence. In E. coli, the
heptamer frameshift site contains six A residues followed by a G
residue in the context A AAA AAG. This sequence satisfies the X XXY
YYZ rule for -1 frameshifting. The frameshift is made more
efficient by the absence of the AAG tRNA for Lys which presumably
leads to stalling of the ribosome at the frameshift site and
increases the efficiency of frameshifting (Tsuchihashi and Brown,
1992). Two additional aids to frameshifting include a downstream
hairpin and an upstream Shine-Dalgarno sequence (Tsuchihashi and
Kornberg, 1990; Larsen et al., 1994). The -1 frameshift leads to
incorporation of one unique residue at the C-terminus of E. coli
.gamma. before encounter with a stop codon.
[0396] In T.th., the dnaX frameshifting heptamner is A AAA AAA, and
it is flanked by two other A residues, one on each side. There is
also a downstream region of secondary structure. The nearest
downstream stop codon is positioned such that gamma would contain
only one unique amino acid, as in E. coli. However, the T.th. stop
codon is in the -2 reading frame thus requires a -2 frameshift. No
precedent exists in nature for -2 frameshifting, although -2
frameshifting has been shown to occur in test cases (Weiss et al.,
1987). In vivo analysis of the T.th. frameshift sequence shows that
this natural sequence promotes both -1 and -2 frameshifting in E.
coli. Whereas the -2 frameshift results in only one unique
C-terminal residue a -1 frameshift would result in anextension of
12 C-terminal residues. At present, the results do not discriminate
which path occurs in T.th., a -1 or -2 frameshift, or a combination
of the two.
[0397] There are two Shine-Dalgarno sequences just upstream of the
frameshift site in T.th. dnaX. In two cases of frameshifting in E.
coli, an upstream Shine-Dalgarno sequence has been shown to
stimulate frameshifting (reviewed in Weiss et al., 1897). In
release factor 2 (RF2), the Shine-Dalgarno is 3 nucleotides
upstream of the shift site, and it stimulates a +1 frameshift
event. In the case. of E. coli dnaX; a Shine-Dalgarno sequence 10
nucleotides upstream of the shift sequence stimulates the -1
frameshift. One of the T.th. dnaX Shine-Dalgarno sequences is
immediately adjacent to the frameshift sequence with no extra
space, the other is 22 residues upstream of the frameshift site.
Which of these Shine-Dalgarno sequences plays a role in T.th. dnaX
frameshifting, if any, will require future study.
[0398] In E. coli, efficient separation of the two polypeptides,
.gamma. and .tau., is achieved by mutation of the frameshift site
such that only one polypeptide is produced from the gene
(Tsuchihashi and Komberg, 1990). Substitution of G-to-A in two
positions of the heptamer of T.th. dnaX eliminates frameshifting
and thus should be a source to obtain .tau. subunit free of
.gamma.. To produce pure .gamma. subunit free of .tau., the
frameshifting site and sequence imunediately downstream of it can
be substituted for an in-frame sequence with a stop codon.
[0399] Examination of the B. subtilis dnaX gene shows no frameshift
sequence that satisfies the X XXY YYZ rule. Hence, it would appear
that dnaX does not make two proteins in this gram positive
organism.
[0400] Rapid thermal motions associated, with high temperature may
make coordination of complicated processes more difficult. It seems
possible that organizing the components of the replication
apparatus may become yet more important at higher temperature.
Hence, production of a .tau. subunit that could be used to
crosslink two poly erases and a clamp loader into one organized
particle may be most useful at elevated temperature.
[0401] As stated above, the following examples describe the
continued isolation and purification of the substantial entirety of
the Polymerase III from the extreme thermophile Thermus
thermophilus. It is to be understood that the following exposition
is reflective of the protocol and characteristics, both
morphological and functional, of the Polymerase III-type enzymes
that are the focus of the present invention, and that the invention
is hereby illustrated and comprehends the entire class of enzymes
of thermophilic origin.
EXAMPLE 9
[0402] Purification of the Thermus thermophilus DNA polymerase
III
[0403] All steps in the purification assay were performed at
4.degree. C. The following assay was used in the purification of
DNA polymerase from T.th. cell extracts. Assays contained 2.5 mg
activated calf thymus DNA (Sigma Chemical Company) in a final
volume of 25 ml of 20 mM Tris-Cl (pH 7.5), 8 mM MgCl.sub.2, 5 mM
DTT, 0.5 mM EDTA, 40 mg/ml BSA, 4% glycerol, 0.5 mM ATP, 3 mM each
dCTP, dGTP, dATP, and 20 mM [.alpha.-.sup.32P]dTTP. An aliquot of
the fraction to be assayed was added to the assay mixture on ice
followed by incubation at 60.degree. C. for 5 min. DNA synthesis
was quantitated using DE81 paper followed by washing off
unincorporated nucleotide. Incorporated nucleotide was determined
by scintillation counting of the filters.
[0404] Thermus thermophilus cell extracts were prepared by
suspending 35 grams of cell paste in 200 ml of 50 mM TRIS-HCl,
pH=7.5, 30 mM spermidine, 100 mM NaCl, 0.5 mM EDTA, 5 mM DTT, 5%
glycerol, followed by disruption by passage through a French
pressure cell (15,000 PSI). Cell debris was removed by
centrifugation (12,000 RPM, 60 min). DNA polymerase III in the
clarified supernatant was precipitated by treatment with ammonium
sulphate (0.226 gm/liter) and recovered by centrifugation. This
fraction was then backwashed with the same buffer (but lacking
spermidine) containing 0.20 gm/l ammonium sulfate. The pellet was
then resuspended in buffer A and dialyzed overnight against 2
liters of buffer A; a precipitate which formed during dialysis was
removed by centrifugation (17,000 RPM, 20 min).
[0405] The clarified dialysis supernatant, containing approximately
336 mg of protein, was applied onto a 60 ml heparin agarose column
equilibrated in buffer A which was washed with the same buffer
until A280 reached baseline. The column was developed with a 500 ml
linear gradient of buffer A from 0 to 500 mM NaCl. More tightly
adhered proteins were washed off the column by treatment with
buffer A (20 mM Tris Hcl, pH=7.5, 0.1 mM EDTA, 5mM DTT, and 10%
glycerol) and 1M NaCl. Some DNA polymerase activity flowed through
the column. Two peaks (HEP.P1 and HEP.P2) of DNA polymerase
activity eluted from the heparin agarose column containing 20 mg
and 2 mg of total protein respectively (FIG. 13A). These were kept
separate throughout the remainder of the purification protocol.
[0406] The Pol III resided in HEP.P1 as indicated by the following
criteria: 1) Western analysis using antibody directed against the a
subunit of E. coli Pol III indicated presence of Pol III in HEP.P
1; 2). Only the HEP.P1 fraction was capable of extending a single
primer around an M13mp18 7.2 kb ssDNA circle (explained later in
Example 16), such long primer extension being a characteristic of
Pol III type enzymes; and 3) Only the HEP.P1 provided DNA
polymerase activity that was retained on an ATP-agarose affinity
column, which is indicative of a Pol III-type DNA polymerase since
the .gamma. and .tau. subunits are ATP interactive proteins.
[0407] The first peak of the heparin agarose column (HEP.P1: 20 mg
in 127.5 ml) was dialyzed against buffer A and applied onto a 2 ml
N6-linkage ATP agarose column pre-equilibrated in the same buffer.
Bound protein was eluted by a slow (0.05 ml/min) wash with buffer
A+2M NaCl and collected into 200 .mu.l fractions. Chromatography of
peak HEP.P1 yielded a flow-through (HEP.P1-ATP-FT) and a bound
fraction (HEP.P1-ATP-Bound) (FIG. 13B). Binding of peak HEP.P2 to
the ATP column could not be detected, though DNA polymerase
activity was recovered in the flow-through.
[0408] The HEP.P1-ATP-Bound fractions from the ATP agarose
chromatographic step were further purified by anion exchange over
monoQ. The HEP.P1-ATP-Bound fractions were diluted with buffer A to
approximately the conductivity of buffer A plus 25 mM NaCl and
applied to a 1 ml monoQ column equilibrated in Buffer A. DNA
polymerase activity eluted in the flow-through and in two resolved
chromatographic peaks (MONOQ peak1 and peak2) (FIG. 13C). Peak 2
was by far the major source of DNA polymerase activity. Western
analysis using rabbit antibody directed against the E. coli a
subunit confirmed presence of the a subunit in the second peak (see
the Western analysis in FIG. 14B). Antibody against the E. coli
.tau. subunit also confirmed the presence of the .tau. subunit in
the second peak. Some reaction against .alpha. and .tau. was also
present in the minor peak (first peak). The Coomassie Blue SDS
polyacrylamide gel of the MonoQ fractions (FIG. 14A) showed a band
that co-migrated with E. coli .alpha. and was in the same postion
as the antibody reactive material (antibody against E. coli
.alpha.). Also present are bands corresponding to .tau., .gamma.,
.delta., and .delta.'. These subunits, along with .beta., are all
that is necessary for rapid and processive synthesis and primer
extension over a long (>7 kb) stretch of ssDNA in the case of E.
coli DNA Polymerase III holoenzyme.
[0409] The Pol III-type enzyme purified from T.th. may be a Pol
III*-like enzyme that contains the DNA polymerase and clamp loader
subuits (i.e., like the Pol III* of E. coli). The evidence for this
is: 1) the presence of dnaX and dnaE gene products in the same
column fractions as indicated by Western analysis (see above); 2)
the ability of this enzyme to extend a primer around a 7.2 kb
circular ssDNA upon adding only .beta. (see Example 16); 3)
stimulation of Pol III by adding .beta. on linear DNA, indicating
.beta. subunit is not present in saturating amounts (see Example
15); and 4) the presence of .tau. in T.th. which may glue the
polymerase and clamp loader into a Pol III* as in E. coli; and 5)
the comigration of .alpha. with subunits .tau., .gamma., .delta.
and .delta.' of the clamp loader in the column fractions of the
last chromatographic step (MonoQ, FIG. 14A).
[0410] Micro-Sequencing of T. th DNA Polymerase III .alpha.
Subunit
[0411] The .alpha. subunit from the purified T.th DNA polymerase
III (HEP.P1.ATP-Bound.MONOQ peak2) was blotted onto PVDF membrane
and was cut out of the SDS-PAGE gel and submitted to the
Protein-Nucleic Acid Facility at Rockefeller University for
N-terminal sequencing and proteolytic digestion, purification and
microsequencing of the resultant peptides. Analysis of the a
candidate band (Mw 130 kD) yielded four peptides, two of which
(TTH1, TTH2) showed sequence similarity to a subunits from various
bacterial sources (see FIG. 15).
EXAMPLE 10
[0412] Identification of the Thermus thermophilus dnaE Gene
Encoding the .alpha. Subunit of DNA Polymerase III Replication
Enzyme
[0413] Cloning of the dnaE gene was started with the sequence of
the TTH1 peptide from the purified a subunit (FFIEIQNHGLSEQK) (SEQ.
ID. No. 61). The fragment was aligned to a region at approximately
180 amino acids downstream of the N-termini of several other known
a subunits as shown in FIG. 15. The upstream 33mer
(5'-GTGGGATCCGTGGTTCTGGATCTCGATGAAGAA-3') (SEQ. ID. No. 31)
consists of a BamHI site within the first 9 nucleotides
(underlined) and the sequence coding for the following peptide
HGLSEQK on the complementary strand. The downstream 29mer
(5'-GTGGGATCCACGGSCTSTCSGA- GCAGAAG-3') (SEQ. ID. No. 32) consists
of a BamHI site within the first 9 nucleotides (underlined) and the
following sequence coding for the peptide FFIEIQNH (SEQ. ID. No.
62).
[0414] These two primers were directed away from each other for the
purpose of perfoming inverse PCR (also called circular PCR). The
amplification reactions contained 10 ng T.th. genomic DNA (that had
been cut and religated with XmaI), 0.5 mM of each primer, in a
volume of 100 .mu.l of Vent polymerase reaction mixture containing
10 .mu.l ThermioPol Buffer, 0.5 mM of each dNTP and 0.25 mM
MgSO.sub.4. Amplification was performed using the following cycling
scheme:
[0415] 1. 4 cycles of: 95.5.degree. C.-30 sec., 45.degree. C.-30
sec., 75.degree. C.-8 min.
[0416] 2. 6 cycles of: 95.5.degree. C.-30 sec., 50.degree. C.-30
sec., 75.degree. C.-6 min.
[0417] 3. 30 cycles of: 95.5.degree. C.-30 sec., 52.5.degree. C.-30
sec., 75.degree. C.-5 min.
[0418] A 1.4 kb fragment was obtained and cloned into pBS-SK:BamHI
(i.e. pBS-SK (Stratragene) was cut with BamHI). This sequence was
bracketted by the 29mer primer on both sides and contained the
sequence coding for the N-terminal part of the subunit up to the
peptide used for primer design.
[0419] To obtain further dnaE gene sequence, the TTH2 peptide was
used. It was aligned to a region about 600 amino acids from the
N-termini of the other known subunits (FIG. 15B).
[0420] The upstream 34mer
(5'-GCGGGATCCTCAACGAGGACCTCTCCATCTTCAA-3') (SEQ. ID. No. 33)
consists of a BamHI site within the first 9 nucleotides
(underlined) and the sequence from the end ofthe fragment
previously obtained. The downstream 35mer
(5'-GCGGGATCCTTGTCGTCSAGSGTSAGSGCGTCGTA-3'- ) (SEQ. ID. No. 34)
consists of a BamHI site within the first 9 nucleotides
(underlined) and the following sequence coding for the peptide
YDALTLDD (SEQ. ID. No. 63) on the complementary strand. The
amplification reactions contained 10 ng T.th. genomic DNA, 0.5 mM
of each primer, in a volume of 100 .mu.l of Vent polymerase
reaction mixture containing 10 .mu.l ThermoPol Buffer, 0.5 mM of
each dNTP and 0.25 mM MgSO.sub.4. Amplification was performed using
the following cycling scheme:
[0421] 1. 4 cycles of: 95.5.degree. C.-30 sec., 45.degree. C.-30
sec., 75.degree. C.-8 min.
[0422] 2. 6 cycles of: 95.5.degree. C.-30 sec., 50.degree. C.-30
sec., 75.degree. C.-6 min.
[0423] 3. 30 cycles of: 95.5.degree. C.-30 sec., 55.degree. C.-30
sec., 75.degree. C.-5 min.
[0424] A 1.2 kb PCR fragment was obtained and cloned into
pUC19:BamHI. The fragment was bracketted by the downstream primer
on both sides and contained the region overlapping in 56 bp with
the fragment previously cloned.
[0425] To obtain yet more dnaE sequence, the following primers were
used. The upstream 39mer
(3'-GTGTGGATCCTCGTCCCCCTCATGCGCGACCAGGAAGGG-5') (SEQ. ID. Nos. 35
and 114) consists of a BamHI site within the first 10 nucleotides
(underlined) and the sequence from the end of the fragment
previously obtained. The downstream 27mer
(5'-GTGTGGATCCTTCTTCTTSCCCATSGC- -3') (SEQ. ID. No. 36) consists of
a BamHI site within the first 10 nucleotides (underlined), and the
sequence coding for the peptide AMGKKK (SEQ. ID. No. 64) (at
position approximately 800 residues from the N terminus) on the
complementary strand. The AMGKKK (SEQ. ID. No. 64) sequence was
chosen for primer design as it is highly conserved among the known
gram-negative a subunits. The amplification reactions contained 10
ng T.th. genomic DNA, 0.5 mM of each primer, in a volume of 100
.mu.l of Taq polymerase reaction mixture containing 10 .mu.l PCR
Buffer, 0.5 mM of each dNTP and 2.5 mM MgCl.sub.2. Amplification
was performed using the following cycling scheme:
[0426] 1. 3 cycles of: 95.5.degree. C.-30 sec., 45.degree. C.-30
sec., 72.degree. C.-8 min.
[0427] 2. 6 cycles of: 94.5.degree. C.-30 sec., 55.degree. C.-30
sec., 72.degree. C.-6 min.
[0428] 3. 32 cycles of: 94.5.degree. C.-30 sec., 50.degree. C.-30
sec., 72.degree. C.-5 min.
[0429] A 2.3 kb PCR fragment was obtained instead of the expected
0.6 kb fragment. BamHI digestion of the PCR product resulted in
three fragmentslof 1.1 kb, 0.7 kb and 0.5 kb. The 1.1 kb fragment
was cloned into pUC19:BamHI. It turned out to be the one adjacent
to the fragment previously obtained and contained the dnaE sequence
right up to the region coding for the AMGKKK (SEQ. ID. No. 64)
peptide, but was disrupted by an intron just upstream of this
region. The sequence that follows this was amplified from the 2.3
kb original PCR product using the same conditions and cycling
scheme as for the 2.3 kb fragment. The downstream primer was the
same as in the previous step. The upstream 27mer
(3'-GTGTGGATCCGTGGTGACCTTAGCCAC-5') (SEQ. ID. Nos. 37 and 115)
consisted of a BamHI site within the first 9 nucleotides
(underlined) and the sequence from the end of the 1.1 kb fragment
previously described.
[0430] The expected 1.2 kb PCR fragment was obtained and cloned
into pUC19:SmaI. This fragment coded for the rest of the intein and
the end of it was used to obtain the next sequence of dnaE
downstream of this region. The upstream 30mer
(3'-TTCGTGTCCGAGGACCTTGTGGTCCACAAC-5') (SEQ. ID. Nos. 38 and 116)
was a sequence from the end of the intron. The downstream 23mer
(5'-CCAGAATCGTCTGCTGGTCGTAG-3') (SEQ. ID. No.39) was the sequence
from the end of the dnaE gene of D.rad. (coding on the
complementary strand for the region slightly homologous in the
distantly related a subunits and possibly highly homologous between
T.th. and D.rad. .alpha. subunits). The amplification reactions
contained 10 ng T.th. genomic DNA, 0.5 mM of each primer, in a
volume of 100 .mu.l of Vent polymerase reaction mixture containing
10 .mu.l ThermoPol Buffer, 0.5 mM of each dNTP and 0.1 mM
MgSO.sub.4. Amplification was performed using the following cycling
scheme:
[0431] 1. 3 cycles of: 95.5.degree. C.-30 sec., 55.degree. C.-30
sec., 75.degree. C.-8 min.
[0432] 2. 32 cycles of: 94.5.degree. C.-30 sec., 50.degree. C.-30
sec., 75.degree. C.-5 min.
[0433] A 2.5 kb PCR fragment was obtained and cloned into
pUC19:SmaI. This fragment contained the dnaE sequence coding for
the 300 mino acids next to the AMGKKK (SEQ. ID. No. 64) region
disrupted by yet a second intein inside another sequence that is
conserved among the known a subunits (FNKSHSAAY) (SEQ. ID. No.
65).
[0434] To obtain the rest of the dnaE gene the upstream 19mer
(5'-AGCACCCTGGAGGAGCTTC-3') (SEQ. ID. No. 40) from the end of the
known dnaE sequence was used. The downstream primer was:
5'-CATGTCGTACTGGGTGTAC-3' (SEQ. ID. No. 41). The amplification
reactions contained 10 ng T.th. genomic DNA, 0.5 mM of each primer,
in a volume of 100 .mu.l of Vent polymerase reaction mixture
containing 10 .mu.l ThermoPol Buffer, 0.5 mM of each dNTP and 0.1
mM MgSO.sub.4. Amplification was performed using the following
cycling scheme:
[0435] 1. 3 cycles of: 95.5.degree. C.-30 sec., 55.degree. C.-30
sec., 75.degree. C.-8 min.
[0436] 2. 32 cycles of: 94.5.degree. C.-30 sec., 50.degree. C.-30
sec., 75.degree. C.-5 min.
[0437] A 1.0 kb fragment bracketed by this upstream primer was
obtained. It contained the 3' end of the dnaE gene.
EXAMPLE 11
[0438] Cloning and Expression of the Thermus thermophilus dnaQ Gene
Encoding the .epsilon. Subunit of DNA Polymerase III Replication
Enzyme
[0439] Cloning of dnaQ
[0440] The dnaQ gene of E. coli and the corresponding region of
PolC of B. subtilis, evolutionary divergent organisms, share
approximately 30% identity. Comparison of the predicted amino acid
sequences for DnaQ (.epsilon.) of E. coli and PolC of B. subtilis
revealed two highly conserved regions (FIG. 17). Within each of
these regions, a nine amino acid sequence was used to design two
oligonucleotide primers for use in the polymerase chain
reaction.
[0441] The regions highly conservative among Pol III exonucleases
were chosen to design the degenerate primers for the amplification
of a T.th. dnaQ internal fragment (see FIG. 17). DNA
oligonucleotides for amplification of T.th. genomic DNA were as
follows. The upstream 27mer (5'-GTSGTSNNSGACNNSGAGACSACSGGG-3'
(SEQ. ID. No. 42)) encodes the following sequence (VVXDXETTG (SEQ.
ID. No. 66). The downstream 27mer
(5'-GAASCCSNNGTCGAASNNGGCGTTGTG-3') (SEQ. ID. No. 43) encodes the
sequence HNAXFDXGF (SEQ. ID. No. 67) on the complementary strand.
The amplification reactions contained 10 ng T.th. genomic DNA, 0.5
mM of each primer, in a volume of 100 .mu.l of Vent polymerase
reaction mixture containing 10 .mu.l ThermoPol Buffer, 0.5 mM of
each dNTP and 0.5 mM MgSO.sub.4. Amplification was performed using
the following cycling scheme:
[0442] 1. 5 cycles of: 95.5.degree. C.-30 sec., 40.degree. C.-30
sec., 72.degree. C.-2 min.
[0443] 2. 5 cycles of: 95.5.degree. C.-30 sec., 45.degree. C.-30
sec., 72.degree. C.-2 min.
[0444] 3. 30 cycles of: 95.5.degree. C.-30 sec., 50.degree. C.-30
sec., 72.degree. C.-30 min.
[0445] Products were visualized in a 1.5% native agarose gel. A
fragment of the expected size of 270 bp was cloned into the SmaI
site of pUC19 and sequenced with the CircumVent Thermal Cycle DNA
sequencing kit accordinig to the manufacturer's instructions (New
England Biolabs).
[0446] To obtain further sequence of the dnaQ gene, genomic DNA was
digested with either mhoI, BamHI, KpnI or NcoI. These restriction
enzymes were chosen because they cut T.th. genomic DNA frequently.
Approximately 0.1 .mu.g of DNA for each digest was ligated by T4
DNA ligase in 50 .mu.l of ligation buffer (50 mM Tris-HCl (pH 7.8),
10 mM MgCl.sub.2, 10 mM dithiothreitol, 1 mM ATP, 25 mg/ml bovine
serum albumin) overnight at 20.degree. C. The ligation mixtures
were used for cicular PCR.
[0447] DNA oligonucleotides for amplification of T.th. genomic DNA
were the following. The upstream 27mer
(5'-CGGGGATCCACCTCAATCACCTCGTGG-3') (SEQ. ID. No. 44) consists of a
BamHI site within the first 9 nucleotides (underlined) and the
sequence complementary to 42-61 bp region of the previously cloned
dnaQ fragment. The downstream 30mer
(5'-CGGGGATCCGCCACCTTGCGGCTCCGGGTG-3') (SEQ. ID. No. 45) consists
of a BanHI site within the first 9 nucleotides (underlined) and the
sequence corresponding to 240-261 bp region of the dnaQ fragment
(see FIG. 17).
[0448] The amplification reactions contained 1 ng T.th. genomic DNA
(that had been cut with NcoI and religated into circular DNA for
circular PCR), 0.4 mM of each primer, in a volume of 100 .mu.l of
Vent polymerase reaction mixture containing 10 .mu.l ThermoPol
Buffer, 0.5 mM of each dNTP, 0.5 mM MgSO.sub.4, and 10% DMSO.
Circular amplification was performed using the following cycling
scheme:
[0449] 1. 5 cycles of: 95.5.degree. C.-30 sec., 50.degree. C.-30
sec., 72.degree. C.-8 min.
[0450] 2. 35 cycles of: 95.5.degree. C.-30 sec., 55.degree. C.-30
sec., 72.degree. C.-6 min.
[0451] 3. 72.degree. C.-10 min.
[0452] A 1.5 kb fragment was obtained and cloned into the BamHI
site of the pUC19 vector. Partial sequencing of the fragment
reveiled that it contained the dnaQ regions adjacent to sequences
corresponding to the PCR primers and hence contained the sequences
both upstream and downstream of the previously cloned dnaQ
fragment. One of NcoI sites turned out to be approximatly 300 bp
downstream of the end of the first cloned dnaQ sequence and hence
did not include the 3' end of dnaQ. To obtain the 3' end, another
inverse PCR reaction was performed. Since an ApaI restiction site
was recognized within this newly sequenced dnaQ fragment, the
circular PCR procedure was performed using as template an Apal
digest of T.th. genomic DNA that was ligated (circularized) under
the same conditions as described above.
[0453] DNA oligonucleotides for amplification of the ApaI/religated
T.th. genomic DNA were as follows. The upstream 31mer
(5'-GCGCTCTAGACGAGTTCCCAA- AGCGTGCGGT-3') (SEQ. ID. No. 46)
consists of a mbaI site within the first 10 nucleotides
(underlined) and the sequence: complementary to the region
downstream of the ApaI restriction site in the, newly sequenced
dnaQ fragment. The downstream 25 mer
(5'-CGCGTCTAGATCACCTGTATCCAGA-3') (SEQ. ID. No. 47) consists of a
XbaI site. within the first 10 nucleotides (underlined) and the
sequence corresponding to another region downstream of the ApaI
restriction site in the newly sequenced dnaQ fragment. The 1.7 kb
PCR fragment was cloned into the XbaI site of the pUC19 vector and
partially sequenced. The sequence of dnaQ, and the protein sequence
of the .epsilon. subunit encoded by it, is shown in FIG. 18.
[0454] The dnaQ gene is encoded by an open reading frame of 209 (or
190 depending on which Val is used as the initiating residue) amino
acids in length (23598.5 kDa-or 21383.8 kDa for shorter version),
similar to the length of the E. coli .epsilon. subunit (243 amino
acids, 27099.1 kDa mass) (see FIG. 17).
[0455] The entire amino acid sequence of the .epsilon. subunit
predicted from the T.th. dnaQ gene aligns with the predicted amino
acid sequence of the dnaQ genes of other organisms with only a few
gaps and insertions (the first two amino acids, and four positions
downstream) (FIG. 17). The consensus motifs VVXDXETTG (SEQ. ID.
Nos. 66 and 68), HNAXFDXGF (SEQ. ID. No. 67), and HRALYD (SEQ. ID.
No. 70), characteristic for exonucleases, are conserved. Overall,
the level of amino acid identity relative to most of the known
.epsilon. subunits, or corresponding proofreading exonuclease
domains ofgram positive PolC genes is approximately 30%. Upstream
of start 1 (FIG. 17) there were stop codons in all three reading
frames.
[0456] Expression of dnaQ
[0457] The dnaQ gene was cloned gene into the pET24-a expression
vector in two steps. First, the PCR fragment encoding the
N-terminal part of the gene was cloned into the pUC19 plasmid,
containing the ApaI inverse PCR fragment into NdeI/ApaI sites. DNA
oligonucleotides for amplification of T.th. genomic DNA were as
follows. The upstream 33mer
(5'-GCGGCGCATATGGTGGTGGTCCTGGACCTGGAG-3') (SEQ. ID. No. 48)
consists of an NdeI site within the first 12 nucleotides
(underlined) and the begining of the dnaQ gene. The downstream 25
mer (5'-CGCGTCTAGATCACCTGTAT- CCAGA-3') (SEQ. ID. No. 49), already
used for ApaI circular PCR, consists of an XbaI site within the
first 10 nucleotides (underlined) and the sequence corresponding to
the region downstream of the ApaI restriction site. The 2.2 kb
NdeI/SalI fragment was then cloned into the NdeI/XhoI sites ofthe
pET16 vector to produce pET24-a:dnaQ. The .epsilon. subunit was
expressed in the BL21/LysS strain transformed by the pET24-a:dnaQ
plasmid.
EXAMPLE 12
The Thermus thermoohilus dnaN Gene Encoding the .beta. Subunit of
DNA Polymerase III Replication Enzyme
[0458] Strategy of Cloning dnaN by use of dnaA
[0459] DnaN proteins are highly divergent in bacteria making it
difficult to clone them by homology. The level of identity between
DnaN representatives from E. coli and B. subtilis is as low as 18%.
These 18% of identical amino acid residues are dispersed through
the proteins rather then clustering together in conservative
regions, further complicating use of homology to design PCR
primers. However, one feature of dnaN genes among widely different
bacteria is their location in the chromosome. They appear to be
near the origin, and immediately adjacent to the dnaA gene. The
dnaA genes show good homology among different bacteria and, thus,
dnaA was first cloned inorder to obtain a DNA probe that is likely
near dnaN.
[0460] Identification of dnaA and dnaN
[0461] The dnaA genes of E. coli and B. subtilis share 58% identity
at the amino acid sequence level within the ATP-binding domain (or
among the representatives of gram-positive and gram-negative
bacteria, evolutionary divergent organisms). Comparison of the
predicted amino acid sequences encoded by dnaA of E. coli and B.
subtilis revealed two highly conserved regions (FIG. 19). Within
each of these regions, a seven amino acid sequence was used to
design two oligonucleotide primers for use in the polymerase chain
reaction. The DNA oligonucleotides for amplification of T.th.
genomic DNA were as follows. The upstream 20mer
(5'-GTSCTSGTSAAGACSCACTT-3') (SEQ. ID. No. 50) encodes the
following sequence: VLVKTHL (SEQ. ID. No. 69). The downstream 21mer
(5'-SAGSAGSGCGTTGAASGTGTG-3', where S is G or C) (SEQ. ID. No. 51)
encodes the sequence: HTFNALL (SEQ. ID. No. 71), on the
complementary strand. The amplification reactions contained 10 ng
T.th. genomic DNA, 0.5 mM of each primer, in a volume of 100 .mu.l
of Vent polymerase reaction mixture containing 10 .mu.l ThermoPol
Buffer, 0.5 mM of each dNTP and 0.5 mM MgSO.sub.4. Amplification
was performed using the following cycling scheme:
[0462] 1. 5 cycles of: 95.5.degree. C.-30 sec., 45.degree. C.-30
sec., 75.degree. C.-2 min.
[0463] 2. 5 cycles of: 95.5.degree. C.-30 sec., 50.degree. C.-30
sec., 75.degree. C.-2 min.
[0464] 3. 30 cycles of: 95.5.degree. C.-30 sec., 52.degree. C.-30
sec., 75.degree. C.-30 min.
[0465] Products were visualized in a 1.5% native agarose gel. A
fragment of the expected size of 300 bp was cloned into the SmaI
site of pUC19 and sequenced with the CircumVent Thermal Cycle DNA
sequencing kit (New England Biolabs).
[0466] To obtain a larger section of the T.th. dnaA gene, genomic
DNA was digested with either HaeII, HindIII, KasI, KpnI, MluI,
NcoI, NgoMI, NheI, NsiI, PaeR71, PstI, SacI, SalI, SpeI, SphI,
StuI, or XhoI, followed by Southern analysis in a native agarose
gel. The filter was probed with the 300 bp PCR product radiolabeled
by random priming. Four different restriction digests showed a
single fragment of reasonable size for further cloning. These were,
KasI, NgoMI, and StuI, all of which produced fragments of about 3
kb, and NcoI that produced a 2 kb fragment. Also, a KpnI digest
resulted in two fragments of about 1.5 kb and 10 kb.
[0467] Genomic DNA digests using either NgoMI and StuI were used to
obtain the dnaA gene by inverse PCR (also referred to as circular
PCR). In this procedure, 0.1 .mu.g of DNA from each digest was
treated separately with T4 DNA ligase in 50 .mu.l of ligation
buffer (50 mM Tris-HCl (pH 7.8), 10 mM MgCl.sub.2, 10 mM
dithiothreitol, 1 mM ATP, 25 mg/ml bovine serum albumin) overnight
at 20.degree. C. This results in circularizing the genomic DNA
fragments. The ligation mixtures were used as substrate in inverse
PCR.
[0468] DNA oligonucleotides for amplification of recircularized
T.th. genomic DNA were as follows. The upstream 22mer was
(5'-CTCGTTGGTGAAAGTTTCCGTG-3') (SEQ. ID. No. 52), and the
downstream 24mer was (5'-CGTCCAGTTCATCGCCGGAA-AGGA-3') (SEQ. ID.
No. 53). The amplification reactions contained 5 ng T.th. genomic
DNA, 0.5 .mu.M of each primer, in a volume of 100 .mu.l of Taq
polymerase reaction mixture containing 10 .mu.l PCR Buffer, 0.5 mM
of each dNTP and 2.5 mM MgCl.sub.2. Amplification was perforned
using the following cycling scheme:
[0469] 1. 5 cycles of: 95.0.degree. C.-30 sec., 55.degree. C.-30
sec., 72.degree. C.-10 min.
[0470] 2. 35 cycles of: 95.5.degree. C.-30 sec., 50.degree. C.-30
sec., 72.degree. C.-8 mriin.
[0471] The PCR fragments of the expected length for NgoMI and StuI
treated and then ligated chromosomal DNA were digested with either
BamHI or Sau3a and cloned into pUC19:BamHI and pUC19:(BamHI+SmaI)
and sequenced with CircumVent Thermal Cycle DNA sequencing kit. The
1.6 kb (BamHI+BamH) fragment from the NgoMI PCR product contained a
sequence coding for the N-terminal part of dnaN, followed by the
gene for enolase. The 1 kb (Sau3a+Sau3a) fragment from the same PCR
product included the start of dnaN gene and sequence characteristic
of the origin of replication (i.e., 9mer DnaA-binding site
sequences). The 0.6 kb (BamHI+BamHI) fragment from the StuI PCR
reaction contained starts for dnaa and gidA genes in inverse
orientation to each other. The 0.4 kb (Sau3a+Sau3a) fragment from
the same PCR product contained the 3' end of the dnaa gene, and DNA
sequence characteristic for the origin of replication.
[0472] This sequence information provided the beginning and end of
both the dnaA and the dnaN genes. Hence, these genes were easily
cloned from this information. Further, the dnaN gene was readily
cloned and expressed in a pET24-a vector. These steps are described
below.
[0473] Cloning and Sequence of the dnaA Gene
[0474] The dnaA gene was cloned for sequencing in two parts: from
the potential start of the gene up to its middle and from the
middle up to the end. For the N-terminal part, the upstream 27mer
(5'-TCTGGCAACACGTTCTGGAGCACATCC-3') (SEQ. ID. No. 54) was 20 bp
downsteam of the potential start codon of the gene. The downstream
23mer (5'-TGCTGGCGTTCATCTTCAGGATG-3') (SEQ. ID. No. 55) was
approximately from the middle of the dnaA gene. For the C-terminal
part, the upstream 23mer (5'-CATCCTGAAGATGAACGCCAGCA-3') (SEQ. ID.
No. 56) was complementary to the previous primer. The downstream
25mer (5'-AGGTTATCCACAGGGGTCATGTGCA-3- ') (SEQ. ID. No. 57) was 20
bp upstream the potential stop codon for the dnaa gene. The
amplification reactions contained 10 ng T.th. genomic DNA, 0.5
.mu.M of each primer, in a volume of 100 .mu.l of Vent polymerase
reaction mixture containing 10 .mu.l ThermoPol Buffer, 0.5 mM of
each dNTP and 0.5 mM MgSO.sub.4. Amplification was performed using
the following cycling scheme:
[0475] 1. 5 cycles of: 95.5.degree. C.-30 sec., 55.degree. C.-30
sec., 75.degree. C.-3 min.
[0476] 2. 30 cycles of: 95.5.degree. C.-30 sec., 50.degree. C.-30
sec., 75.degree. C.-2 mM.
[0477] Products were visualized in a 1.0% native agarose gel.
Fragments of the expected sizes of 750 bp and 650 bp were produced,
and were sequenced using CircumVent Thermal Cycle DNA sequencing
method (New England Biolabs). The nucleotide and amino acid
sequences of dnaA and its protein product are shown in FIG. 20. The
DnaA protein is homologous to the DnaA proteins of several other
bacteria as shown in FIG. 19.
[0478] Cloning and Expression of dnaN
[0479] The full length dnaN gene was obtained by PCR from T.th.
total. DNA. DNA oligonucleotides for amplification of T.th. dnaN
were the following: the upstream 29mer
(5'-GTGTGTCATATGAACATAACGGTTCCCAA-3') (SEQ. ID. No. 58) consists of
an NdeI site within first 11 nucleotides (underlined), followed by
the sequence for the start of the dnaN gene; the downstream 29mer
(5'-GCGCGAATTCTCCCTTGTGGAAGGCTTAG-3') (SEQ. ID. No. 59) consists of
an EcoRI site within the first 10 nucleotides (underlined),
followed by the sequence complementary to a section just downstream
of the dnaN stop codon. The amplification reactions contained 10 ng
T.th. genomic DNA, 0.5 .mu.M of each primer, in a volume of 100
.mu.l of Vent polymerase reactionmixture containing 10 .mu.l
Thermopol Buffer, 0.5 mM of each dNTP and 0.2 mM MgSO.sub.4.
Amplification was performed using the following cycling scheme:
[0480] 1. 5 cycles of: 95.0.degree. C.-30 sec., 55.degree. C.-30
sec., 75.degree. C.-5 min.
[0481] 2. 35 cycles of: 95.5.degree. C.-30 sec., 50.degree. C.-30
sec., 75.degree. C.-4 min.
[0482] The nucleotide and amnino acid sequences of dnaN and the
.beta. subunit, respectively, are shown in FIG. 21. The T.th.
.beta. subunit shows limited homology to the .beta. subunit
sequences of several other bacteria over its entire length (FIG.
22).
[0483] The approximately 1 kb dnan gene was cloned into the pET24-a
expression vector using the NdeI and EcoRI restriction sites both
in the dnaN containing PCR product and in pEt24-a (FIG. 23).
Expression of T.th. .beta. subunit was obtained under the following
conditions: a fresh colony of Bl21(DE3) E. coli strain was
transformed by the pET24-a:dnaN plasmid, and then was grown in LB
broth containing 50 mg/ml kanamycin at 37.degree. C. until the cell
density reached 0.4 OD.sub.600. The cell culture was then induced
for dnaN expression upon addition of 2 mM IPTG. Cells were
harvested after 4 additional hours of growth under 37.degree. C.
The induction of the T.th. .beta. subunit is shown in FIG. 24.
[0484] Two liters of BL21 (DE3)pETdnaNcells were grown in LB media
containing 50 mg/ml ampicillin at 37.degree. C. to an O.D. of 0.8
and then IPTG was added to a concentration of 2 mM. After a further
2 h at 37.degree. C., cells were harvested by centrifugation and
stored at -70.degree. C. The following steps were performed at
4.degree. C. Cells were thawed and resuspended in 40 ml of 5 mM
Tris-HCl (pH 8.0), 1% sucrose, 1M NaCl, 5 mM DTT, and 30 mM
spermidine. Cells were lysed using a French Pressure cell at 20,000
psi. The lysate was allowed to sit at 4.degree. C. for 30 min. and
then cell debris was removed by centrifugation (Sorvall SS-34
rotor, 45 min. 18,000 rpm). The supernatant was incubated at
65.degree. C. for 20 minutes with occasional stirring. The
resulting protein precipitate was removed by centrifugation as
described above. The supernatant was dialyzed against 4 liters of
buffer A containing 50 mM NaCl overnight. The dialyzed supernatant
was clarified by centrifugation (35 ml, 150 mg total) and then
loaded onto an 8 ml MonoQ column equilibrated in buffer A
containing 50 mM NaCl. The column was washed with 5 column volumes
of the same buffer and then eluted with a 120 ml gradient of buffer
A plus 50 mM NaCl to buffer A plus 500 mM NaCl. Fractions of 2 ml
were collected. Over 50 mg of T.th. .beta. was recovered in
fractions 5-21.
EXAMPLE 13
[0485] Identification and Cloning of T. thermophilus holA
[0486] A search of the incomplete T.th. genome database
(www.g21.bio.unigoettingen.de) showed a match to E. coli .delta.
encoded by holA. The sequence obtained from the database was as
follows (SEQ. ID. No. 185):
4 TPKGKDLVRHLENRAKRLGLRLPGGVAQYLA-SLEGDLEALERELEKLAL
LSP-PLTLEKVEKVVALRPPLTGFDLVRSVLEKDPKEALLRLGRLKEEGE
EPLRLLGALSWQFALLARAFFLLREMPRPKEEDLARLEAAHPYAAKKALL
-EAARRLTEEALKEALDALMEAEKRAKG-GKDPWLALEAAVLRLAR-PAG QPRVD
[0487] Next, the following PCR primers were designed from the codon
usage of T.th.: upstream 27mer (5'-GCC CAG TAC CTC GCC TCC CTC GAG
GGG-3') (SEQ. ID. No. 186) and downstream 27mer (5'-GGC CCC CTT GGC
CTT CTC GGC CTC CAT-3' (SEQ. ID. No. 187) to obtain a partial holA
nucleotide sequence (SEQ. ID. No. 188):
5 AGACTCGAGG CCCTGGAGCG GGAGCTGGAG AAGCTTGCCC TCCTCTCCCC ACCCCTCACC
60 CTGGAGAAGG TGGAGAAGGT GGTGGCCCTG AGGCCCCCCC TCACGGGCTT
TGACCTGGTG 120 CGCTCCGTCC TGGAGAAGGA CCCCAAGGAG GCCCTCCTGC
GCCTCAGGCG CCTCAGGGAG 180 GAGGGGGAGG AGCCCCTCAG GCTCCTCGGG
GCCCTCTCCT GGCAGTTCGC CCTCCTCGCC 240 CGGGCCTTCT TCCTCCTCCG
GGAAAACCCC AGGCCCAAGG AGGAGGACCT CGCCCGCCTC 300 GAGGCCCACC
CCTACGCCGC CAAGAAGGCC A 331
[0488] This sequence codes for a partial amino acid sequence of the
T.th. .delta. subunit (SEQ. ID. No. 189):
6 RLEALERELEKLALLSPPLTLEKVEKVVALRPPLTGFDLVRSVLEKDPKE
ALLRLRRLREEGEEPLRLLGALSWQFALLARAFFLLRENPRPKEEDLARL EAHPYAAKKA
[0489] The DNA sequence obtained by PCR (SEQ. ID. No. 188) was used
to design internal primers for inverted PCR. The upstream 31 mer
(5'-GTGGTGTCTAGACATCATAACGGTTCTGGCA-3') (SEQ. ID. NO. I90)
introduced an XbaI site for cloning holA into a pGEX vector. The
downstream 27mer (5'-GAGGGCCACCACCTTCTCCACCTTCTC-3') (SEQ. ID. No.
191) encodes holA sequence EKVEKVVAL (aa residues 159-167 of SEQ.
ID. No. 158) on the complementary strand. The amplification
reactions contained 50ng T.th. genomic DNA and 0.1 .mu.M of each
primer in a volume of 100 .mu.l of Vent polymerase reaction mixture
containing 10 .mu.l ThermoPol Buffer, 2.5 mM of each dNTP, 2 mM
MgSO.sub.4, and 10 .mu.l of formamide. Amplification was performed
using the following cycling scheme:
[0490] 1. 5 cycles of: 95.degree. C.-30 sec., 65.degree. C.-20
sec., 75.degree. C.-5 min.
[0491] 2. 5 cycles of: 95.degree. C.-20 sec., 58.degree. C.-10
sec., 75.degree. C.-5 min.
[0492] 3. 35 cycles of: 95.degree. C.-20 sec., 50.degree. C.-5
sec., 75.degree. C.-4 min.
[0493] Products were visualized in a 1.0% native agarose gel. A
fragment of 1.5 Kb was gel purified and partially sequenced.
[0494] A different set of primers were used to obtain the 3'-end of
T.th. holA, including an upstream 25mer
(5'-CTCCGTCCTGGAGAAGGACCCCAAG-3') (SEQ. ID. No. 192) which encoded
the amino acid sequence SVLEKDPK from T.th. holA (aa residues
179-186, of SEQ. ID. No. 158), and a downstream 29mer
(5'-CGCGAATTCAACGCSCTCCTCAAGACSCT-3' where S.dbd.C or G) (SEQ. ID.
No. 193) was not related to the holA sequence. The amplification
reactions contained 50ng T.th. genomic DNA and 0.1 .mu.M of each
primer in a volume of 100 .mu.l of Vent polymerase reaction mixture
containing 1.0 .mu.l ThermoPol Buffer, 2.5 mM of each dNTP, and 1-2
mM MgSO.sub.4, and 10 .mu.l of formamide. Amplification was
performed using the following cycling scheme:
[0495] 1. 5 cycles of: 95.degree. C.-30 sec., 65.degree. C.-20
sec., 75.degree. C.-5 min.
[0496] 2. 5 cycles of: 95.degree. C.-20 sec., 55.degree. C.-10
sec., 75.degree. C.-5 min.
[0497] 3. 35 cycles of: 95.degree. C.-20 sec., 50.degree. C.-5
sec., 75.degree. C.-4 min.
[0498] Products were visualized in a 1.0% native agarose gel. A
fragment of 1.2 Kb was gel purified and partially sequenced to
obtain the remainder of the T.th. holA gene.
[0499] The T.th. holA gene was cloned into the NdeI/EcoRI sites in
the pET24 vector using a pair of primers. The upstream 31mer
(5'-GACACTTAACATATGGTCATCGCCTTCACCG-3') (SEQ. ID. No. 194) contains
a NdeI site within the first 15 nucleotides (underlined) and has a
sequence corresponding to 5' region of T.th. holA. The downstream
38 mer (5'-GTGTGTGAATTCGGGTCAACGGGCGAGGCGGAGGACCG-3') (SEQ. ID. No.
195) contains a EcoRI site within the first 12 nucleotides
(underlined) and has a sequence complementary to the 3' end of holA
gene.
EXAMPLE 14
[0500] Identification of T.th. holB Encoding 8' Subunit
[0501] To clone the ends of T.th. holB gene, it was assumed that
the order of genes in Thermus thermophilis could be the same as in
related Deinococcus radiodurance. Multiple alignmnent of the
upstream neighbor (probable phosphoesterase, DNA repair Rad24c
related protein) revealed a conservative region close to the
C-terminus of the protein sequence:
7 Deinococcus VILNPGSVGQ (SEQ. ID. No. 196) radiodurance
Methanococcus YLINPGSVGQ (SEQ. ID. No. 197) janaschii Thermotoga
LVLNPGSAGR (SEQ. ID. No. 198) maritima
[0502] The D.rad. sequence was used to design an upstream 28mer
primer (5'-CTGGTGAACCCGGGCTCCGTGGGCCAGC-3') (SEQ. ID. No. 199) that
encodes the amino acid sequence LLVNPGSVGQ (SEQ. ID. No. 200) and a
downstream 27mer (5'-CTCGAGGAGCTTGAGGAGGGTGTTGGC-3') (SEQ. ID. No.
201) encodes the sequence ANTLLKLLE (SEQ. ID. No. 202) on the
complementary strand. The amplification reactions contained 50ng
T.th. genomic DNA and 0.1 .mu.M of each primer in a volume of 100
.mu.l of Deep Vent polymerase reaction mixture containing 10 .mu.l
ThermoPol Buffer, 2.5 mM of each dNTP, 1.5 mM MgSO.sub.4, and 10
.mu.l formamide. Amplification was performed using the following
cycling scheme:
[0503] 1. 5 cycles of: 95.degree. C.-30 sec., 68.degree. C.-20
sec., 75.degree. C.-3 min.
[0504] 2. 5 cycles of: 95.degree. C.-20 sec., 63.degree. C.-20
sec., 75.degree. C.-3 min.
[0505] 3. 35 cycles of: 95.degree. C.-20 sec., 55.degree. C.-10
sec., 75.degree. C.-3 min.
[0506] Product was visualized in a 1.0% native agarose gel as a
single band of 0.7 Kb. The fragment was purified and partially
sequenced.
[0507] Multiple alignment of the gene downstream of D.rad.
identified the following conservative region:
8 Deinococcus radiodurans GFGGVQLHAAHGYLLSQFLSPRHNVREDEYGG (SEQ.
ID. No. 203) Caenorhabditis elegans
GFDGIQLHGAHGYLLSQFTSPTTNKRVDKYGG (SEQ. ID. No. 204) Pseudomonas
aeruginosa GFSGVEIHAAHGYLLSQFLSPLSNRRSDAWGG (SEQ. ID. No. 205)
Archaeoglobus fulgidus GFDAVQLHAAHGYLLSEFISPHVNRRKDEYGG (SEQ. ID.
No. 206)
[0508] The fragment in bold was used to design primers,
specifically the downstream primer, for cloning of the 3' region of
the T.th. holB gene. The upstream 30mer
(5'-CATCCTGGACTCGGCCCACCTCCTCACCGA-3') (SEQ. ID. No. 207) encodes
the amino acid sequence ILDSAHLLT (SEQ. ID. No. 208). The
downstream 33mer (5'-GAGGAGGTAGCCGTGGGCCGCGTGGAGCTCCAC-3') (SEQ.
ID. No. 209) encodes the sequence VELHAAHGYLL (SEQ. ID. No. 210) on
the complementary strand. The amplification reactions contained 50
ng T.th. genomic DNA and 0.1 .mu.M of each primer in a volume of
100 .mu.l of Deep Vent polymerase reaction mixture containing 10
.mu.l ThermoPol Buffer, 2.5 mM of each dNTP, 2 mM MgSO.sub.4, and
10 .mu.l DMSO. Amplification was performed using the following
cycling scheme:
[0509] 1. 5 cycles of: 95.degree. C.-30 sec., 70.degree. C.-20
sec., 75.degree. C.-4 min.
[0510] 2. 5 cycles of: 95.degree. C.-20 sec., 66.degree. C.-20
sec., 75.degree. C.-4 min.
[0511] 3. 30 cycles of: 95.degree. C.-20 sec., 60.degree. C.-10
sec., 77.degree. C.-4 min.
[0512] Products were visualized in a 1.0% native agarose gel as a
single band of 1.1 kb. The Kb fragment was gel purified and
sequenced to provide the remainder of the holB gene encoding T.th.
.delta.'.
[0513] For protein expression, the T.th. holB gene was cloned
intothe pET24 vector at the Nde:EcoR sites using a pair of primers.
The upstream 32mer (5'-GGCTTTCCCATATGGCTCTACACCCGGCTCAC-3') (SEQ.
ID. No. 211) contains a NdeI site within the first 15 nucleotides
(underlined) and the sequence corresponding to the 5' region of
T.th. holB. The downstream 29 mer
(5'-GCGTGGATCCACGGTCATGTCTCTAAGTC-3') (SEQ. ID. No. 212) contains a
BamHI site within the first 10 nucleotides (underlined) and a
sequence complementary to the 3' end of the holB gene.
EXAMPLE 15
[0514] Alternate Synthetic Path in Absence of Clamp Loader
Activity
[0515] As discussed earlier, the Pol III-type enzyme of the present
invention is capable of application and use in a variety of
contexts, including a method wherein the clamp loader component
that is traditionally involved in the initiation of enzyme
activity, is not required. The clamp loader generally functions to
increase the efficiency of ring assembly onto circular primed DNA,
because both the ring and the DNA are circles and one must be
broken transiently for them to become interlocked rings. In such a
reaction, the clamp loader increases the efficiency of opening the
ring.
[0516] The procedure described below illustrates the instance where
the clamp loader need not be present. For example, the .beta. clamp
can be assembled onto DNA in the absence of the clamp loader.
Particularly, the bulk of primed templates in PCR reactions are
linear ssDNA fragments that are primed at the ends. On linear
primed DNA, the ring need not open at all. Instead, the ring can
simply thread onto the end of the linear primed template (Bauer and
Burgers, 1988; Tan et al, 1986; O'Day et al., 1992; Burgers and
Yoder, 1993). Hence, on linear primed templates, such as those
generated in PCR, the beta clamp can simply slide over the DNA end.
After the ring slides onto the end, the DNA polymerase can
associate with the ring for enhanced DNA synthesis.
[0517] Such "end assembly" is common among Pol III-type enzymes and
has been demonstrated in yeast and human systems. Rings assembling
onto linear DNA for use by their respective DNA polymerases are
shown in the following example demonstrated in the E. coli
bacterial system, in the human system, and in the T.th. system.
[0518] The bulk of the primed templates in PCR reactions are linear
ssDNA fragments that are primed at their ends. However, these end
primed linear fragments are not generated until after the first
step of PCR has already been performed. In the very first step, PCR
primers generally anneal at internal sites in a heat denatured
ssDNA template. Primed linear templates are then generated in
subsequent steps enabling use of this alternate path. For this
first step, the clamp may be assembled onto an internal site in the
absence of the clamp loader using special conditions that allow
clamp assembly in the absence of a clamp loader.
[0519] For example, a set of conditions that lead to assembly of
the clamp onto circular DNA (i.e., internal primed sites) have been
described in the protocol for the use of the bacteriophage T4 ring
shaped clamp (gene 45 protein) without the clamp loader (Reddy et
al., 1993). In this case, polyethylene glycol leads to
"macromolecular crowding" such that the clamp and DNA are pushed
together in close proximity, leading to the ring self assembling
onto internal primed sites on circular DNA. Other possible
conditions that may lead to assembly of rings onto internal sites
include use of a high concentration of beta such that use of heat
or denaturant to break the dimeric ring into two half rings
(crescents) followed by lowering the heat (or dilution or removal
of denaturant) leading to rings assembling around the DNA.
[0520] The ring shaped sliding clamps of E. coli and human slide
over the end of linear DNA to activate their respective DNA
polymerase in the absence of the clamp loader. This clamp loader
independent assay is performed in the bacterial system in FIG. 25A.
For this assay, the linear template is polydA primed with oligodT.
The polydA is of average length 4500 nucleotides and was purchased
from SuperTecs. OligodT35 was synthesized by Oligos etc. The
template was prepared using 145 .mu.l of 5.2 mM (as nucleotide)
polydA and 22 .mu.l of 1.75 mM (as nucleotide) oligodT. The mixture
was incubated in a final volume of 2100 .mu.l T.E. buffer (ratio as
nucleotide was 21:1 polydA to oligodT). The mixture was heated to
boiling in a 1 ml Eppendorf tube, then removed and allowed to cool
to room temperature. Assays were performed in a final volume of 25
.mu.l 20 mM Tris-Cl (pH 7.5), 8 mM MgCl.sub.2, 5 mM DTT, 0.5 mM
EDTA, 40 mg/ml BSA, 4% glycerol, containing 20 .mu.M
[.alpha.-.sup.32P]dTTP, 0.1 .mu.g-polydA-oligodT, 25 ng Pol III
and, where present, 5 .mu.g of .beta. subunit. Proteins were added
to the reaction on ice, then shifted to 37.degree. C. for 5 min.
DNA synthesis was quantitated using DE81. paper as described (Rowen
and Komberg, 1978).
[0521] In the linear template assay, no ATP or dATP is provided and
therefore, a clamp loader, even if present, is not active. Thus,
the clamp (e.g., .beta.) can only stimulate the DNA polymerase
provided the clamp threads onto the DNA (see diagram in FIG. 25).
Hence, threading of the clamp is shown by a stimulation of the DNA
polymerase. In lane 1 of FIG. 25A, the DNA polymerase is incubated
with the the linear DNA in the absence of the clamp, and lane 2
shows the result of adding the clamp. The results show that the
clamp is able to thread onto the DNA ends and stimulate the DNA
polymerase in the absence of ATP and thus, in the absence of clamp
loading as well.
[0522] This clamp loader independent assay is performed in the
human system in FIG. 25B. The assay reaction (25 .mu.l) contains 50
mM Tris-HCl (pH=7.8), 8 mM MgCl2, 1 mM DTT, 1 mM creatine
phosphate, 40 .mu.g/ml bovine serum albumin, 0.55 .mu.g human SSB,
100 ng PCNA (where present), 7 units DNA polymerase delta (1 unit
incorporates 1 pmol dTMP in 60 min.), 40 mM [.alpha.-.sup.32P]dTTP
and 0.1 .mu.g polydA-oligodT. Proteins were added to the reaction
on ice, then shifted to 37.degree. C. for 60 min. DNA synthesis was
quantitated using DE81 paper as described (Rowen and Kornberg,
1978). In lane 3, (FIG. 25) the DNA polymerase .delta. is incubated
with the linear. DNA in the absence of the clamp, and lane 4 showes
the result of adding the PCNA clamp. The results demonstrate that
the clamp is able to thread onto the DNA ends and stimulate the DNA
polymerase in the absence of ATP and thus, the absence of clamp
loading.
[0523] This clamp loader independent assay is performed in the
T.th. system in FIG. 25C. The assay reaction is exactly as
described above for use of the E. coli Pol III and beta system
except the temperature is 60.degree. C. and here the Pol III is
HEP.P1 T.th. Pol III (0.5 .mu.l, providing 0.1 units where one unit
is equal to 1 pmol of dTTP incorporated in 1 minute under these
conditions and in the absence of beta), and the beta subunit is 7
.mu.g T.th. .beta. (from the MonoQ column). Proteins were added to
the reaction on ice, then shifted to 37.degree. C. for 60 min. DNA
synthesis was quantitated using DE81 paper as described (Rowen and
Komberg, 1978). In lane 3 (FIG. 25C), the T.Th. Pol III is
incubated with the linear DNA in the absence of the clamp, and lane
4 shows the result of adding the T.th. .beta. clamp. The results
demonstrate that the clamp is able to thread onto the DNA ends and
stimulate the DNA polymerase in the absence of clamp loader
activity.
EXAMPLE 16
[0524] Use of T.th. Pol III in Long Chain Primer Extension
[0525] A characteristic of Pol III-type enzymes is their ability to
extend a single primer for several kilobases around a long (e.g. 7
kb) circular single stranded DNA genome of a bacteriophage. This
reaction uses the circular .beta. clamp protein. For the circular
.beta. to be assembled onto a circular DNA genome, the circular
.beta. must be opened, positioned around the DNA, and then closed.
This assembly of the circular beta around DNA requires the action
of the clamp loader, which uses ATP to open and close the ring
around DNA. In this example, the 7.2 kb circular single strand DNA
genome of bacteriophage M13mp18 was used as a template. This
template was primed with a single DNA 57mer oligonucleotide and the
Pol III enzyme was tested for conversion of this template to a
double strand circular form (RFII). The reaction was supplemented
with recombinant T.th. .beta. produced in E. coli. This assay is
summarized in the scheme at the top of FIG. 26. M13mp18 ssDNA was
phenol extracted from phage purified as described (Turner and
O'Donnell, 1995). M13mp18 ssDNA was primed with a 57mer DNA
oligomer synthesized by Oligos etc. The replication assays
contained 73 ng singly primed M13mp18 ssDNA and 100 ng T.th. .beta.
subunit in a 25 .mu.l reaction containing 20 mM Tris-HCl (pH 7.5),
8 mM MgCl.sub.2, 40 .mu.g/ml BSA, 0.1 mM EDTA, 4% glycerol, 0.5 mM
ATP, 60 .mu.M each of dCTP, dGTP, dATP and 20 .mu.M
.alpha.-.sup.32P-TTP (specific activity 2,000-4,000 cpm/pmol).
Either T.th. Pol III from the Heparin, peak 1 (HEP.P1; 5 .mu.l,
0.21 units where 1 unit equals 1 pmol nucleotide incorporated in 1
min.) or a non-Pol III from the Heparin peak 2 (HEP.P2; 5 .mu.l,
2.6 units) were added to the reaction. Reactions were shifted to
60.degree. C. for 5 min., and then DNA synthesis was quenched upon
adding 25 .mu.l of 1% SDS, 40 mM EDTA. One half of the reaction was
analyzed in a 0.8% native agarose gel, and the other half was
quantitated using DE81 paper as described (Studwell and O'Donnell,
1990).
[0526] The results of the assay are shown in FIG. 26. Lane 1 is the
result obtained using the T.th. Pol III (HEP.P1) which was capable
of extending the primer around the ssDNA circle to form RFII. Lane
2 shows the result of using the non-Pol III (HEP.P2) which was not
capable of this extension and produced only incomplete DNA products
(the result shown included 0.8 .mu.g E. coli SSB which did not
increase the chain length of the product). In the absence of SSB,
the same product was observed, although the band contained more
counts. The greater amount of total synthesis observed in lane 2 is
due to the build up of inmmature products in a small region of the
gel. The presence of immature products in lane 1 is likely due to a
contaminating polymerase in the preparation that can not convert
the single primer to the full length RFII form. Alternatively, the
presence of incomplete products in lane 1 (Pol III type enzyme) is
due to secondary structure in the DNA which causes the Pol III to
pause. In this case it may be presumed that performing the reaction
at higher temperature could remove the secondary structure barrier.
Alternatively, SSB could be added to the assay (although T.th. SSB
would be needed, because addition of E. coli SSB was tried and did
not alter the quality of the product profile). Generally, SSB is
needed to remove secondary structure elements from ssDNA at
37.degree. C. for complete extension of primers by mesophilic Pol
III-type enzymes.
[0527] The assay described above was performed at 60.degree. C. The
T.th. Pol III HEP.P1 gained activity as the temperature was
increased from 37.degree. C. to 60.degree. C., as expected for an
enzyme from a thermophilic source. The E. coli Pol III lost
activity at 60.degree. C. compared to 37.degree. C., as expected
for an enzyme from a mesophilic source.
EXAMPLE 17
[0528] Materials used in Examples 18-29
[0529] Radioactive nucleotide were from Dupont NEN; unlabeled
nucleotides were from Pharmacia Upjohn. DNA oligonucleotides were
synthesized by Gibco BRL. M13mp18 ssDNA was purified from phage
that was isolated by two successive bandings in cesium chloride
gradients. M13mp18 ssDNA was primed with a 30-mer (map position
6817-6846) as described. The pET protein expression vectors and
BL21 (DE3) protein expression strain of E. coli were purchased from
Novagen. DNA modification enzymes were from New England Biolabs.
Aquifex aeolicus genomic DNA was a gift of Dr. Robert Huber and Dr.
Karl Stetter (Regensburg University, Germany). Protein
concentrations were determined by absorbance at 280 nm using
extention coefficients calculated from their known Trp and Tyr
content using the equation .epsilon..sub.280=Trp.sub.m (5690
M.sup.-1 cm.sup.-1)+Tyr.sub.n (1280 M.sup.-1 cm.sup.-1).
EXAMPLE 18
[0530] Purification of .alpha. Encoded by dnaE
[0531] The Aquifex aeolicus dnaE gene was previously identified
(Deckert et al., 1998). The dnaE was obtained by searching the
Aquifex aeolicus genome with the amino acid sequence of T.th
.alpha. subunit (encoded by dnaE). The dnaE gene was amplified from
Aquifex aeolicus genomic DNA by. PCR using the following primers:
the upstream 37mer (5'-GTGTGTCATATGAGTAAGGATTTCGTCCACCTTCACC-3')
(SEQ. ID. No. 157) contains an NdeI site (underlined); the
downstream 34mer (5'-GTGTGTGGATCCGGGGACTAC- TCGGAAGTAAGGG-3') (SEQ.
ID. No. 158) contains a BamHI site (underlined). The PCR product
was digested with NdeI and BamHI, purifed, and ligated into the
pET24 NdeI and BamHI sites to produce pETAadnaE.
[0532] The pETAadnaE plasmid was transformed into the BL21 (DE3)
strain of E. coli. Cells were grown in 50 L of LB containing 100
.mu.g/ml of kanamycin, 5 mM MgSO.sub.4 at 37.degree. C. to
OD.sub.600=2.0, induced with 2 mM IPTG for 20 h at 20.degree. C.,
then collected by centrifugation. Cells were resuspended in 400 ml
50 mM Tris-HCl (pH 7.5), 10% sucrose, 1M NaCl, 30 mM spermidine, 5
mM DTT and 2 mM EDTA. The following procedures were performed at
4.degree. C. Cells were lysed by passing them twice through a
French Press (15,000 psi) followed by centrifugation at 13,000 rpm
for 90 min at 4.degree. C. In this protein preparation, as well as
each of those that follow, the induced Aquifex aeolicus protein was
easily discernible as a large band in an SDS polyacrylamide gel
stained with Coomassie Blue. Hence, column fractions were assayed
for the presence of the Aquifex aeolicus protein by SDS PAGE
analysis, which forms the basis for pooling column fractions.
[0533] The clarified cell lysate was heated to 65.degree. C. for 30
min and the precipitate was removed by centrifugation at 13,000 rpm
in a GSA rotor for 1 h. The supernatant (1.4 gm, 280 ml) was
dialyzed against buffer A (20 mM Tris-HCl (pH 7.5)), 10% glycerol,
0.5 mM EDTA, 5 mM DTT) overnight, then diluted to 320 ml with
buffer A to a conductivity equal to 100 mM NaCl. The dialysate was
applied to a 150 ml Fast Flow Q (FFQ) Sepharose column (Pharmacia)
equilibrated in buffer A, and eluted with a 1.5 L linear gradient
of 0-500 mM NaCl in buffer A. Eighty fractions were collected.
Fractions 38-58 (1 g, 390 ml) were pooled, dialyzed versus buffer A
overnight, and applied to a 250 ml Heparin Agarose column (Bio-Rad)
equilibrated with buffer A. Protein was eluted with a 1 L linear
0-5 mM NaCl gradient in buffer A. One hundred fractions were
collected. Fractions 69-79 (320 mg in 200 ml) were pooled and
dialyzed against buffer A containing 100 mM NaCl. The .alpha.
preparation was aliquoted and stored frozen at -80.degree. C. (see
FIG. 27).
EXAMPLE 19
[0534] Purification of .delta. Encoded by holA
[0535] The Aquifex aeolicus holA gene was not previously identified
by the genome sequencing group at Diversa (Deckert et al., 1998).
Aquifex aeolicus holA was identified by searching the Aquifex
aeolicus genome with the amino acid sequence of the T.th. .delta.
subunit (encoded by holA). The Aquifex aeolicus holA was amplified
by PCR using the following primers: the upstream 36mer
(5'-GTGTGTCATATGGAAACCACAATATTCCAGTTCCAG-3') (SEQ. ID. No. 159)
contains an NdeI site (underlined); the downstream 39mer
(5'-GTGTGTGGATCCTTATCCACCATGAGAAGTATTTTTCAC-3') (SEQ. ID. No. 160)
contains a BamHI site (underlined). The PCR product was digested
with NdeI and BamHI, purified, and ligated into the pET24 NdeI and
BamHI sites to produce pETAaholA.
[0536] The pETAaholA plasmid was transformed into E. coli strain
BL21 (DE3). Cells were grown in 50 L of LB media containing 100
.mu.g/ml kanamycin. Cells were grown at 37.degree. C. to
OD.sub.600=2.0, induced for 20 h upon addition of 2 mM IPTG, then
collected by centrifugation. Cells from 25 L of culture were lysed
as described in Example 18.
[0537] The cell lysate was heated to 65.degree. C. for 30 min and
the precipatate was removed by centrifugation. The supernatant (650
mg, 240 ml) was dialyzed against buffer A, adjusted to a
conductivity equal to 160 mM NaCl by addition of 40 ml of buffer A,
and applied to a 220 ml Heparin Agarose column equilibrated in
buffer A containing 100 mM NaCl. The column was eluted with 1.0 L
linear gradient of 150-700 mM NaCl in buffer A. One hundred and
four fractions were collected. Fractions 45-56 were pooled (250 mg,
210 ml), diluted with 230 ml buffer A to a conductivity equal to
230 mM NaCl, then loaded onto a 100 ml FFQ Sepharose column
equilbrated in buffer A containing 150 mM NaCl. The column was
eluted with 200 ml linear gradient of 150-750 mM NaCl in buffer A;
seventy-three fractions were collected. Fractions 16-38 were pooled
(95 mg, 40 ml), aliquoted, and stored at -80.degree. C. (see FIG.
27).
EXAMPLE 20
[0538] Purification of .delta.' Encoded by holB
[0539] The Aquifex aeolicus holB gene was previously identified by
the genome sequencing facility at Diversa (Deckert et al., 1998).
The Aquifex aeolicus holB sequence was obtained by searching the
Aquifex aeolicus genome with the sequence of the T.th. .delta.'
(encoded by holB). The Aquifex aeolicus holB gene was amplified by
PCR using the following primers: the upstream 39mer
(5'-GTGTGTCATATGGAAAAAGTTTTTGGAAA AAACTCCAG-3') (SEQ. ID. No. 161)
contains an NdeI site (underlined); the downstream 35mer
(5'-GTGTGTGGATCCTTAATCCGCCTGAACGGCTAACG-3') (SEQ. ID. No. 162)
contains a BamHI site (underlined). The PCR product was digested
with NdeI and BamHI, purified, and ligated into the pET24 NdeI and
BamHI site to produce pETAaholB.
[0540] The pETAaholB plasmid was transformed into E. coli strain
BL21 (DE3). Cells were grown at 37.degree. C. in 50 L media
containing 100 .mu.g/ml kanamycin to OD.sub.600=2.0, then induced
for 3 h upon addition of 0.2 mM IPTG. Cells were collected by
centrifugation and were lysed using lysozyme by the heat lysis
procedure (Wickner and Komberg, 1974). The cell lystate was heated
to 65.degree. C. for 30 min and precipatate was removed by
centrifugation. The supernatant (2.4 g, 400 ml) was dialyzed versus
buffer A, then applied to a 220 ml FFQ Sepharose column
equilibrated in buffer A. Protein was eluted with a 1 L linear
gradient of 0-500 mM NaCl in buffer A; eighty fractions were
collected. Fractions 23-30 were pooled and diluted 2-fold with
buffer A to a conductivity equal to 100 mM NaCl, then loaded onto a
200 ml Heparin Agarose column equilibrated in buffer A. Protein was
eluted with a 1 L linear gradient of 0-1.0M NaCl in bufferA;
eighty-four fractions were collected. Fractions 46-66 were pooled
(1.3 g, 395 ml), dialyzed versus buffer A containing 100 mM NaCl,
then aliquoted and stored frozen at -80.degree. C. (see FIG.
27)
EXAMPLE 21
[0541] Purification of .tau. Encoded by dnaX
[0542] The Aquifex aeolicus dnaX gene was previously identified.
(Deckert et al., 1998). The dnaX gene sequence was obtained by
searching the Aquifex aeolicus genome with the sequence of T.th.
.tau. subunit (encoded by dnaX). The Aquifex aeolicus dnaX was
amplified by PCR using the following primers: the upstream 41mer
(5'-GTGTGTCATATGAACTACGTTCCCTTCGCGA- GAAAGTACAG-3') (SEQ. ID. No.
163) contains an NdeI site (underlined); the downstream 36mer
(5'-GTGTGTGGATCCTTAAAACAGCCTCGTCCCGCTGGA-3') (SEQ. ID. No. 164)
contains a BamHI site (underlined). The PCR product was digested
with NdeI and BamHI, purified, and ligated into the pET24 NdeI and
BamHI sites to produce pETAadnaX.
[0543] The pETAadnaX plasmid was transformed into E. coli strain
BL21 (DE3). Cells were grown in 50 L LB containing 100 .mu.g/ml
kanamycin at 37.degree. C. to OD.sub.600=0.6, then induced for 20 h
at 20.degree. C. upon addition of IPTG to. 0.2 mM. Cells were
collected by centrifugation and lysed as described in Example 18.
The clarified cell lysate was heated to 65.degree. C. for 30 min
and the protein precipitate was removed by centrifugation. The
supernatant (1.1 g in 340 ml) was treated with 0.228 g/ml ammonium
sulfate followed by centrifugation. The .tau. subunit remained in
the pellet which was dissolved in buffer B (20 mM Hepes (pH 7.5),
0.5 mM EDTA, 2 mM DTT, 10% glycerol) and dialyzed versus buffer B
to a conductivity equal to 87 mM NaCl. The dialysate (1073 mg, 570
ml) was applied to a 200 ml FFQ Sepharose column equilibrated in
buffer A. The column was eluted with a 1.5 L linear gradient of
0-500 mM NaCl in buffer A; eighty fractions were collected.
Fractions 28-37 were pooled (289 mg, 138 ml), dialyzed against
buffer A to a conductivity equal to 82 mM NaCl, then loaded onto a
150 ml column of Heparin Agarose equilibrated in buffer A. The
column was eluted with a 900 ml linear gradient of 0-500 mM NaCl in
buffer A; thirty-two fractions were collected. Fractions 15-18 (187
mg, 110 ml) were. dialyzed versus buffer A, then aliquoted and
stored at -80.degree. C. (see FIG. 27).
EXAMPLE 22
[0544] Purification of .beta. Encoded by dnaN
[0545] The Aquifex aeolicus dnaN gene was previously identified
(Deckert et al., 1998). The dnaNsequence was obtained by searching
the Aquifex aeolicus genome with the sequence of T.th. .beta.
subunit (encoded by dnaN). The Aquifex aeolicus dnaN gene was
amplified by PCR using the following primers: the upstream 33mer
(5'-GTGTGTCATATGCGCGTTAAGGTGGACAGGG- AG-3') (SEQ. ID. No. 165)
contains an NdeI site (underlined); the downstream 36mer
(5'-TGTGTCTCGAGTCATGGCTACACCCTCATCGGCAT-3') (SEQ. ID. No. 166)
contains a XhoI site.(underlined). The PCR product was digested
with NdeI and Bamffl, purified, and ligated into the pET24 NdeI and
BamHI sites to produce pETAadnaN.
[0546] The pETAadnaN plasmid was transformed into E. coli strain
BL21 (DE3). Cells were grown in 1 L LB containing 100 mg/ml
kanamycin at 37.degree. C. to OD.sub.600=1.0, then induced for 6 h
upon addition of 2 mM IPTG. Cells were collected (7 g) and lysed as
described in Example 18. The cell lysate was heated to 65.degree.
C. for 30 min and the protein precipitate was removed by
centrifugation. The supernatant (39 mg, 45 ml) was applied to a 10
ml DEAE Sephacel column (Pharmacia) equilibrated in buffer A. The
column was eluted with a 100 ml linear gradient of 0-500 mM NaCl in
bufferA; seventy-five fractions were collected. Fractions 45-57
were pooled (18.7 mg), dialyzed versus buffer A, and applied to a
30 ml Heparin Agarose column equilibrated in buffer A. The column
was eluted with a 300 ml linear gradient of 0-500 mM NaCl in buffer
A; sixty-five fractions were collected. Fractions 27-33 were pooled
(11 mg, 28 ml) and stored at -80.degree. C. (see FIG. 27).
EXAMPLE 23
[0547] Purification of SSB Encoded by ssb
[0548] The Aquifex aeolicus ssb gene was previously identified
(Deckert et al., 1998g). The ssb gene sequence was obtained by
searching the Aquifex aeolicus genome with the sequence of T.th.
SSB (encoded by ssb). The Aquifex aeolicus ssb gene was amplified
by PCR using the following primers: the upstream 47mer
(5'-GTGTGTCATATGCTCAA TAAGGTTTTTATAATAGGAAGAC- TTACGGG-3') (SEQ.
ID. No. 167) contains an NdeI site (underlined); the downstream
39mer (5'-GTGTGGATCCTTA AAAAGGTATTTCGTCCTCTTCATCGG-3') (SEQ. ID.
No. 168) contains a BamHI site (underlined). The PCR product was
digested with NdeI and BamHI, purified, and ligated into the pET16
NdeI and BamHI sites to produce pETAassb.
[0549] The pETAassb plasmid was transformed into E. coli strain
BL21 (DE3). Cells were grown in 6 L of LB media containing 200
.mu.g/ml ampicillin. Cells were grown at 37.degree. C. to
OD.sub.600=0.6, then induced at 15.degree. C. overnight in the
presence of 2 mM IPTG and collected by centrifugation. Cells were
lysed as described above in Example 18, except cells were
resuspended in buffer C (20 mM Tris-HCl (pH 7.9), 500 mM NaCl).
[0550] The cell lysate was heated to 65.degree. C. for 30 min, then
the precipitate was removed by centrifugation. The supernatant (1.4
g, 190 ml) was applied to 25 ml Chelating Sepharose column
(Pharmacia-Biotech) charged with 50 mM Nickel Sulfate and then
equilibrated in buffer C containing 5 mM Imidazole. The column was
eluted with a 300 ml linear gradient of 5-100 mM Imidazole in
buffer C. Fractions of 4 ml were collected. Fractions 81-92 were
pooled (240 mg in 48 ml) and dialyzed overnight against 2 L of
buffer B containing 200 mM NaCl. The dialysate was diluted to a
conductivity equal to 92 mM NaCl using buffer A and then loaded
onto an 8 ml MonoQ column equilibrated in buffer A containing 100
mM NaCl. The column was eluted with a 120ml linear gradient of
100-500 mM Imidazole in buffer A. Seventy-four fractions were
collected. Fractions 57-70 were pooled (100 mg, 25 ml), aliquoted,
and stored at -80.degree. C. (see FIG. 27).
EXAMPLE 24
[0551] MonoQ Preparation of .tau..delta..delta.'
[0552] The .delta. subunit (0.29 mg) purified in Example 19 and
.delta.' subunit (0.31 mg) purified in Example 20 were mixed in a
volume of 2.8 ml of buffer A at 15.degree. C. After 30 min, the
.tau. subunit (0.5 mg in 1.4 ml), purified in Example 21, was added
and the reaction was incubated a further 1 h at 15.degree. C. The
reaction was applied to a 1 ml MonoQ column equilibrated in buffer
A. The .tau..delta..delta.' complex elutes later than either .tau.,
.delta. or .delta.' alone. Protein was eluted with a 32 ml linear
gradient of 100-500 mM NaCl in buffer A; eighty fractions were
collected. Analysis of the MonoQ fractions in a SDS polyacylamide
gel shows a peak of .tau..delta..delta.' complex that elutes in
fractions of 32-38 (see FIG. 28). The peak fractions 850 .mu.g were
stored at -80.degree. C. This procedure can easily be scaled up.
For example, a much larger amount of .tau..delta..delta.' was
constituted by following a similar protocol and using a 8 ml MonoQ
column, which yielded 9.6 mg of .tau..delta..delta.'.
EXAMPLE 25
[0553] Constitution of .alpha..tau..delta..delta.' Complex
[0554] The reaction mixture contained 1.2 mg .alpha.subunit (9
nmol; 133,207 da) purified in Example 18, 0.41 mg .tau. subunit
(7.5 nmol; 54,332 da) purified in Example 21, 0.41 mg .delta.
subunit (10 nmol; 40,693 da) purified in Example 19, and 0.2 mg
.delta.' subunit (9 nmol; 29,000 da) purified in Example 20 in 1.1
ml buffer A. The .alpha. and .tau. subunit solutions were premixed
in 871 .mu.l for 2 h at 15.degree. C. before adding .delta. and
.delta.' subunit solution, then the complete mixture was allowed to
incubate an additional 12 h at 15.degree. C. The reaction may not
require an order of addition, or these extended incubation times.
The reaction mixture was concentrated to 200 .mu.l using a
Centricon 30 at 4.degree. C., then applied to an FPLC Superose 6 HR
10/30 column (25 ml) at 4.degree. C. developed with a continuous
flow of buffer A containing 100 mM NaCl. After the first 216 drops
(6.6 ml), fractions of 7 drops each were collected. Fractions were
analyzed on a SDS polyacrylamide gel stained with Coomassie Blue
(FIG. 29). The analysis was repeated using the a subunit alone
(FIG. 29). The results show that the peak fractions of .alpha.
shift to a considerably earlier position when .tau., .delta. and
.delta.' are present and .alpha. comigrates with .tau., .delta.,
and .delta.', when compared, to the elution position of .alpha.
alone, indicating that a assembles with .tau., .delta. and .delta.'
into a .alpha..tau..delta..delta.' complex.
EXAMPLE 26
[0555] .alpha..tau..delta..delta.' Functions with the .beta.
Clamp
[0556] Replication reactions were performed using circular M13mp18
ssDNA primed with a synthetic DNA 90 mer oligonucleotide. Reactions
contained 8.6 kg primed M13mp18 ssDNA, 9.4 kg SSB purified in
Example 23, 1.0 .mu.g .alpha..tau..delta..delta.' prepared in
Example 25, and 2.0 .mu.g .beta. subunit purified in Example 22
(when present), in 230 .mu.l of 20 mM Tris-HCl (pH 7.5), 5 mM DTT,
4% glycerol, 8 mM MgCl.sub.2, 0.5 mM ATP, 60 .mu.M each dATP and
dGTP (buffer composition is for a final volume of 250 .mu.l).
Reactions were mixed on ice, then aliquoted into separate tubes
containing 25 .mu.l each. For each timed reaction, the mixture was
brought to 65.degree. C. for 2 min before initiating syntheses upon
addition of 2 .mu.l of dCTP and .alpha..sup.32P-dTTP (final
centrations, 60 and 40 .mu.M, respectively). Aliquots were quenched
at the times indicated in FIG. 30 upon adding 4 .mu.l of 0.25M
EDTA, 1% SDS. Quenched reactions were then analyzed in a 0.8%
alkaline agarose gel. The results, illustrated in FIG. 30,
demonstrate that efficient synthesis requires addition of the
.beta. subunit. Comparison with size standards in the same gel
indicates an average speed of .about.125 nucleotides; the leading
edge of the product smear indicates a maximum speed of 375
nucleotides/s.
EXAMPLE 27
[0557] Purification of Tth. .alpha. Subunit
[0558] To obtain T.th. .alpha. subunit, 8 L of E. coli BL21(DE3)
cells harboring pETtthalpha were grown to O.D.=0.3 and induced upon
adding IPTG. Cells were collected by centrifugation and resuspended
in 200 ml 50 mM Tris-HCl (pH 7.5), 10% sucrose, 1M NaCl, 30 mM
spermidine, 5 mM DTT and 2 mM EDTA. The following procedures were
performed at 4.degree. C. Cells were lysed by passing them three
times through a French Press (20,000 psi) followed by incubation at
4.degree. C. for 30 min and then centrifugation at 18,000 rpm in an
SS-34 rotor for 45 min at 4.degree. C. Induced protein was less
that 1% total cell protien but was discernible as a band that
migrated in the appropriate position for its predicted molecular
weight in an SDS polyacrylamide gel stained with Coomassie Blue.
Hence, column fractions were assayed for the presence of the
protein by SDS PAGE analysis, which forms the basis for pooling
column fractions.
[0559] The clarified cell lysate was heated to 65.degree. C. for 30
min and the precipitate was removed by centrifugation. The
supernatant (1.4 gm, 280 ml) was dialyzed against buffer A (20 mM
Tris-HCl (pH 7.5), 10% glycerol, 0.5 mM EDTA, 5 mM DTT) overnight,
then diluted to 320 ml with buffer A to a conductivity equal to 100
mM NaCl. The dialysate (approximately 150 mg) was applied to a 60
ml DEAE Fast Flow Q (FFQ) Sepharose column (Pharmacia) equilibrated
in buffer A, and eluted with a 600 ml linear gradient of 0-500 mM
NaCl in buffer A. Fractions of 8 ml each were collected. The Tth.
.alpha. subunit could be seen as a major band in several fractions,
especially in fractions 26-30. In these peak fractions the Tth.
.alpha. subunit was approximately 20-30 percent pure.
EXAMPLE 28
[0560] Purification of Tth. .epsilon. Subunit
[0561] The dnaQ gene was cloned into the pET16 expression plasmid
using the Val within the context "VGLWEW . . . " and transformed
into E. coli (BL21(DE3). This pET plasmid places an N-terminal
leader containing six histidines onto the expressed protein to
facilitate purification via use of chelate affinity chromatography.
Twelve liters of cells were grown to an OD of 0.7 and induced with
IPTG. Induced cells were collected by centrifugation and
resuspended in 150 ml of buffer C (20 mM Tris-HCl (pH 7.9), 500 mM
NaCl). Cells were lysed by passing them two times through a French
Press (20,000 psi) followed by incubation at 4.degree. C. for 30
min and then centrifugation at 13,800 rpm in an SLA-1500 rotor for
45 min at 4.degree. C. Induced protein appeared greater than 5%
total cell protien and was easily discernible as a band that
migrated in the appropriate position for its predicted molecular
weight in an SDS polyacrylamide gel stained with Coomassie Blue.
Hence, column fractions were assayed for the presence of the
protein by SDS PAGE analysis, which forms the basis for pooling
column fractions.
[0562] Upon analyzing the precipitate from the cell lysis, and the
supernatent, it was determined that the epsilon subunit was
insoluble and appeared in the precipitate. Therefore the cell
pellet was resuspended in 100 ml of binding buffer containing 6M
freshly deionized urea. This resuspension was then placed in
centrifuge bottles and spun at 13,800 rpm for 45 min in the
SLA-1500 rotor. The epsilon was in the supernatent and was applied
to a 25 ml Chelating Sepharose column (Pharmacia-Biotech) charged
with 50 mM Nickel Sulfate and then equilibrated in buffer C
containing 5 mM Imidazole. The column was washed with two column
volumes of buffer C, then washed with 5 column volumes of beffer C
containing 80 mM Imidazole (final). Then the Tth epsilon was eluted
with a 250 ml linear gradient of 60-1000 mM Imidazole in buffer C.
Fractions of 4 ml were collected. Fractions 15-24 were pooled
(.about.131 mg) and dialyzed overnight against 2 L of buffer A
containing 6M urea, but no NaCl or glycerol. The dialysate was then
loaded onto an 8 ml MonoQ column equilibrated in buffer A
containing 6M urea. The column was eluted with a 120 ml linear
gradient of 0-500 mM NaCl in buffer A containing urea. Sixty five
fractions were collected. The epsilon is approximately 80-90
percent pure at this stage. Fractions 13-17 were stored at
-80.degree. C. The epsilon is in urea but is at a concentration of
5-10 mg/ml, and thus can be used with other proteins by diluting it
such that the final urea concentration is less than 0.5 M. This
level of urea does not generally denature protein, and should allow
epsilon to renature for catalytic activity.
EXAMPLE 29
[0563] Temperature Optimum of Aquifex and Thermus .alpha. Subunit
DNA Polymerases
[0564] The temperature optimum of the alpha subunits of the Aquifex
and Thermus replicases was tested in the calf thymus DNA
replication assay. In this experiment, the reactions were assembled
on ice in 25 .mu.l containing 2.5 .mu.g calf thymus activated DNA,
and either 0.88 ug Aquifex .alpha., or 0.6 .mu.g of the Thermus
.alpha. DEAE pool of peak fractions (obtained from Examples 18 and
28, respectively) in 20 mM Tris-HCl (pH 8.8), 8 mM MgCl.sub.2, 10
mM KCl, 10 mM (NH.sub.4)SO.sub.4, 2 mM MgSO.sub.4, 0.1% Triton
X-100, 60 .mu.M each dATP, dCTP, dGTP, and 20 .mu.M
.alpha..sup.32P-dTTP. Reactons were shifted to either 30, 40, 50,
60, 70, 80, or 90.degree. C., then stopped after 5 minutes and
spotted onto DE81 filters to quantitate DNA synthesis. The results,
illustrated in FIGS. 31-32, show that these enzymes increase in
activity as the temperature is raised. The Thermus a has a broad
peak of activity from 70-80.degree. C. (FIG. 31), while the Aquifex
a is maximal at 80.degree. C. (FIG. 32). The Aquifex .alpha.
retains considerable activity at 90.degree. C., whereas the Thermus
.alpha. is nearly inactive at 90.degree. C., a result that is
consistent with the higher temperature at which the Aquifex
aeolicus may live relative to the Thermus bacterium.
EXAMPLE 30
[0565] Temperature Optimum of Aquifex
.alpha..tau..delta..delta.'/.beta.
[0566] Aquifex .alpha., .beta., .tau..delta..delta.', SSB and
.alpha..tau..delta..delta.' were tested for stability at different
temperatures by incubating the protein in a solution, followed by
performing a replication assay of the protein. Incubation was
performed in 0.4 ml tubes under mineral oil. The 5 .mu.l reaction
mixture contained: buffer B (20 mM Tris-HCl (pH 7.5), 5 mM DTT, 5
mM EDTA), and either: 0.352 .mu.g of .alpha. (FIG. 33A), 0.2 .mu.g
of .beta. (FIG. 33B), 0.125 .mu.g .tau. complex (FIG. 33C), 0.32
.mu.g SSB and 0.042 .mu.g primed M13mp18 ssDNA (FIG. 33D), 0.82
.mu.g Pol III* (FIG. 33E). Reactions were incubated for 2 min. at
either 70, 80, 85, or 90.degree. C. in the presence of either 0.1%
Triton X-100 (filled diamonds); 0.05% Tween-20 and 0.01% NP-40
(filled circles); 4 mM CaCl.sub.2 (filled triangles); 40% Glycerol
(inverted filled triangles); 0.01% Triton X-100, 0.05% Tween-20,
0.01% NP-40, 4 mM CaCl.sub.2 (half-filled square); 40% Glycerol,
0.1% Triton X-100 (open diamonds); 40% Glycerol, 0.05% Tween-20,
0.01% NP-40 (open circles); 40% Glycerol, 4 mM CaCl.sub.2 (open
triangles); 40% Glycerol, 0.01% Triton X-100, 0.05% Tween-20, 0.01%
NP-40, 4 mM CaCl.sub.2 (half-filled diamonds). After heating,
reactions were shifted to ice and 20 .mu.l of replication assay
buffer was added followed by incubation for 1.5 min at 70.degree.
C.; 15 .mu.l was then spotted onto a DE81 filter and DNA synthesis
was quantitated. The replication assay buffer contained: 60 mM
Tris-HCl (pH 9.1 at 25.degree. C.), 8 mM MgCl.sub.2, 18 mM
(NH.sub.4).sub.2SO.sub.4, 2 mM ATP, 60 .mu.M each of dATP, dCTP,
dGTP, and 20 .mu.M [.alpha..sup.-32P]TTP (specific activity 10,000
cpm/pmol), and 0.264 .mu.g primed M13mp18 ssDNA. To assay for
.beta., 0.1 ng .alpha..tau..delta..delta.' was added to the
reaction. To assay .tau..delta..delta.', 0.9 ng .beta. and 0.17 ng
.alpha. were added to the reaction. To assay for SSB, 0.17 ng E.
coli .beta. and 0.1 ng E. coli .alpha..tau..delta..delta.' were
added to the reaction followed by incubation for 1.5 min at
37.degree. C. To assay for .alpha..tau..delta..delta.', 0.9 ng
.beta. was added to the reaction. To assay .alpha., the calf thymus
DNA replication assay was performed in the buffer as described
above but 2.5 .mu.g activated calf thymus DNA was used instead of
primed M13mp18 ssDNA, no other replication proteins were added, and
incubation was for 8 min at 70.degree. C.
[0567] References
[0568] The following is a list of documents related to the above
disclosure and particularly to the experimental procedures and
discussions. The documents should be considered as incorporated by
reference in their entirety.
[0569] Alonso, J. C., Shirahige, K., and Ogasawara, N. (1990)
Molecular cloning, genetic characterization and DNA sequence
analysis of the recM region of Bacillus subtilis. Nuc. Acids Res.
18:6771-6777.
[0570] Altschul et al., (1997) Gapped BLAST and PSI-BLAST: A new
generation of protein database search programs. Nucl. Acids Res.
25:3389-3402.
[0571] Ausubel, R. M., ed., Current Protocols in Molecular Biology,
Vol. I-III (1994).
[0572] Bambara, R. A., and Jessee, C. B. (1991) Properties of DNA
polymerases .delta. and .epsilon., and their role in eukaryotic DNA
replication. Biochimica et Biophysica Acta 1.088:11-24.
[0573] Barnes, M. H., Tarantino, Jr., P. M., Spaccioappoli, P.,
Brown, N. C., Yu, H., and Dybvig, K. (1994) DNA poiymerase III of
Mycoplasma pulmonis: isolation of characterization of the enzyme
and its structural gene, polC. Molec Microbiol. 13:843-854.
[0574] Barnes, W. M., (1994) PCR amplification of up to 35-kb DNA
with high fidelity and high yield from lambda bacteriophage
templates. Proc. Natl. Acad. Sci. USA 91:2216-2220.
[0575] Bauer, G. A., and Burgers, P. M. (1988) Protein-protein
interactions of yeast DNA polymerase III with mammalian and yeast
proliferating cell nuclear antigen (PCNA)/cyclin. Biochim. Biophys.
Acta 951(2-3):274-9.
[0576] Blinkowa, A. L., and Walker, J. R., (1990) Programmed
ribosomal frameshifting generates the Escherichia coli DNA
polymerase III gamma subunit from within the tau subunit reading
frame. Nucl. Acids Res. 18(7):1725-1729.
[0577] Bonner, C. A., Stukenberg, P. T., Rajagopalan, M., Eritja,
R., O'Donnell, M., McEntee K, Echols, H., and Goodman, M. F. (1992)
Processive DNA synthesis by DNA polymerase II mediated by DNA
polymerase III accessory proteins. J. Biol. Chem.,
267:11431-11438.
[0578] Braithwaite, D. K., and Ito, J. (1993) Compilation,
alignment, and phylogenetic relationships of DNA polymerases. Nucl.
Acids Res. 21(4):787-802.
[0579] Brock, T. D., and Freeze, H., (1969) Thermus aquaticus gen.
n. and sp. n., a nonsporulating extreme thermophile. J. Bacteriol.
98(1):289-297.
[0580] Burgers, P. M., Yoder, B. L. (1993) ATP-independent loading
of the proliferating cell nuclear antigenrequires DNA ends. J.
Biol. Chem. 268(27):19923-19926.
[0581] Caetano-Anolles et al., (199.1) DNA amplification
fingerprinting using very short arbitrary oligonucleotide primers.
Bio/Technology 9:553-557.
[0582] Carter, J. R., Franden, M. A., Aebersold, R., and McHenry,
C. S. (1993) Identification, isolation, and characterization of the
structural gene encoding the .delta.' subunit of E. coli DNA
polymerase III holoenzyme. J. Bacteriol. 175:3812-3822.
[0583] Celis, J. E., ed.; Cell Biology: A Laboratory Handbook, Vol.
I-III (1994).
[0584] Chen, M., Pan, Z.-Q., and Hurwitz, J. (I992) Studies of the
cloned 37-kDa subunit of activator 1 (replication factor C) of HeLa
cells. Proc. Natl. Acad. Sci. USA 89(12):5211-5215.
[0585] Cheng, S., Fockler, C.; Barnes, W. M., and Higuchi, R.,
(1994) Effective amplification of long targets from cloned inserts
and human genomic DNA. Proc. Natl. Acad. Sci. USA 91:5695-5699.
[0586] Coligan, J. E., ed., Current Protocols in Immunology, Vol,
I-III (1994).
[0587] Cullman, G., Fien, K., Kobayashi, R., and Stillman, B.
(1995) Characterization of the five replication factor C genes of
Saccharomyces cerevesiae. Mol. and Cell. Biol. 15:4661-4671.
[0588] Davis, L. G., Basic Methods In Molecular Biology, Elsevier
Edit., New York (1986).
[0589] Decket et al., (1998) The complete genome of the
hyperthermophilic bacterium Aquifex aeolicus. Nature
392:353-358.
[0590] Dulbecco, R., et al. (1959) Plaque production by the polyoma
virus. Virol. 8:396-397.
[0591] Edge, M. D., et al., (1981) Total synthesis of a human
leukocyte interferon gene. Nature 292:756.
[0592] Flower, A. M. and McHenry, C. S. (1990) The .gamma. subunit
of DNA polymerase III holoenzyme of Escherichia coli is produced by
ribosomal frameshifting. Proc. Natl. Acad. Sci. USA
87:3713-3717.
[0593] Freshney, R. I., ed., Animal Cell Culture (1986).
[0594] Gait, M. J., ed., Oligonucleotide Synthesis (1984).
[0595] Glover, ed., DNA Cloning: A Practical Approach, Vol. I &
II, MRL Press, Ltd., Oxford, U.K. (1985).
[0596] Guenther, B. D. (1996) Structural studies on the DNA
replication apparatus: X-ray crystal structure of the .delta.'
subunit of Escherichia coli DNA Pol III. Ph.D. Thesis, Rockefeller
University.
[0597] Guibus, J. M. Kelman, Z., Hurwitz, J., O'Donnell, M., and
Kuriyan, J. (1996) Structure of the C-terminal region of
p21waf1/cip1 complexed with human PCNA. Cell 87:297-306.
[0598] Hames, B. D., and Higgins, S. J., eds., Nucleic Acid
Hybridization (1985).
[0599] Hames, B. D., and Higgins, S. J., eds., Transcription and
Translation (1984).
[0600] Hammerling et al., Monoclonal Antibodies and T-cell
Hybridomas (1981).
[0601] Harlow and Lane, eds., Antibodies--A Laboratory Manual, Cold
Spring Harbor, N.Y. (1988).
[0602] Heath, D. D., Iwama, G. K., and Devlin, R. H., (1993) PCR
primed with VNTR core sequences yields species specific patterns
and hypervariable probes. Nuc. Acids Res. 21(24):5782-5785.
[0603] Hughes, Jr., A. J., Bryan, S. K., Chen, H., Moses, R. E.,
and McHenry, C. S. (1991) Escherichia coli DNA polymerase II is
stimulated by DNA polymerase III holoenzyme auxiliary subunits. J.
Biol. Chem. 266:4568-4573.
[0604] IRL Press, Publ., Immobilized Cells and Enzymes (1986).
[0605] Ito, J., and Braithwaite, D., (1991) Compilation and
alignment of DNA polymerase sequences. Nucl. Acids Res.
19(15):4045-4057 (1991).
[0606] Jacks, T., Madhami, H. D., Masiarz, F. R., and Varmus, H. E.
(1988) Signals for ribosomal frameshifting in the Rous sarcoma
virus gag-pol region. Cell 55:447-458.
[0607] Jay, E., et al., (1984) Chemical synthesis of a biologically
active gene for human immune interferon-gamma. Prospect for
site-specific mutagenesis and structure-function studies. J. Biol.
Chem. 259:6311-6317.
[0608] Kelman Z., and O'Donnell, M. (1995) DNA Polymerase III
holoenzyme: Structure and function of a chromosomal replicating
machine, Annu. Rev. Biochem., 64:171-200.
[0609] Kelman, Z., and O'Donnell, M. (1994) DNA replication:
enzymology and mechanisms. Current Opinions in Genetics and
Development 4:185-195.
[0610] Kennett et al., Monoclonal Antibodies (1980).
[0611] Kong, X.-P., Onrust, R., O'Donnell, M., and Kuriyan, J.
(1992). Three dimensional structure of the .beta. subunit of
Escherichia coli DNA polymerase III holoenzyme: a sliding DNA
clamp. Cell 69:425-437.
[0612] Kornberg, A., and Baker, T. (1992). DNA Replication, second
edition. (New York: W. H. Freeman and Company), pp. 165-194.
[0613] Krishna, T. S., Kong, X.-P., Gary, S., Burgers, P. M., and
Kuriyan, J. (1994) Crystal structure of the eukaryotic DNA
polymerase processivity factor PCNA. Cell 79(7): 1233-1243.
[0614] Kuriyan, J. and O'Donnell, M. (1993) Sliding clamps of DNA
polymerases. J. Mol. Biol. 234:915-925.
[0615] Larsen, B., Wills, N. M., Gesteland, R. F., and Atkins, J.
F. (1994) rRNA-mRNA base pairing stimulates a programmed -1
ribosomal frameshift. J. Bact. 176: 6842-6851.
[0616] Lin, J. J., and Kuo, J. (1995) Focus 17(2):66-70.
[0617] Linn, S. (1991) How many pols does it take to replicate
nuclear DNA? Cell 66:185-187.
[0618] Lee, S. H. and Walker, J. R. (1987) Escherichia coli dnaX
product, the .tau. subunit of DNA polymerase III, is a
multifunctiona protein with single-stranded DNA-dependent ATPase
activity. Proc. Natl. Acad Sci. USA 84:2713-2717.
[0619] Low, R. L., Rashbaum, S. A., and Cozzarelli, N. R. (1976)
Purification and characterization of DNA polymierase III from
Bacillus subtilis. J. Biol. Chem., 251:1311-1325.
[0620] Maki, H., Maki, S., and Komberg, A. (1988) DNA polymerase
III holoenzyme of Escherichia coli IV. The holoenzyme is an
asymmetric dimer with twin active sites. J. Biol. Chem.
263:6570-6578.
[0621] Maniatis, T., Fritsch, E. F., and Sambrook, J. (1992)
Molecular Cloning: A Laboratory Manual, Cold Spring Harbor
Laboratory, Cold Spring Harbor, N.Y.
[0622] McHenry, C. S. (1991) DNA Polymerase III Holoenzyme. J.
Biol. Chem., 266:19127-19130.
[0623] McHenry, C. S., and Crow, W. (1979) DNA polymerase III of
Escherichia coli: Purification and identification of Subunits. J.
Biol. Chem. 254(5):1748-1753.
[0624] McHenry, C. S. (1982) Purfication and characterization of
DNA polymerase III'. Identification of .tau. as a subunit of the
DNA polymerase III holoenzyme. J. Biol. Chem. 257:2657-2663.
[0625] Moarefi, I., Jeruzalmi, D., Turner, J., O'Donnell, M., and
Kuriyan, J. (2000). Crystal structure of the DNA polymerase
processivity factor of T4 bacteriophage. J. Molec. Biol.,
296:1215-1223.
[0626] Naktinis, V., Turner, J., and O'Donnell, M. (1996) A
molecular switch in a replication machine defined by an internal
competition for protein rings. Cell 84(1):137-145.
[0627] Naktinis, V., Onrust, R., Fang, L., O'Donnell, M. (1995)
Assembly of a chromosomal replication machine: two DNA polymerases,
a clamp loader, and sliding clamps in one holoenzyme particle. II.
Intermediate complex between the clamp loader and its clamp. J.
Biol. Chem. 270:13358-13365.
[0628] Nambair, K. P., et al., (1984) Total synthesis and cloning
of a gene coding for the ribonuclease S protein. Science
223:1299-1300.
[0629] Nelson, K. E., et al., (1999) Evidence for lateral gene
transfer between Archaea and bacteria from genome sequence of
Thermotoga maritima. Nature 399:323-329.
[0630] Noren, C. J., et al., (1989) A general method for
site-specific incorporation of unnatural amino acids into proteins.
Science 244:182-188.
[0631] O'Day, C. L., Burgers, P. M., Taylor, J. S. (1992)
PCNA-induced DNA synthesis past cis-syn and trans-syn-I thymine
dimers by calf thymus DNA polymerase delta in vitro. Nucl. Acids
Res. 20(20):5403-6.
[0632] O'Donnell, M., (1987) Accessory proteins bind a primed
template and Mediate Rapid Cycling of DNA polymerase III Holoenzyme
from E. coli. J Biol. Chem. 262:16558-16565.
[0633] O'Donnell, M., Kuriyan, J., Kong, X-P., Stukenberg, P. T.
and Onrust, R. (1992) The sliding clamp of DNA polymerase III
holoenzyme encircles DNA. Molec. Biol. Cell 3:953-957.
[0634] O'Donnell, M., Onrust, R., Dean, F. B., Chen, M., and
Hurwitz, J. (1993) Homology in accessory proteins of replicative
polymerases-E. coli to humans. Nucl. Acids Res. 21:1-3.
[0635] Onrust, R., Finkelstein, J., Turner, J., Naktinis, V., and
O'Donnell, M. (1995), Assembly of a chromosomal replication
machine: two DNA polymerases, a clamp loader and sliding clamps in
one holoenzyme particle. III) Interface between two polymerases and
the clamp loader. J. Biol. Chem. 270:13366-13377.
[0636] Onrust, R. and O'Donnell, M. (1993) DNA polymerase III
accessory proteins. 1) holA and holB encoding .delta. and .delta..
J. Biol. Chem. 268:11758-11765.
[0637] Onrust, R., Stukenberg, P. T., and O'Donnell, M. (1991)
Analysis of the ATPase subassembly which initiates processive DNA
synthesis by DNA polymerase III holoenzyme. J. Biol. Chem.
266:21681-21686.
[0638] Oshima, T., and Imahori, K, (1974) Description of Thermus
thermophilus (Yoshida and Oshima) comb-nov, a nonsporulating
bacterium from a Japanese spa. Int. J. Syst. Bacteriol.
24(1):102-112.
[0639] Pacitti, D. F., Barnes, M. H., Li, D. H., and Brown, N. C.
(1995) Characterization and overexpression of the gene encoding
Staphylococcus aureus DNA polymerase III. Gene, 1165:51-56.
[0640] Perbal, B., A Practical Guide to Molecular Cloning
(1984).
[0641] Perrino, F. W., and Loeb, L. A. (1990) Hydrolysis of
3'-terminal mispairs in vitro by the 3' 5' exonuclease of DNA
polymerase.delta. permits subsequent extension by DNA polymerase
.alpha.. Biochem. 29:5226-5231.
[0642] Reddy et al., (1993) Assembly of a functional replication
complex without ATP hydrolysis: a direct interaction of
bacteriophage T4 gp45 with T4 DNA polymerase. Proc. Natl. Acad.
Sci. USA 90(8):3211-3215.
[0643] Rowen, L., and Kornberg, A. (1978) Primase, the DnaG protein
of Escherichia coli. An enzyme which starts DNA chains. J. Biol.
Chem. 253:758-764.
[0644] Ruttimann, C., Cotoras, M., Zaldivar, J., and Vicuna, R.
(1985) DNA polymerases from the extremely thermophilic bacterium
Thermus thermophilus HB-8. European J. Biochem. 149:41-46.
[0645] Sambrook et al., Molecular Cloning: A Laboratory Manual
(1989).
[0646] Sanger, F., and Coulson, A. R., (1975) A rapid method for
determining sequences in DNA by primed synthesis with DNA
polymerase. J. Mol. Biol. 94:441-448.
[0647] Sanger, F., et al., (1977) DNA sequencing with
chain-terminating inhibitors. Proc. Natl. Acad. Sci. USA
74:5463-5467
[0648] Schreier, M., et al., Hybridoma Techniques (1980).
[0649] Studwell-Vaughan, P. S. and O'Donnell, M. (1991)
Constitution of the twin polymerase of DNA polymerase III
holoenzyme. J. Biol. Chem. 266:19833-19841.
[0650] Studwell-Vaughan, P. S. and O'Donnell, M. (1990) Processive
replication is contingent on the exonuclease subunit of DNA
polymerase III holoenzyme. J. Biol. Chem. 265(2):1171-1178.
[0651] Stukenberg, P. T., Studwell-Vaughan, P. S., and O'Donnell,
M. (1991) Mechanism of the sliding B-clamp of DNA polymerase III
holoenzyme. J. Biol. Chem. 266:11328-11334.
[0652] Sugino, A. (1995) Yeast DNA polymerases and their role at
the replication fork. Elsevier Science Ltd., 319-323.
[0653] Tabor, S. and Richardson, C. C. (1995) A single residue in
DNA polymerases of the Escherichia coli DNA polymerase I family is
critical for distinguishing between deoxy- and
dideoxyribonucleotides. Proc. Natl. Acad. Sci. USA,
92(14):6339-6343.
[0654] Tan, C. K., Castillo, C., So, A. G., Downey, K. M. (1986) An
auxiliary protein for DNA polymerase-delta from fetal calf thymus.
J. Biol. Chem. 261(26):12310-6.
[0655] Towbin, H., Staehelin, T., Gordon, J. (1979) Electrophoretic
transfer of proteins from polyacrylamide gels to nitrocellulose
sheets: procedure and some applications. Proc. Natl. Acad. Sci. USA
76(9):4350-4354.
[0656] Tsuchihashi, Z., and Kornberg, A. (1989) ATP interactions of
the tau and gamma subunits of DNA polymerase III holoenzyme of
Escherichia coli. J. Biol. Chem. 264:.17790-95.
[0657] Tsuchihashi, Z. and Kornberg, A. (1990) Translational
frameshifting generates the .gamma. subunit of DNA polymerase III
holoenzyme. Proc. Natl. Acad Sci. USA 87:2516-2520.
[0658] Tsuchihashi, Z., and Brown, P. O. (1992) Sequence
requirements for efficient translational frameshifting in the
Escherichia coli dnaX gene and the role of an unstable interaction
between tRNALys and an AAG lysine codon. Genes and Dev.
6:511-519.
[0659] Turner, J., and O'Donnell, M. (1995) Cycling of Escherichia
coli DNA polymerase III from one sliding clamp to another: model
for lagging strand. Methods Enzymol. 262:442-449.
[0660] Vos, P., et al., (1995) AFLP: a new technique for DNA
fingerprinting. Nucl. Acids Res. 23(21):44074414.
[0661] Weiss, R. B., Dunn, D. M., Atkins, J. F., and Gesteland, R.
F., (1987) Slippery runs, shifty stops, backward steps, and forward
hops: -2, -1, +2, +5 and +6 ribosomal frameshifting. in Cold Spring
Harbor Symposia on Quantitative Biology 52: 687-693.
[0662] Welsh, J., and McClelland, M., (1990) Fingerprinting genomes
using PCR with arbitrary primers. Nucl. Acids Res.
18(24):7213-7218.
[0663] Wickner, W., and Kornberg, A., (1974) A holoenzyme form of
DNA Polymerase III. Isolation and Properties. J. Biol. Chem.
249(19):6244-6249.
[0664] Williams, J. G., et al., (1990) DNA polymorphisms amplified
by arbitrary primers are useful as genetic markers. Nucl. Acids
Res. 18(22):6531-6535.
[0665] Yin, K-C., Blinkowa, A., and Walker, J. R. (1986) Nucleotide
sequence of the Escherichia replication gene dnaZX. Nuc. Acids.
Res. 14:6541-6549.
[0666] Young, M. C., Reddy, M. K., and von Hippel, P. H. (1992)
Structure and function of the bacteriophage T4 DNA polymerase
holoenzyme. Biochem., 31:8675-8690.
[0667] Yuzhakov, A., Turner, J. and O'Donnell, M. (1996) Replisome
assembly reveals the basis for asymmetric function in leading and
lagging strand replication. Cell 86:877-886.
[0668] U.S. Pat. No. 5,668,004 to O'Donnell.
[0669] U.S. Pat. No. 5,583,026 to O'Donnell.
[0670] U.S. Pat. No. 5,545,552 to Mathur.
[0671] U.S. Pat. No. 5,498,523 to Tabor et al.
[0672] U.S. Pat. No. 5,455,166 to Walker.
[0673] U.S. Pat. No. 5,409,818 to Davey et al.
[0674] U.S. Pat. No. 5,374,553 to Gelfand et al.
[0675] U.S. Pat. No. 5,352,778 to Comb et al.
[0676] U.S. Pat. No. 5,322,785 to Comb et al.
[0677] U.S. Pat. No. 5,192,674 to Oshima et al.
[0678] U.S. Pat. No. 4,962,022 to Fleming et al.
[0679] U.S. Pat. No. 4,816,567 to Cabilly et al.
[0680] U.S. Pat. No. 4,816,397 to Boss et al.
[0681] U.S. Pat. No. 4,683,202 to Mullis.
[0682] U.S. Pat. No. 4,683,195 to Mullis et al.
[0683] U.S. Pat. No. 4,493,890 to Morris.
[0684] U.S. Pat. No. 4,493,795 to Nestor et al.
[0685] U.S. Pat. No. 4,491,632 toWands et al.
[0686] U.S. Pat. No. 4,472,500 to Milstein et al.
[0687] U.S. Pat. No. 4,466,917 to Nussenzweig et al.
[0688] U.S. Pat. No. 4,451,570 to Royston et al.
[0689] U.S. Pat. No. 4,444,887 to Hoffman.
[0690] U.S. Pat. No. 4,427,783 to Newman et al.
[0691] U.S. Pat. No. 4,399,121 to Albarella et al.
[0692] U.S. Pat. No. 4,342,566 to Theofilopous et al.
[0693] U.S. Pat. No. 4,341,761 to Ganfield et al.
[0694] WO 96/10640 to Chatterjee et al.
[0695] EP 329,822 to Davey et al.
[0696] EP 534,858 to Vos et al.
[0697] This invention may be embodied in other forms or carried out
in other ways without departing from the spirit or essential
characteristics thereof. The present disclosure is therefore to be
considered as in all respects illustrative and not restrictive, the
scope of the invention being indicated by the appended claims, and
all changes which come within the meaning and range of equivalency
are intended to be embraced therein.
Sequence CWU 1
1
212 1 2007 DNA Thermus thermophilus 1 tccgggggtg gggttcccag
gtagaccccg gcccctcccg tgagcccctt tacccaggcc 60 gccacctcct
ccaggggggc caaggcgtgc aaggagagga acgtccgcac cacgccctat 120
actagccttg tgagcgccct ctaccgccgc ttccgccccc tcaccttcca ggaggtggtg
180 gggcaggagc acgtgaagga gcccctcctc aaggccatcc gggaggggag
gctcgcccag 240 gcctacctct tctccgggcc caggggcgtg ggcaagacca
ccacggcgag gctcctcgcc 300 atggcggtgg ggtgccaggg ggaagacccc
ccttgcgggg tctgccccca ctgccaggcg 360 gtgcagaggg gcgcccaccc
ggacgtggtg gacattgacg ccgccagcaa caactccgtg 420 gaggacgtgc
gggagctgag ggaaaggatc cacctcgccc ccctctctgc ccccaggaag 480
gtcttcatcc tggacgaggc ccacatgctc tccaaaagcg ccttcaacgc cctcctcaag
540 accctggagg agcccccgcc ccacgtcctc ttcgtcttcg ccaccaccga
gcccgagagg 600 atgcccccca ccatcctctc ccgcacccag cacttccgct
tccgccgcct cacggaggag 660 gagatcgcct ttaagctccg gcgcatcctg
gaggccgtgg ggcgggaggc ggaggaggag 720 gccctcctcc tcctcgcccg
cctggcggac ggggccctta gggacgcgga aagcctcctg 780 gagcgcttcc
tcctcctgga aggccccctc acccggaagg aggtggagcg cgccctaggc 840
tcccccccag ggaccggggt ggccgagatc gccgcctccc tcgcgagggg gaaaacggcg
900 gaggccctgg gcctcgcccg gcgcctctac ggggaagggt acgccccgag
gagcctggtc 960 tcgggccttt tggaggtgtt ccgggaaggc ctctacgccg
ccttcggcct cgcgggaacc 1020 ccccttcccg ccccgcccca ggccctgatc
gccgccatga ccgccctgga cgaggccatg 1080 gagcgcctcg cccgccgctc
cgacgcctta agcctggagg tggccctcct ggaggcggga 1140 agggccctgg
ccgccgaggc cctaccccag cccacgggcg ctccttcccc agaggtcggc 1200
cccaagccgg aaagcccccc gaccccggaa cccccaaggc ccgaggaggc gcccgacctg
1260 cgggagcggt ggcgggcctt cctcgaggcc ctcaggccca ccctacgggc
cttcgtgcgg 1320 gaggcccgcc cggaggtccg ggaaggccag ctctgcctcg
ctttccccga ggacaaggcc 1380 ttccactacc gcaaggcctc ggaacagaag
gtgaggctcc tccccctggc ccaggcccat 1440 ttcggggtgg aggaggtcgt
cctcgtcctg gagggagaaa aaaaaagcct gagcccaagg 1500 ccccgcccgg
ccccacctcc tgaagcgccc gcacccccgg gccctcccga ggaggaggta 1560
gaggcggagg aagcggcgga ggaggccccg gaggaggcct tgaggcgggt ggtccgcctc
1620 ctgggggggc gggtgctctg ggtgcggcgg cccaggaccc gggaggcgcc
ggaggaggaa 1680 cccctgagcc aagacgagat agggggtact ggtatataat
gggggcatga cgcggaccac 1740 cgacctcgga caagagaccg tggacaacat
cctcaagcgc ctccgccgta ttgagggcca 1800 ggtgcggggg ctccagaaga
tggtggccga gggccgcccc tgcgacgagg tcctcaccca 1860 gatgaccgcc
accaagaagg ccatggaggc ggcggccacc ctgatcctcc acgagttcct 1920
gaacgtctgc gccgccgagg tctccgaggg caaggtgaac cccaagaagc ccgaggagat
1980 cgccaccatg ctgaagaact tcatcta 2007 2 529 PRT Thermus
thermophilus 2 Met Ser Ala Leu Tyr Arg Arg Phe Arg Pro Leu Thr Phe
Gln Glu Val 1 5 10 15 Val Gly Gln Glu His Val Lys Glu Pro Leu Leu
Lys Ala Ile Arg Glu 20 25 30 Gly Arg Leu Ala Gln Ala Tyr Leu Phe
Ser Gly Pro Arg Gly Val Gly 35 40 45 Lys Thr Thr Thr Ala Arg Leu
Leu Ala Met Ala Val Gly Cys Gln Gly 50 55 60 Glu Asp Pro Pro Cys
Gly Val Cys Pro His Cys Gln Ala Val Gln Arg 65 70 75 80 Gly Ala His
Pro Asp Val Val Asp Ile Asp Ala Ala Ser Asn Asn Ser 85 90 95 Val
Glu Asp Val Arg Glu Leu Arg Glu Arg Ile His Leu Ala Pro Leu 100 105
110 Ser Ala Pro Arg Lys Val Phe Ile Leu Asp Glu Ala His Met Leu Ser
115 120 125 Lys Ser Ala Phe Asn Ala Leu Leu Lys Thr Leu Glu Glu Pro
Pro Pro 130 135 140 His Val Leu Phe Val Phe Ala Thr Thr Glu Pro Glu
Arg Met Pro Pro 145 150 155 160 Thr Ile Leu Ser Arg Thr Gln His Phe
Arg Phe Arg Arg Leu Thr Glu 165 170 175 Glu Glu Ile Ala Phe Lys Leu
Arg Arg Ile Leu Glu Ala Val Gly Arg 180 185 190 Glu Ala Glu Glu Glu
Ala Leu Leu Leu Leu Ala Arg Leu Ala Asp Gly 195 200 205 Ala Leu Arg
Asp Ala Glu Ser Leu Leu Glu Arg Phe Leu Leu Leu Glu 210 215 220 Gly
Pro Leu Thr Arg Lys Glu Val Glu Arg Ala Leu Gly Ser Pro Pro 225 230
235 240 Gly Thr Gly Val Ala Glu Ile Ala Ala Ser Leu Ala Arg Gly Lys
Thr 245 250 255 Ala Glu Ala Leu Gly Leu Ala Arg Arg Leu Tyr Gly Glu
Gly Tyr Ala 260 265 270 Pro Arg Ser Leu Val Ser Gly Leu Leu Glu Val
Phe Arg Glu Gly Leu 275 280 285 Tyr Ala Ala Phe Gly Leu Ala Gly Thr
Pro Leu Pro Ala Pro Pro Gln 290 295 300 Ala Leu Ile Ala Ala Met Thr
Ala Leu Asp Glu Ala Met Glu Arg Leu 305 310 315 320 Ala Arg Arg Ser
Asp Ala Leu Ser Leu Glu Val Ala Leu Leu Glu Ala 325 330 335 Gly Arg
Ala Leu Ala Ala Glu Ala Leu Pro Gln Pro Thr Gly Ala Pro 340 345 350
Ser Pro Glu Val Gly Pro Lys Pro Glu Ser Pro Pro Thr Pro Glu Pro 355
360 365 Pro Arg Pro Glu Glu Ala Pro Asp Leu Arg Glu Arg Trp Arg Ala
Phe 370 375 380 Leu Glu Ala Leu Arg Pro Thr Leu Arg Ala Phe Val Arg
Glu Ala Arg 385 390 395 400 Pro Glu Val Arg Glu Gly Gln Leu Cys Leu
Ala Phe Pro Glu Asp Lys 405 410 415 Ala Phe His Tyr Arg Lys Ala Ser
Glu Gln Lys Val Arg Leu Leu Pro 420 425 430 Leu Ala Gln Ala His Phe
Gly Val Glu Glu Val Val Leu Val Leu Glu 435 440 445 Gly Glu Lys Lys
Ser Leu Ser Pro Arg Pro Arg Pro Ala Pro Pro Pro 450 455 460 Glu Ala
Pro Ala Pro Pro Gly Pro Pro Glu Glu Glu Val Glu Ala Glu 465 470 475
480 Glu Ala Ala Glu Glu Ala Pro Glu Glu Ala Leu Arg Arg Val Val Arg
485 490 495 Leu Leu Gly Gly Arg Val Leu Trp Val Arg Arg Pro Arg Thr
Arg Glu 500 505 510 Ala Pro Glu Glu Glu Pro Leu Ser Gln Asp Glu Ile
Gly Gly Thr Gly 515 520 525 Ile 3 1590 DNA Thermus thermophilus 3
gtgagcgccc tctaccgccg cttccgcccc ctcaccttcc aggaggtggt ggggcaggag
60 cacgtgaagg agcccctcct caaggccatc cgggagggga ggctcgccca
ggcctacctc 120 ttctccgggc ccaggggcgt gggcaagacc accacggcga
ggctcctcgc catggcggtg 180 gggtgccagg gggaagaccc cccttgcggg
gtctgccccc actgccaggc ggtgcagagg 240 ggcgcccacc cggacgtggt
ggacattgac gccgccagca acaactccgt ggaggacgtg 300 cgggagctga
gggaaaggat ccacctcgcc cccctctctg cccccaggaa ggtcttcatc 360
ctggacgagg cccacatgct ctccaaaagc gccttcaacg ccctcctcaa gaccctggag
420 gagcccccgc cccacgtcct cttcgtcttc gccaccaccg agcccgagag
gatgcccccc 480 accatcctct cccgcaccca gcacttccgc ttccgccgcc
tcacggagga ggagatcgcc 540 tttaagctcc ggcgcatcct ggaggccgtg
gggcgggagg cggaggagga ggccctcctc 600 ctcctcgccc gcctggcgga
cggggccctt agggacgcgg aaagcctcct ggagcgcttc 660 ctcctcctgg
aaggccccct cacccggaag gaggtggagc gcgccctagg ctccccccca 720
gggaccgggg tggccgagat cgccgcctcc ctcgcgaggg ggaaaacggc ggaggccctg
780 ggcctcgccc ggcgcctcta cggggaaggg tacgccccga ggagcctggt
ctcgggcctt 840 ttggaggtgt tccgggaagg cctctacgcc gccttcggcc
tcgcgggaac cccccttccc 900 gccccgcccc aggccctgat cgccgccatg
accgccctgg acgaggccat ggagcgcctc 960 gcccgccgct ccgacgcctt
aagcctggag gtggccctcc tggaggcggg aagggccctg 1020 gccgccgagg
ccctacccca gcccacgggc gctccttccc cagaggtcgg ccccaagccg 1080
gaaagccccc cgaccccgga acccccaagg cccgaggagg cgcccgacct gcgggagcgg
1140 tggcgggcct tcctcgaggc cctcaggccc accctacggg ccttcgtgcg
ggaggcccgc 1200 ccggaggtcc gggaaggcca gctctgcctc gctttccccg
aggacaaggc cttccactac 1260 cgcaaggcct cggaacagaa ggtgaggctc
ctccccctgg cccaggccca tttcggggtg 1320 gaggaggtcg tcctcgtcct
ggagggagaa aaaaaaagcc tgagcccaag gccccgcccg 1380 gccccacctc
ctgaagcgcc cgcacccccg ggccctcccg aggaggaggt agaggcggag 1440
gaagcggcgg aggaggcccc ggaggaggcc ttgaggcggg tggtccgcct cctggggggg
1500 cgggtgctct gggtgcggcg gcccaggacc cgggaggcgc cggaggagga
acccctgagc 1560 caagacgaga tagggggtac tggtatataa 1590 4 464 PRT
Thermus thermophilus 4 Met Ser Ala Leu Tyr Arg Arg Phe Arg Pro Leu
Thr Phe Gln Glu Val 1 5 10 15 Val Gly Gln Glu His Val Lys Glu Pro
Leu Leu Lys Ala Ile Arg Glu 20 25 30 Gly Arg Leu Ala Gln Ala Tyr
Leu Phe Ser Gly Pro Arg Gly Val Gly 35 40 45 Lys Thr Thr Thr Ala
Arg Leu Leu Ala Met Ala Val Gly Cys Gln Gly 50 55 60 Glu Asp Pro
Pro Cys Gly Val Cys Pro His Cys Gln Ala Val Gln Arg 65 70 75 80 Gly
Ala His Pro Asp Val Val Asp Ile Asp Ala Ala Ser Asn Asn Ser 85 90
95 Val Glu Asp Val Arg Glu Leu Arg Glu Arg Ile His Leu Ala Pro Leu
100 105 110 Ser Ala Pro Arg Lys Val Phe Ile Leu Asp Glu Ala His Met
Leu Ser 115 120 125 Lys Ser Ala Phe Asn Ala Leu Leu Lys Thr Leu Glu
Glu Pro Pro Pro 130 135 140 His Val Leu Phe Val Phe Ala Thr Thr Glu
Pro Glu Arg Met Pro Pro 145 150 155 160 Thr Ile Leu Ser Arg Thr Gln
His Phe Arg Phe Arg Arg Leu Thr Glu 165 170 175 Glu Glu Ile Ala Phe
Lys Leu Arg Arg Ile Leu Glu Ala Val Gly Arg 180 185 190 Glu Ala Glu
Glu Glu Ala Leu Leu Leu Leu Ala Arg Leu Ala Asp Gly 195 200 205 Ala
Leu Arg Asp Ala Glu Ser Leu Leu Glu Arg Phe Leu Leu Leu Glu 210 215
220 Gly Pro Leu Thr Arg Lys Glu Val Glu Arg Ala Leu Gly Ser Pro Pro
225 230 235 240 Gly Thr Gly Val Ala Glu Ile Ala Ala Ser Leu Ala Arg
Gly Lys Thr 245 250 255 Ala Glu Ala Leu Gly Leu Ala Arg Arg Leu Tyr
Gly Glu Gly Tyr Ala 260 265 270 Pro Arg Ser Leu Val Ser Gly Leu Leu
Glu Val Phe Arg Glu Gly Leu 275 280 285 Tyr Ala Ala Phe Gly Leu Ala
Gly Thr Pro Leu Pro Ala Pro Pro Gln 290 295 300 Ala Leu Ile Ala Ala
Met Thr Ala Leu Asp Glu Ala Met Glu Arg Leu 305 310 315 320 Ala Arg
Arg Ser Asp Ala Leu Ser Leu Glu Val Ala Leu Leu Glu Ala 325 330 335
Gly Arg Ala Leu Ala Ala Glu Ala Leu Pro Gln Pro Thr Gly Ala Pro 340
345 350 Ser Pro Glu Val Gly Pro Lys Pro Glu Ser Pro Pro Thr Pro Glu
Pro 355 360 365 Pro Arg Pro Glu Glu Ala Pro Asp Leu Arg Glu Arg Trp
Arg Ala Phe 370 375 380 Leu Glu Ala Leu Arg Pro Thr Leu Arg Ala Phe
Val Arg Glu Ala Arg 385 390 395 400 Pro Glu Val Arg Glu Gly Gln Leu
Cys Leu Ala Phe Pro Glu Asp Lys 405 410 415 Ala Phe His Tyr Arg Lys
Ala Ser Glu Gln Lys Val Arg Leu Leu Pro 420 425 430 Leu Ala Gln Ala
His Phe Gly Val Glu Glu Val Val Leu Val Leu Glu 435 440 445 Gly Glu
Lys Lys Lys Pro Glu Pro Lys Ala Pro Pro Gly Pro Thr Ser 450 455 460
5 454 PRT Thermus thermophilus 5 Met Ser Ala Leu Tyr Arg Arg Phe
Arg Pro Leu Thr Phe Gln Glu Val 1 5 10 15 Val Gly Gln Glu His Val
Lys Glu Pro Leu Leu Lys Ala Ile Arg Glu 20 25 30 Gly Arg Leu Ala
Gln Ala Tyr Leu Phe Ser Gly Pro Arg Gly Val Gly 35 40 45 Lys Thr
Thr Thr Ala Arg Leu Leu Ala Met Ala Val Gly Cys Gln Gly 50 55 60
Glu Asp Pro Pro Cys Gly Val Cys Pro His Cys Gln Ala Val Gln Arg 65
70 75 80 Gly Ala His Pro Asp Val Val Asp Ile Asp Ala Ala Ser Asn
Asn Ser 85 90 95 Val Glu Asp Val Arg Glu Leu Arg Glu Arg Ile His
Leu Ala Pro Leu 100 105 110 Ser Ala Pro Arg Lys Val Phe Ile Leu Asp
Glu Ala His Met Leu Ser 115 120 125 Lys Ser Ala Phe Asn Ala Leu Leu
Lys Thr Leu Glu Glu Pro Pro Pro 130 135 140 His Val Leu Phe Val Phe
Ala Thr Thr Glu Pro Glu Arg Met Pro Pro 145 150 155 160 Thr Ile Leu
Ser Arg Thr Gln His Phe Arg Phe Arg Arg Leu Thr Glu 165 170 175 Glu
Glu Ile Ala Phe Lys Leu Arg Arg Ile Leu Glu Ala Val Gly Arg 180 185
190 Glu Ala Glu Glu Glu Ala Leu Leu Leu Leu Ala Arg Leu Ala Asp Gly
195 200 205 Ala Leu Arg Asp Ala Glu Ser Leu Leu Glu Arg Phe Leu Leu
Leu Glu 210 215 220 Gly Pro Leu Thr Arg Lys Glu Val Glu Arg Ala Leu
Gly Ser Pro Pro 225 230 235 240 Gly Thr Gly Val Ala Glu Ile Ala Ala
Ser Leu Ala Arg Gly Lys Thr 245 250 255 Ala Glu Ala Leu Gly Leu Ala
Arg Arg Leu Tyr Gly Glu Gly Tyr Ala 260 265 270 Pro Arg Ser Leu Val
Ser Gly Leu Leu Glu Val Phe Arg Glu Gly Leu 275 280 285 Tyr Ala Ala
Phe Gly Leu Ala Gly Thr Pro Leu Pro Ala Pro Pro Gln 290 295 300 Ala
Leu Ile Ala Ala Met Thr Ala Leu Asp Glu Ala Met Glu Arg Leu 305 310
315 320 Ala Arg Arg Ser Asp Ala Leu Ser Leu Glu Val Ala Leu Leu Glu
Ala 325 330 335 Gly Arg Ala Leu Ala Ala Glu Ala Leu Pro Gln Pro Thr
Gly Ala Pro 340 345 350 Ser Pro Glu Val Gly Pro Lys Pro Glu Ser Pro
Pro Thr Pro Glu Pro 355 360 365 Pro Arg Pro Glu Glu Ala Pro Asp Leu
Arg Glu Arg Trp Arg Ala Phe 370 375 380 Leu Glu Ala Leu Arg Pro Thr
Leu Arg Ala Phe Val Arg Glu Ala Arg 385 390 395 400 Pro Glu Val Arg
Glu Gly Gln Leu Cys Leu Ala Phe Pro Glu Asp Lys 405 410 415 Ala Phe
His Tyr Arg Lys Ala Ser Glu Gln Lys Val Arg Leu Leu Pro 420 425 430
Leu Ala Gln Ala His Phe Gly Val Glu Glu Val Val Leu Val Leu Glu 435
440 445 Gly Glu Lys Lys Lys Ala 450 6 32 DNA Artificial Sequence
Description of Artificial Sequence primer 6 cgcaagcttc acgcstacct
sttctccggs ac 32 7 8 PRT Artificial Sequence Description of
Artificial Sequence peptide 7 His Ala Tyr Leu Phe Ser Gly Thr 1 5 8
34 DNA Artificial Sequence Description of Artificial Sequence
primer 8 cgcgaattcg tgctcsggsg gctcctcsag sgtc 34 9 9 PRT
Artificial Sequence Description of Artificial Sequence peptide 9
Lys Thr Leu Glu Glu Pro Pro Glu His 1 5 10 38 DNA Artificial
Sequence Description of Artificial Sequence primer 10 gcgcggatcc
ggagggagaa aaaaaaagcc tcagccca 38 11 38 DNA Artificial Sequence
Description of Artificial Sequence primer 11 gcgcggatcc ggagggagag
aagaaaagcc tcagccca 38 12 28 DNA Artificial Sequence Description of
Artificial Sequence primer 12 gaattaaatt cgcgcttcgg gaggtggg 28 13
27 DNA Artificial Sequence Description of Artificial Sequence
primer 13 gcgcgaattc gcgcttcggg aggtggg 27 14 29 DNA Artificial
Sequence Description of Artificial Sequence primer 14 gcgcgaattc
gggcgcttca ggaggtggg 29 15 31 DNA Artificial Sequence Description
of Artificial Sequence primer 15 gtggtgcata tggtgagcgc cctctaccgc c
31 16 31 DNA Artificial Sequence Description of Artificial Sequence
primer 16 gtggtggtcg acccaggagg gccacctcca g 31 17 8 PRT Artificial
Sequence Description of Artificial Sequence peptide 17 Gly Xaa Xaa
Gly Xaa Gly Lys Thr 1 5 18 12 PRT Artificial Sequence Description
of Artificial Sequence peptide 18 Lys Pro Asp Pro Lys Ala Pro Pro
Gly Pro Thr Ser 1 5 10 19 180 PRT Escherichia coli 19 Met Ser Tyr
Gln Val Leu Ala Arg Lys Trp Arg Pro Gln Thr Phe Ala 1 5 10 15 Asp
Val Val Gly Gln Glu His Val Leu Thr Ala Leu Ala Asn Gly Leu 20 25
30 Ser Leu Gly Arg Ile His His Ala Tyr Leu Phe Ser Gly Thr Arg Gly
35 40 45 Val Gly Lys Thr Ser Ile Ala Arg Leu Leu Ala Lys Gly Leu
Asn Cys 50 55 60 Glu Thr Gly Ile Thr Ala Thr Pro Cys Gly Val Cys
Asp Asn Cys Arg 65 70 75 80 Glu Ile Glu Gln Gly Arg Phe Val Asp Leu
Ile Glu Ile Asp Ala Ala 85 90 95 Ser Arg Thr Lys Val Glu Asp Thr
Arg Asp Leu Leu Asp Asn Val Gln 100 105 110 Tyr Ala Pro Ala Arg Gly
Arg Phe Lys Val Tyr Leu Ile Asp Glu Val 115
120 125 His Met Leu Ser Arg His Ser Phe Asn Ala Leu Leu Lys Thr Leu
Glu 130 135 140 Glu Pro Pro Glu His Val Lys Phe Leu Leu Ala Thr Thr
Asp Pro Gln 145 150 155 160 Lys Leu Pro Val Thr Ile Leu Ser Arg Cys
Leu Gln Phe His Leu Lys 165 170 175 Ala Leu Asp Val 180 20 180 PRT
Bacillus subtilis 20 Met Ser Tyr Gln Ala Leu Tyr Arg Val Phe Arg
Pro Gln Arg Phe Glu 1 5 10 15 Asp Val Val Gly Gln Glu His Ile Thr
Lys Thr Leu Gln Asn Ala Leu 20 25 30 Leu Gln Lys Lys Phe Ser His
Ala Tyr Leu Phe Ser Gly Pro Arg Gly 35 40 45 Thr Gly Lys Thr Ser
Ala Ala Lys Ile Phe Ala Lys Ala Val Asn Cys 50 55 60 Glu His Ala
Pro Val Asp Glu Pro Cys Asn Glu Cys Ala Ala Cys Lys 65 70 75 80 Gly
Ile Thr Asn Gly Ser Ile Ser Asp Val Ile Glu Ile Asp Ala Ala 85 90
95 Ser Asn Asn Gly Val Asp Glu Ile Arg Asp Ile Arg Asp Lys Val Lys
100 105 110 Phe Ala Pro Ser Ala Val Thr Tyr Lys Val Tyr Ile Ile Asp
Glu Val 115 120 125 His Met Leu Ser Ile Gly Ala Phe Asn Ala Leu Leu
Lys Thr Leu Glu 130 135 140 Glu Pro Pro Glu His Cys Ile Phe Ile Leu
Ala Thr Thr Glu Pro His 145 150 155 160 Lys Ile Pro Leu Thr Ile Ile
Ser Arg Cys Gln Arg Phe Asp Phe Lys 165 170 175 Arg Ile Thr Ser 180
21 294 PRT Escherichia coli 21 Met Ser Tyr Gln Val Leu Ala Arg Lys
Trp Arg Pro Gln Thr Phe Ala 1 5 10 15 Asp Val Val Gly Gln Glu His
Val Leu Thr Ala Leu Ala Asn Gly Leu 20 25 30 Ser Leu Gly Arg Ile
His His Ala Tyr Leu Phe Ser Gly Thr Arg Gly 35 40 45 Val Gly Lys
Thr Ser Ile Ala Arg Leu Leu Ala Lys Gly Leu Asn Cys 50 55 60 Glu
Thr Gly Ile Thr Ala Thr Pro Cys Gly Val Cys Asp Asn Cys Arg 65 70
75 80 Glu Ile Glu Gln Gly Arg Phe Val Asp Leu Ile Glu Ile Asp Ala
Ala 85 90 95 Ser Arg Thr Lys Val Glu Asp Thr Arg Asp Leu Leu Asp
Asn Val Gln 100 105 110 Tyr Ala Pro Ala Arg Gly Arg Phe Lys Val Tyr
Leu Ile Asp Glu Val 115 120 125 His Met Leu Ser Arg His Ser Phe Asn
Ala Leu Leu Lys Thr Leu Glu 130 135 140 Glu Pro Pro Glu His Val Lys
Phe Leu Leu Ala Thr Thr Asp Pro Gln 145 150 155 160 Lys Leu Pro Val
Thr Ile Leu Ser Arg Cys Leu Gln Phe His Leu Lys 165 170 175 Ala Leu
Asp Val Glu Gln Ile Arg His Gln Leu Glu His Ile Leu Asn 180 185 190
Glu Glu His Ile Ala His Glu Pro Arg Ala Leu Gln Leu Leu Ala Arg 195
200 205 Ala Ala Glu Gly Ser Leu Arg Asp Ala Leu Ser Leu Thr Asp Gln
Ala 210 215 220 Ile Ala Ser Gly Asp Gly Gln Val Ser Thr Gln Ala Val
Ser Ala Met 225 230 235 240 Leu Gly Thr Leu Asp Asp Asp Gln Ala Leu
Ser Leu Val Glu Ala Met 245 250 255 Val Glu Ala Asn Gly Glu Arg Val
Met Ala Leu Ile Asn Glu Ala Ala 260 265 270 Ala Arg Gly Ile Glu Trp
Glu Ala Leu Leu Val Glu Met Leu Gly Leu 275 280 285 Leu His Arg Ile
Ala Met 290 22 294 PRT Haemophilus influenzae 22 Met Ser Tyr Gln
Val Leu Ala Arg Lys Trp Arg Pro Lys Thr Phe Ala 1 5 10 15 Asp Val
Val Gly Gln Glu His Ile Ile Thr Ala Leu Ala Asn Gly Leu 20 25 30
Lys Asp Asn Arg Leu His His Ala Tyr Leu Phe Ser Gly Thr Arg Gly 35
40 45 Val Gly Lys Thr Ser Ile Ala Arg Leu Phe Ala Lys Gly Leu Asn
Cys 50 55 60 Val His Gly Val Thr Ala Thr Pro Cys Gly Glu Cys Glu
Asn Cys Lys 65 70 75 80 Ala Ile Glu Gln Gly Asn Phe Ile Asp Leu Ile
Glu Ile Asp Ala Ala 85 90 95 Ser Arg Thr Lys Val Glu Asp Thr Arg
Glu Leu Leu Asp Asn Val Gln 100 105 110 Tyr Lys Pro Val Val Gly Arg
Phe Lys Val Tyr Leu Ile Asp Glu Val 115 120 125 His Met Leu Ser Arg
His Ser Phe Asn Ala Leu Leu Lys Thr Leu Glu 130 135 140 Glu Pro Pro
Glu Tyr Val Lys Phe Leu Leu Ala Thr Thr Asp Pro Gln 145 150 155 160
Lys Leu Pro Val Thr Ile Leu Ser Arg Cys Leu Gln Phe His Leu Lys 165
170 175 Ala Leu Asp Glu Thr Gln Ile Ser Gln His Leu Ala His Ile Leu
Thr 180 185 190 Gln Glu Asn Ile Pro Phe Glu Asp Pro Ala Leu Val Lys
Leu Ala Lys 195 200 205 Ala Ala Gln Gly Ser Ile Arg Asp Ser Leu Ser
Leu Thr Asp Gln Ala 210 215 220 Ile Ala Met Gly Asp Arg Gln Val Thr
Asn Asn Val Val Ser Asn Met 225 230 235 240 Leu Gly Leu Leu Asp Asp
Asn Tyr Ser Val Asp Ile Leu Tyr Ala Leu 245 250 255 His Gln Gly Asn
Gly Glu Leu Leu Met Arg Thr Leu Gln Arg Val Ala 260 265 270 Asp Ala
Ala Gly Asp Trp Asp Lys Leu Leu Gly Glu Cys Ala Glu Lys 275 280 285
Leu His Gln Ile Ala Leu 290 23 294 PRT Bacillus subtilis 23 Met Ser
Tyr Gln Ala Leu Tyr Arg Val Phe Arg Pro Gln Arg Phe Glu 1 5 10 15
Asp Val Val Gly Gln Glu His Ile Thr Lys Thr Leu Gln Asn Ala Leu 20
25 30 Leu Gln Lys Lys Phe Ser His Ala Tyr Leu Phe Ser Gly Pro Arg
Gly 35 40 45 Thr Gly Lys Thr Ser Ala Ala Lys Ile Phe Ala Lys Ala
Val Asn Cys 50 55 60 Glu His Ala Pro Val Asp Glu Pro Cys Asn Glu
Cys Ala Ala Cys Lys 65 70 75 80 Gly Ile Thr Asn Gly Ser Ile Ser Asp
Val Ile Glu Ile Asp Ala Ala 85 90 95 Ser Asn Asn Gly Val Asp Glu
Ile Arg Asp Ile Arg Asp Lys Val Lys 100 105 110 Phe Ala Pro Ser Ala
Val Thr Tyr Lys Val Tyr Ile Ile Asp Glu Val 115 120 125 His Met Leu
Ser Ile Gly Ala Phe Asn Ala Leu Leu Lys Thr Leu Glu 130 135 140 Glu
Pro Pro Glu His Cys Ile Phe Ile Leu Ala Thr Thr Glu Pro His 145 150
155 160 Lys Ile Pro Leu Thr Ile Ile Ser Arg Cys Gln Arg Phe Asp Phe
Lys 165 170 175 Arg Ile Thr Ser Gln Ala Ile Val Gly Arg Met Asn Lys
Ile Val Asp 180 185 190 Ala Glu Gln Leu Gln Val Glu Glu Gly Ser Leu
Glu Ile Ile Ala Ser 195 200 205 Ala Ala His Gly Gly Met Arg Asp Ala
Leu Ser Leu Leu Asp Gln Ala 210 215 220 Ile Ser Phe Ser Gly Asp Ile
Leu Lys Val Glu Asp Ala Leu Leu Ile 225 230 235 240 Thr Gly Ala Val
Ser Gln Leu Tyr Ile Gly Lys Leu Ala Lys Ser Leu 245 250 255 His Asp
Lys Asn Val Ser Asp Ala Leu Glu Thr Leu Asn Glu Leu Leu 260 265 270
Gln Gln Gly Lys Asp Pro Ala Lys Leu Ile Glu Asp Met Ile Phe Tyr 275
280 285 Phe Arg Asp Met Leu Leu 290 24 300 PRT Caulobacter
crescentus 24 Asp Ala Tyr Thr Val Leu Ala Arg Lys Tyr Arg Pro Arg
Thr Phe Glu 1 5 10 15 Asp Leu Ile Gly Gln Glu Ala Met Val Arg Thr
Leu Ala Asn Ala Phe 20 25 30 Ser Thr Gly Arg Ile Ala His Ala Phe
Met Leu Thr Gly Val Arg Gly 35 40 45 Val Gly Lys Thr Thr Thr Ala
Arg Leu Leu Ala Arg Ala Leu Asn Tyr 50 55 60 Glu Thr Asp Thr Val
Lys Gly Pro Ser Val Asp Leu Thr Thr Glu Gly 65 70 75 80 Tyr His Cys
Arg Ser Ile Ile Glu Gly Arg His Met Asp Val Leu Glu 85 90 95 Leu
Asp Ala Ala Ser Arg Thr Lys Val Asp Glu Met Arg Glu Leu Leu 100 105
110 Asp Gly Val Arg Tyr Ala Pro Val Glu Ala Arg Tyr Lys Val Tyr Ile
115 120 125 Ile Asp Glu Val His Met Leu Ser Thr Ala Ala Phe Asn Ala
Leu Leu 130 135 140 Lys Thr Leu Glu Glu Pro Pro Pro His Ala Lys Phe
Ile Phe Ala Thr 145 150 155 160 Thr Glu Ile Arg Lys Val Pro Val Thr
Ile Leu Ser Arg Cys Gln Arg 165 170 175 Phe Asp Leu Arg Arg Val Glu
Pro Asp Val Leu Val Lys His Phe Asp 180 185 190 Arg Ile Ser Ala Lys
Glu Gly Ala Arg Ile Glu Met Asp Ala Leu Ala 195 200 205 Leu Ile Ala
Arg Ala Ala Glu Gly Ser Val Arg Asp Gly Leu Ser Leu 210 215 220 Leu
Asp Gln Ala Ile Val Gln Thr Glu Arg Gly Gln Thr Val Thr Ser 225 230
235 240 Thr Val Val Arg Asp Met Leu Gly Leu Ala Asp Arg Ser Gln Thr
Ile 245 250 255 Ala Leu Tyr Glu His Val Met Ala Gly Lys Thr Lys Asp
Ala Leu Glu 260 265 270 Gly Phe Arg Ala Leu Trp Gly Phe Gly Ala Asp
Pro Ala Val Val Met 275 280 285 Leu Asp Val Leu Asp His Cys His Ala
Ser Ala Val 290 295 300 25 260 PRT Mycoplasma genitalium 25 Met His
Gln Val Phe Tyr Gln Lys Tyr Arg Pro Ile Asn Phe Lys Gln 1 5 10 15
Thr Leu Gly Gln Glu Ser Ile Arg Lys Ile Leu Val Asn Ala Ile Asn 20
25 30 Arg Asp Lys Leu Pro Asn Gly Tyr Ile Phe Ser Gly Glu Arg Gly
Thr 35 40 45 Gly Lys Thr Thr Phe Ala Lys Ile Ile Ala Lys Ala Ile
Asn Cys Leu 50 55 60 Asn Trp Asp Gln Ile Asp Val Cys Asn Ser Cys
Asp Val Cys Lys Ser 65 70 75 80 Ile Asn Thr Asn Ser Ala Ile Asp Ile
Val Glu Ile Asp Ala Ala Ser 85 90 95 Lys Asn Gly Ile Asn Asp Ile
Arg Glu Leu Val Glu Asn Val Phe Asn 100 105 110 His Pro Phe Thr Phe
Lys Lys Lys Val Tyr Ile Leu Asp Glu Ala His 115 120 125 Met Leu Thr
Thr Gln Ser Trp Gly Gly Leu Leu Lys Thr Leu Glu Glu 130 135 140 Ser
Pro Pro Tyr Val Leu Phe Ile Phe Thr Thr Thr Glu Phe Asn Lys 145 150
155 160 Ile Pro Leu Thr Ile Leu Ser Arg Cys Gln Ser Phe Phe Phe Lys
Lys 165 170 175 Ile Thr Ser Asp Leu Ile Leu Glu Arg Leu Asn Asp Ile
Ala Lys Lys 180 185 190 Glu Lys Ile Lys Ile Glu Lys Asp Ala Leu Ile
Lys Ile Ala Asp Leu 195 200 205 Ser Gln Gly Ser Leu Arg Asp Gly Leu
Ser Leu Leu Asp Gln Leu Ala 210 215 220 Ile Ser Leu Ile Val Lys Lys
Leu Val Leu Leu Met Leu Lys Lys His 225 230 235 240 Leu Ile Ser Leu
Ile Glu Met Gln Asn Leu Leu Leu Leu Lys Gln Phe 245 250 255 Tyr Gln
Glu Ile 260 26 289 PRT Thermus thermophilus 26 Val Ser Ala Leu Tyr
Arg Arg Phe Arg Pro Leu Thr Phe Gln Glu Val 1 5 10 15 Val Gly Gln
Glu His Val Lys Glu Pro Leu Leu Lys Ala Ile Arg Glu 20 25 30 Gly
Arg Leu Ala Gln Ala Tyr Leu Phe Ser Gly Pro Arg Gly Val Gly 35 40
45 Lys Thr Thr Thr Ala Arg Leu Leu Ala Met Ala Val Gly Cys Gln Gly
50 55 60 Glu Asp Pro Pro Cys Gly Val Cys Pro His Cys Gln Ala Val
Gln Arg 65 70 75 80 Gly Ala His Pro Asp Val Val Asp Ile Asp Ala Ala
Ser Asn Asn Ser 85 90 95 Val Glu Asp Val Arg Glu Leu Arg Glu Arg
Ile His Leu Ala Pro Leu 100 105 110 Ser Ala Pro Arg Lys Val Phe Ile
Leu Asp Glu Ala His Met Leu Ser 115 120 125 Lys Ser Ala Phe Asn Ala
Leu Leu Lys Thr Leu Glu Glu Pro Pro Pro 130 135 140 His Val Leu Phe
Val Phe Ala Thr Thr Glu Pro Glu Arg Met Pro Pro 145 150 155 160 Thr
Ile Leu Ser Arg Thr Gln His Phe Arg Phe Arg Arg Leu Thr Glu 165 170
175 Glu Glu Ile Ala Phe Lys Leu Arg Arg Ile Leu Glu Ala Val Gly Arg
180 185 190 Glu Ala Glu Glu Glu Ala Leu Leu Leu Leu Ala Arg Leu Ala
Asp Gly 195 200 205 Ala Leu Arg Asp Ala Glu Ser Leu Leu Glu Arg Phe
Leu Leu Leu Glu 210 215 220 Gly Pro Leu Thr Arg Lys Glu Val Glu Arg
Ala Leu Gly Ser Pro Pro 225 230 235 240 Gly Thr Gly Val Ala Glu Ile
Ala Ala Ser Leu Ala Arg Gly Lys Thr 245 250 255 Ala Glu Ala Leu Gly
Leu Ala Arg Arg Leu Tyr Gly Glu Gly Tyr Ala 260 265 270 Pro Arg Ser
Leu Val Ser Gly Leu Leu Glu Val Phe Arg Glu Gly Leu 275 280 285 Tyr
27 94 DNA Thermus thermophilus 27 gccggaggga gaaaaaaaaa gccgagccca
aggccccgcc cggccccacc ccgaagcgcc 60 cgcacccccg ggccccccga
ggaggaggag aggc 94 28 11 PRT Thermus thermophilus 28 Val Leu Glu
Gly Glu Lys Lys Ser Leu Ser Pro 1 5 10 29 23 DNA Artificial
Sequence Description of Artificial Sequence primer 29 cacgcntacc
tnttctccgg nac 23 30 25 DNA Artificial Sequence Description of
Artificial Sequence primer 30 gtgctcnggn ggctcctcnt cngtc 25 31 33
DNA Artificial Sequence Description of Artificial Sequence primer
31 gtgggatccg tggttctgga tctcgatgaa gaa 33 32 29 DNA Artificial
Sequence Description of Artificial Sequence primer 32 gtgggatcca
cggsctstcs gagcagaag 29 33 34 DNA Artificial Sequence Description
of Artificial Sequence primer 33 gcgggatcct caacgaggac ctctccatct
tcaa 34 34 35 DNA Artificial Sequence Description of Artificial
Sequence primer 34 gcgggatcct tgtcgtcsag sgtsagsgcg tcgta 35 35 39
DNA Artificial Sequence Description of Artificial Sequence primer
35 gggaaggacc agcgcgtact ccccctgctc ctaggtgtg 39 36 27 DNA
Artificial Sequence Description of Artificial Sequence primer 36
gtgtggatcc ttcttcttsc ccatsgc 27 37 27 DNA Artificial Sequence
Description of Artificial Sequence primer 37 caccgattcc agtggtgcct
aggtgtg 27 38 30 DNA Artificial Sequence Description of Artificial
Sequence primer 38 caacacctgg tgttccagga gcctgtgctt 30 39 23 DNA
Artificial Sequence Description of Artificial Sequence primer 39
ccagaatcgt ctgctggtcg tag 23 40 19 DNA Artificial Sequence
Description of Artificial Sequence primer 40 agcaccctgg aggagcttc
19 41 19 DNA Artificial Sequence Description of Artificial Sequence
primer 41 catgtcgtac tgggtgtac 19 42 27 DNA Artificial Sequence
Description of Artificial Sequence primer 42 gtsgtsnnsg acnnsgagac
sacsggg 27 43 27 DNA Artificial Sequence Description of Artificial
Sequence primer 43 gaasccsnng tcgaasnngg cgttgtg 27 44 27 DNA
Artificial Sequence Description of Artificial Sequence primer 44
cggggatcca cctcaatcac ctcgtgg 27 45 30 DNA Artificial Sequence
Description of Artificial Sequence primer 45 cggggatccg ccaccttgcg
gctccgggtg 30 46 31 DNA Artificial Sequence Description of
Artificial Sequence primer 46 gcgctctaga cgagttccca aagcgtgcgg t 31
47 25 DNA Artificial Sequence Description of Artificial Sequence
primer 47 cgcgtctaga tcacctgtat ccaga 25 48 33 DNA Artificial
Sequence Description of Artificial Sequence primer 48 gcggcgcata
tggtggtggt cctggacctg gag
33 49 25 DNA Artificial Sequence Description of Artificial Sequence
primer 49 cgcgtctaga tcacctgtat ccaga 25 50 20 DNA Artificial
Sequence Description of Artificial Sequence primer 50 gtsctsgtsa
agacscactt 20 51 21 DNA Artificial Sequence Description of
Artificial Sequence primer 51 sagsagsgcg ttgaasgtgt g 21 52 22 DNA
Artificial Sequence Description of Artificial Sequence primer 52
ctcgttggtg aaagtttccg tg 22 53 22 DNA Artificial Sequence
Description of Artificial Sequence primer 53 ctcgttggtg aaagtttccg
tg 22 54 27 DNA Artificial Sequence Description of Artificial
Sequence primer 54 tctggcaaca cgttctggag cacatcc 27 55 23 DNA
Artificial Sequence Description of Artificial Sequence primer 55
tgctggcgtt catcttcagg atg 23 56 23 DNA Artificial Sequence
Description of Artificial Sequence primer 56 catcctgaag atgaacgcca
gca 23 57 25 DNA Artificial Sequence Description of Artificial
Sequence primer 57 aggttatcca caggggtcat gtgca 25 58 29 DNA
Artificial Sequence Description of Artificial Sequence primer 58
gtgtgtcata tgaacataac ggttcccaa 29 59 29 DNA Artificial Sequence
Description of Artificial Sequence primer 59 gcgcgaattc tcccttgtgg
aaggcttag 29 60 13 PRT Thermus thermophilus 60 Arg Val Glu Leu Asp
Tyr Asp Ala Leu Thr Leu Asp Asp 1 5 10 61 14 PRT Thermus
thermophilus 61 Phe Phe Ile Glu Ile Gln Asn His Gly Leu Ser Glu Gln
Lys 1 5 10 62 8 PRT Thermus thermophilus 62 Phe Phe Ile Glu Ile Gln
Asn His 1 5 63 8 PRT Thermus thermophilus 63 Tyr Asp Ala Leu Thr
Leu Asp Asp 1 5 64 6 PRT Thermus thermophilus 64 Ala Met Gly Lys
Lys Lys 1 5 65 9 PRT Thermus thermophilus 65 Phe Asn Lys Ser His
Ser Ala Ala Tyr 1 5 66 9 PRT Artificial Sequence Description of
Artificial Sequence peptide 66 Val Val Xaa Asp Xaa Glu Thr Thr Gly
1 5 67 9 PRT Artificial Sequence Description of Artificial Sequence
peptide 67 His Asn Ala Xaa Phe Asp Xaa Gly Phe 1 5 68 9 PRT
Artificial Sequence Description of Artificial Sequence peptide 68
Val Val Xaa Asp Xaa Glu Thr Thr Gly 1 5 69 7 PRT Thermus
thermophilus 69 Val Leu Val Lys Thr His Leu 1 5 70 6 PRT Artificial
Sequence Description of Artificial Sequence peptide 70 His Arg Ala
Leu Tyr Asp 1 5 71 7 PRT Thermus thermophilus 71 His Thr Phe Asn
Ala Leu Leu 1 5 72 34 PRT Escherichia coli 72 Asp Arg Tyr Phe Leu
Glu Leu Ile Arg Thr Gly Arg Pro Asp Glu Glu 1 5 10 15 Ser Tyr Leu
His Ala Ala Val Glu Leu Ala Glu Ala Arg Gly Leu Pro 20 25 30 Val
Val 73 34 PRT Vibrio cholerae 73 Asp His Phe Tyr Leu Glu Leu Ile
Arg Thr Gly Arg Ala Asp Glu Glu 1 5 10 15 Ser Tyr Leu His Phe Ala
Leu Asp Val Ala Glu Gln Tyr Asp Leu Pro 20 25 30 Val Val 74 34 PRT
Haemophilus influenzae 74 Asp His Phe Tyr Leu Ala Leu Ser Arg Thr
Gly Arg Pro Asn Glu Glu 1 5 10 15 Arg Tyr Ile Gln Ala Ala Leu Lys
Leu Ala Glu Arg Cys Asp Leu Pro 20 25 30 Leu Val 75 34 PRT
Rickettsia prowazekii 75 Asp Arg Phe Tyr Phe Glu Ile Met Arg His
Asp Leu Pro Glu Glu Gln 1 5 10 15 Phe Ile Glu Asn Ser Tyr Ile Gln
Ile Ala Ser Glu Leu Ser Ile Pro 20 25 30 Ile Val 76 34 PRT
Helicobacter pylori 76 Asp Asp Phe Tyr Leu Glu Ile Met Arg His Gly
Ile Leu Asp Gln Arg 1 5 10 15 Phe Ile Asp Glu Gln Val Ile Lys Met
Ser Leu Glu Thr Gly Leu Lys 20 25 30 Ile Ile 77 34 PRT
Synechocystis sp. 77 Asp Asp Tyr Tyr Leu Glu Ile Gln Asp His Gly
Ser Val Glu Asp Arg 1 5 10 15 Leu Val Asn Ile Asn Leu Val Lys Ile
Ala Gln Glu Leu Asp Ile Lys 20 25 30 Ile Val 78 34 PRT
Mycobacterium tuberculosis 78 Asp Asn Tyr Phe Leu Glu Leu Met Asp
His Gly Leu Thr Ile Glu Arg 1 5 10 15 Arg Val Arg Asp Gly Leu Leu
Glu Ile Gly Arg Ala Leu Asn Ile Pro 20 25 30 Pro Leu 79 46 PRT
Escherichia coli 79 Asn Lys Arg Arg Ala Lys Asn Gly Glu Pro Pro Leu
Asp Ile Ala Ala 1 5 10 15 Ile Pro Leu Asp Asp Lys Lys Ser Phe Asp
Met Leu Gln Arg Ser Glu 20 25 30 Thr Thr Ala Val Phe Gln Leu Glu
Ser Arg Gly Met Lys Asp 35 40 45 80 46 PRT Vibrio cholerae 80 Asn
Pro Arg Leu Lys Lys Ala Gly Lys Pro Pro Val Arg Ile Glu Ala 1 5 10
15 Ile Pro Leu Asp Asp Ala Arg Ser Phe Arg Asn Leu Gln Asp Ala Lys
20 25 30 Thr Thr Ala Val Phe Gln Leu Glu Ser Arg Gly Met Lys Glu 35
40 45 81 46 PRT Haemophilus influenzae 81 Asn Val Arg Met Val Arg
Glu Gly Lys Pro Arg Val Asp Ile Ala Ala 1 5 10 15 Ile Pro Leu Asp
Asp Pro Glu Ser Phe Glu Leu Leu Lys Arg Ser Glu 20 25 30 Thr Thr
Ala Val Phe Gln Leu Glu Ser Arg Gly Met Lys Asp 35 40 45 82 46 PRT
Rickettsia prowazekii 82 Cys Lys Lys Leu Leu Lys Glu Gln Gly Ile
Lys Ile Asp Phe Asp Asp 1 5 10 15 Met Thr Phe Asp Asp Lys Lys Thr
Tyr Gln Met Leu Cys Lys Gly Lys 20 25 30 Gly Val Gly Val Phe Gln
Phe Glu Ser Ile Gly Met Lys Asp 35 40 45 83 45 PRT Helicobacter
pylori 83 Leu Lys Ile Ile Lys Thr Gln His Lys Ile Ser Val Asp Phe
Leu Ser 1 5 10 15 Leu Asp Met Asp Asp Pro Lys Val Tyr Lys Thr Ile
Gln Ser Gly Asp 20 25 30 Thr Val Gly Ile Phe Gln Ile Glu Ser Gly
Met Phe Gln 35 40 45 84 46 PRT Synechocystis sp. 84 Gln Glu Arg Lys
Ala Leu Gln Ile Arg Ala Arg Thr Gly Ser Lys Lys 1 5 10 15 Leu Pro
Asp Asp Val Lys Lys Thr His Lys Leu Leu Glu Ala Gly Asp 20 25 30
Leu Glu Gly Ile Phe Gln Leu Glu Ser Gln Gly Met Lys Gln 35 40 45 85
46 PRT Mycobacterium tuberculosis 85 Ile Asp Asn Val Arg Ala Asn
Arg Gly Ile Asp Leu Asp Leu Glu Ser 1 5 10 15 Val Pro Leu Asp Asp
Lys Ala Thr Tyr Glu Leu Leu Gly Arg Gly Asp 20 25 30 Thr Leu Gly
Val Phe Gln Leu Asp Gly Gly Pro Met Arg Asp 35 40 45 86 3729 DNA
Thermus thermophilus 86 atgggccggg agctccgctt cgcccacctc caccagcaca
cccagttctc cctcctggac 60 ggggcggcga agctttccga cctcctcaag
tgggtcaagg agacgacccc cgaggacccc 120 gccttggcca tgaccgacca
cggcaacctc ttcggggccg tggagttcta caagaaggcc 180 accgaaatgg
gcatcaagcc catcctgggc tacgaggcct acgtggcggc ggaaagccgc 240
tttgaccgca agcggggaaa gggcctagac gggggctact ttcacctcac cctcctcgcc
300 aaggacttca cggggtacca gaacctggtg cgcctggcga gccgggctta
cctggagggg 360 ttttacgaaa agccccggat tgaccgggag atcctgcgcg
agcacgccga gggcctcatc 420 gccctctcgg ggtgcctcgg ggcggagatc
ccccagttca tcctccagga ccgtctggac 480 ctggccgagg cccggctcaa
cgagtacctc tccatcttca aggaccgctt cttcatcgag 540 atccagaacc
acggcctccc cgagcagaaa aaggtcaacg aggtcctcaa ggagttcgcc 600
cgaaagtacg gcctggggat ggtggccacc aacgacggcc attacgtgag gaaggaggac
660 gcccgcgccc acgaggtcct cctcgccatc cagtccaaga gcaccctgga
cgaccccggg 720 cgctggcgct tcccctgcga cgagttctac gtgaagaccc
ccgaggagat gcgggccatg 780 ttccccgagg aggagtgggg ggacgagccc
tttgacaaca ccgtggagat cgcccgcatg 840 tgcaacgtgg agctgcccat
cggggacaag atggtctacc gaatcccccg cttccccctc 900 cccgaggggc
ggaccgaggc ccagtacctc atggagctca ccttcaaggg gctcctccgc 960
cgctacccgg accggatcac cgagggcttc taccgggagg tcttccgcct tttggggaag
1020 cttccccccc acggggacgg ggaggccttg gccgaggcct tggcccaggt
ggagcgggag 1080 gcttgggaga ggctcatgaa gagcctcccc cctttggccg
gggtcaagga gtggacggcg 1140 gaggccattt tccaccgggc cctttacgag
ctttccgtga tagagcgcat ggggtttccc 1200 ggctacttcc tcatcgtcca
ggactacatc aactgggccc ggagaaacgg cgtctccgtg 1260 gggcccggca
gggggagcgc cgccgggagc ctggtggcct acgccgtggg gatcaccaac 1320
attgaccccc tccgcttcgg cctcctcttt gagcgcttcc tgaacccgga gagggtctcc
1380 atgcccgaca ttgacacgga cttctccgac cgggagcggg accgggtgat
ccagtacgtg 1440 cgggagcgct acggcgagga caaggtggcc cagatcggca
ccctgggaag cctcgcctcc 1500 aaggccgccc tcaaggacgt ggcccgggtc
tacggcatcc cccacaagaa ggcggaggaa 1560 ttggccaagc tcatcccggt
gcagttcggg aagcccaagc ccctgcagga ggccatccag 1620 gtggtgccgg
agcttagggc ggagatggag aaggacccca aggtgcggga ggtcctcgag 1680
gtggccatgc gcctggaggg cctgaaccgc cacgcctccg tccacgccgc cggggtggtg
1740 atcgccgccg agcccctcac ggacctcgtc cccctcatgc gcgaccagga
agggcggccc 1800 gtcacccagt acgacatggg ggcggtggag gccttggggc
ttttgaagat ggactttttg 1860 ggcctccgca ccctcacctt cctggacgag
gtcaagcgca tcgtcaaggc gtcccagggg 1920 gtggagctgg actacgatgc
cctccccctg gacgacccca agaccttcgc cctcctctcc 1980 cggggggaga
ccaagggggt cttccagctg gagtcggggg ggatgaccgc cacgctccgc 2040
ggcctcaagc cgcggcgctt tgaggacctg atcgccatcc tctccctcta ccgccccggg
2100 cccatggagc acatccccac ctacatccgc cgccaccacg ggctggagcc
cgtgagctac 2160 agcgagtttc cccacgccga gaagtaccta aagcccatcc
tggacgagac ctacggcatc 2220 cccgtctacc aggagcagat catgcagatc
gcctcggccg tggcggggta ctccctgggc 2280 gaggcggacc tcctgcggcg
gtccatgggc aagaagaagg tggaggagat gaagtcccac 2340 cgggagcgct
tcgtccaggg ggccaaggaa aggggcgtgc ccgaggagga ggccaaccgc 2400
ctctttgaca tgctggaggc cttcgccaac tacggcttca acaaatccca cgctgccgcc
2460 tacagcctcc tctcctacca gaccgcctac gtgaaggccc actaccccgt
ggagttcatg 2520 gccgccctcc tctccgtgga gcggcacgac tccgacaagg
tggccgagta catccgcgac 2580 gcccgggcca tgggcataga ggtccttccc
ccggacgtca accgctccgg gtttgacttc 2640 ctggtccagg gccggcagat
ccttttcggc ctctccgcgg tgaagaacgt gggcgaggcg 2700 gcggcggagg
ccattctccg ggagcgggag cggggcggcc cctaccggag cctcggcgac 2760
ttcctcaagc ggctggacga gaaggtgctc aacaagcgga ccctggagtc cctcatcaag
2820 gcgggcgccc tggacggctt cggggaaagg gcgcggctcc tcgcctccct
ggaagggctc 2880 ctcaagtggg cggccgagaa ccgggagaag gcccgctcgg
gcatgatggg cctcttcagc 2940 gaagtggagg agccgccttt ggccgaggcc
gcccccctgg acgagatcac ccggctccgc 3000 tacgagaagg aggccctggg
gatctacgtc tccggccacc ccatcttgcg gtaccccggg 3060 ctccgggaga
cggccacctg caccctggag gagcttcccc acctggcccg ggacctgccg 3120
ccccggtcta gggtcctcct tgccgggatg gtggaggagg tggtgcgcaa gcccacaaag
3180 agcggcggga tgatggcccg cttcgtcctc tccgacgaga cgggggcgct
tgaggcggtg 3240 gcattcggcc gggcctacga ccaggtctcc ccgaggctca
aggaggacac ccccgtgctc 3300 gtcctcgccg aggtggagcg ggaggagggg
ggcgtgcggg tgctggccca ggccgtttgg 3360 acctacgagg agctggagca
ggtcccccgg gccctcgagg tggaggtgga ggcctccctc 3420 ctggacgacc
ggggggtggc ccacctgaaa agcctcctgg acgagcacgc ggggaccctc 3480
cccctgtacg tccgggtcca gggcgccttc ggcgaggccc tcctcgccct gagggaggtg
3540 cgggtggggg aggaggctgt aggcggccgc gtggttccgg gcctacctcc
tgcccgaccg 3600 ggaggtcctt ctccagggcg gccaggcggg ggaggcccag
gaggcggtgc ccttctaggg 3660 ggtgggccgt gagacctagc gccatcgttc
tcgccggggg caaggaggcc tgggcccgac 3720 cccttttgg 3729 87 1245 PRT
Thermus thermophilus 87 Met Gly Arg Glu Leu Arg Phe Ala His Leu His
Gln His Thr Gln Phe 1 5 10 15 Ser Leu Leu Asp Gly Ala Pro Lys Leu
Ser Asp Leu Leu Lys Trp Val 20 25 30 Glu Glu Thr Thr Pro Glu Asp
Pro Ala Leu Ala Met Thr Asp His Gly 35 40 45 Asn Leu Phe Gly Ala
Val Glu Phe Tyr Lys Lys Ala Thr Glu Met Gly 50 55 60 Ile Lys Pro
Ile Leu Gly Tyr Glu Ala Tyr Val Ala Ala Glu Ser Arg 65 70 75 80 Phe
Asp Arg Lys Arg Gly Lys Gly Leu Asp Gly Gly Tyr Phe His Leu 85 90
95 Thr Leu Leu Ala Lys Asp Phe Thr Gly Tyr Gln Asn Leu Val Arg Leu
100 105 110 Ala Ser Arg Ala Tyr Leu Glu Gly Phe Tyr Glu Lys Pro Arg
Ile Asp 115 120 125 Arg Glu Ile Leu Arg Glu His Ala Glu Gly Leu Ile
Ala Leu Ser Gly 130 135 140 Cys Leu Gly Ala Glu Ile Pro Gln Phe Ile
Leu Gln Asp Arg Leu Asp 145 150 155 160 Leu Ala Glu Ala Arg Leu Asn
Glu Tyr Leu Ser Ile Phe Lys Asp Arg 165 170 175 Phe Phe Ile Glu Ile
Gln Asn His Gly Leu Pro Glu Gln Lys Lys Val 180 185 190 Asn Glu Val
Leu Lys Glu Phe Ala Arg Lys Tyr Gly Leu Gly Met Val 195 200 205 Ala
Thr Asn Asp Gly His Tyr Val Arg Lys Glu Asp Ala Arg Ala His 210 215
220 Glu Val Leu Leu Ala Ile Gln Ser Lys Ser Thr Leu Asp Asp Pro Gly
225 230 235 240 Ala Leu Ala Leu Pro Cys Glu Glu Phe Tyr Val Lys Thr
Pro Glu Glu 245 250 255 Met Arg Ala Met Phe Pro Glu Glu Glu Val Gly
Gly Arg Ser Pro Leu 260 265 270 Thr Thr Pro Trp Arg Ser Pro His Val
Gln Arg Gly Ala Ala Ile Gly 275 280 285 Thr Arg Trp Ser Thr Arg Ile
Pro Arg Phe Pro Leu Pro Glu Gly Arg 290 295 300 Thr Glu Ala Gln Tyr
Leu Met Glu Leu Thr Phe Lys Gly Leu Leu Arg 305 310 315 320 Arg Tyr
Pro Asp Arg Ile Thr Glu Gly Phe Tyr Arg Glu Val Phe Arg 325 330 335
Leu Ser Gly Lys Leu Pro Pro His Gly Asp Gly Glu Ala Leu Ala Glu 340
345 350 Ala Leu Ala Gln Val Glu Arg Glu Ala Trp Glu Arg Leu Met Lys
Ser 355 360 365 Leu Pro Pro Leu Ala Gly Val Lys Glu Trp Thr Ala Glu
Ala Ile Phe 370 375 380 His Arg Ala Leu Tyr Glu Leu Ser Ala Ile Glu
Arg Met Gly Phe Pro 385 390 395 400 Gly Leu Leu Pro His Arg Pro Gly
Leu His Gln Leu Gly Pro Glu Lys 405 410 415 Gly Val Ser Val Gly Pro
Gly Arg Gly Gly Ala Ala Gly Ser Leu Val 420 425 430 Ala Tyr Ala Val
Gly Ile Thr Asn Ile Asp Pro Leu Arg Phe Gly Leu 435 440 445 Leu Phe
Glu Arg Phe Leu Asn Pro Glu Arg Val Ser Met Pro Asp Ile 450 455 460
Asp Thr Asp Phe Ser Asp Arg Glu Arg Asp Arg Val Ile Gln Tyr Val 465
470 475 480 Arg Glu Arg Tyr Gly Glu Asp Lys Val Ala Gln Ile Gly Thr
Leu Gly 485 490 495 Ser Leu Ala Ser Lys Ala Ala Leu Lys Glu Val Ala
Arg Val Tyr Gly 500 505 510 Ile Pro Arg Lys Lys Ala Glu Glu Leu Ala
Lys Leu Ile Pro Val Gln 515 520 525 Phe Gly Lys Pro Lys Pro Leu Gln
Glu Ala Ile Gln Val Val Pro Glu 530 535 540 Leu Arg Ala Glu Met Glu
Lys Asp Pro Lys Val Arg Glu Val Leu Glu 545 550 555 560 Val Ala Met
Arg Leu Glu Gly Leu Asn Arg His Ala Ser Val His Ala 565 570 575 Gly
Arg Gly Gly Val Phe Ser Glu Pro Leu Thr Asp Leu Val Pro Leu 580 585
590 Cys Ala Thr Arg Lys Gly Gly Pro Tyr Thr Gln Tyr Asp Met Gly Ala
595 600 605 Val Glu Ala Leu Gly Leu Leu Lys Met Asp Phe Leu Gly Leu
Arg Thr 610 615 620 Leu Thr Phe Leu Asp Glu Val Lys Arg Ile Val Lys
Ala Ser Gln Gly 625 630 635 640 Val Glu Leu Asp Tyr Asp Ala Leu Pro
Leu Asp Asp Pro Lys Thr Phe 645 650 655 Ala Leu Leu Ser Arg Gly Glu
Thr Lys Gly Val Phe Gln Leu Glu Ser 660 665 670 Gly Gly Met Thr Ala
Thr Leu Arg Gly Leu Lys Pro Arg Arg Phe Glu 675 680 685 Asp Leu Ile
Ala Ile Leu Ser Leu Tyr Arg Pro Gly Pro Met Glu His 690 695 700 Ile
Pro Thr Tyr Ile Arg Arg His His Gly Leu Glu Pro Val Ser Tyr 705 710
715 720 Ser Glu Phe Pro His Ala Glu Lys Tyr Leu Lys Pro Ile Leu Asp
Glu 725 730 735 Thr Tyr Gly Ile Pro Val Tyr Gln Glu Gln Ile Met Gln
Ile Ala Ser 740 745 750 Ala Val Ala Gly Tyr Ser Leu Gly Glu Ala Asp
Leu Leu Arg Arg Ser 755 760 765 Met Gly Lys Lys Lys Val Glu Glu Met
Lys Ser His Arg Glu Arg Phe 770 775 780 Val Gln Gly Ala Lys Glu Arg
Gly Val
Pro Glu Glu Glu Ala Asn Arg 785 790 795 800 Leu Phe Asp Met Leu Glu
Ala Phe Ala Asn Tyr Gly Phe Asn Lys Ser 805 810 815 His Ala Ala Ala
Tyr Ser Leu Leu Ser Tyr Gln Thr Ala Tyr Val Lys 820 825 830 Ala His
Tyr Pro Val Glu Phe Met Ala Ala Leu Leu Ser Val Glu Arg 835 840 845
His Asp Ser Asp Lys Val Ala Glu Tyr Ile Arg Asp Ala Arg Ala Met 850
855 860 Gly Ile Glu Val Leu Pro Pro Asp Val Asn Arg Ser Gly Phe Asp
Phe 865 870 875 880 Leu Val Gln Gly Arg Gln Ile Leu Phe Gly Leu Ser
Ala Val Lys Asn 885 890 895 Val Gly Glu Ala Ala Ala Glu Ala Ile Leu
Arg Glu Arg Glu Arg Gly 900 905 910 Gly Pro Tyr Arg Ser Leu Gly Asp
Phe Leu Lys Arg Leu Asp Glu Lys 915 920 925 Val Leu Asn Lys Arg Thr
Leu Glu Ser Leu Ile Lys Ala Gly Ala Leu 930 935 940 Asp Gly Phe Gly
Glu Arg Ala Arg Leu Leu Ala Ser Leu Glu Gly Leu 945 950 955 960 Leu
Lys Trp Ala Ala Glu Asn Arg Glu Lys Ala Arg Ser Gly Met Met 965 970
975 Gly Leu Phe Ser Glu Val Glu Glu Pro Pro Leu Ala Glu Ala Ala Pro
980 985 990 Leu Asp Glu Ile Thr Arg Leu Arg Tyr Glu Lys Glu Ala Leu
Gly Ile 995 1000 1005 Tyr Val Ser Gly His Pro Ile Leu Arg Tyr Pro
Gly Leu Arg Glu Thr 1010 1015 1020 Ala Thr Cys Thr Leu Glu Glu Leu
Pro His Leu Ala Arg Asp Leu Pro 1025 1030 1035 1040 Pro Arg Ser Arg
Val Leu Leu Ala Gly Met Val Glu Glu Val Val Arg 1045 1050 1055 Lys
Pro Thr Lys Ser Gly Gly Met Met Ala Arg Phe Val Leu Ser Asp 1060
1065 1070 Glu Thr Gly Ala Leu Glu Ala Val Ala Phe Gly Arg Ala Tyr
Asp Gln 1075 1080 1085 Val Ser Pro Arg Leu Lys Glu Asp Thr Pro Val
Leu Val Leu Ala Glu 1090 1095 1100 Val Glu Arg Glu Glu Gly Gly Val
Arg Val Leu Ala Gln Ala Val Trp 1105 1110 1115 1120 Thr Tyr Gln Glu
Leu Glu Gln Val Pro Arg Ala Leu Glu Val Glu Val 1125 1130 1135 Glu
Ala Ser Leu Pro Asp Asp Arg Gly Val Ala His Leu Lys Ser Leu 1140
1145 1150 Leu Asp Glu His Ala Gly Thr Leu Pro Leu Tyr Val Arg Val
Gln Gly 1155 1160 1165 Ala Phe Gly Glu Ala Leu Leu Ala Leu Arg Glu
Val Arg Val Gly Glu 1170 1175 1180 Glu Ala Leu Gly Ala Leu Glu Ala
Ala Gly Phe Pro Ala Tyr Leu Leu 1185 1190 1195 1200 Pro Asn Arg Glu
Val Ser Pro Arg Leu Thr Gly Ser Gly Gly Pro Arg 1205 1210 1215 Gly
Arg Ala Leu Ser Thr Gly Leu Ala Leu Lys Thr Tyr Pro Ile Ala 1220
1225 1230 Leu Pro Gly Gly Asn Glu Ala Leu Ala Arg Pro Leu Leu 1235
1240 1245 88 198 PRT Thermus thermophilus 88 Val Glu Arg Val Val
Arg Thr Leu Leu Asp Gly Arg Phe Leu Leu Glu 1 5 10 15 Glu Gly Val
Gly Leu Trp Glu Trp Arg Tyr Pro Phe Pro Leu Glu Gly 20 25 30 Glu
Ala Val Val Val Leu Asp Leu Glu Thr Thr Gly Leu Ala Gly Leu 35 40
45 Asp Glu Val Ile Glu Val Gly Leu Leu Arg Leu Glu Gly Gly Arg Arg
50 55 60 Leu Pro Phe Gln Ser Leu Val Arg Pro Leu Pro Pro Ala Glu
Ala Arg 65 70 75 80 Ser Trp Asn Leu Thr Gly Ile Pro Arg Glu Ala Leu
Glu Glu Ala Pro 85 90 95 Ser Leu Glu Glu Val Leu Glu Lys Ala Tyr
Pro Leu Arg Gly Asp Ala 100 105 110 Thr Leu Val Ile His Asn Ala Ala
Phe Asp Leu Gly Phe Leu Arg Pro 115 120 125 Ala Leu Glu Gly Leu Gly
Tyr Arg Leu Glu Asn Pro Val Val Asp Ser 130 135 140 Leu Arg Leu Ala
Arg Arg Gly Leu Pro Gly Leu Arg Arg Tyr Gly Leu 145 150 155 160 Asp
Ala Leu Ser Glu Val Leu Glu Leu Pro Arg Arg Thr Cys His Arg 165 170
175 Ala Leu Glu Asp Val Glu Arg Thr Leu Ala Val Val His Glu Val Tyr
180 185 190 Tyr Met Leu Thr Ser Gly 195 89 182 PRT Deinococcus
radiodurans PEPTIDE (79) X at position 79 is undefined 89 Pro Trp
Pro Gln Asp Val Val Val Phe Asp Leu Glu Thr Thr Gly Phe 1 5 10 15
Ser Pro Ala Ser Ala Ala Ile Val Glu Ile Gly Ala Val Arg Ile Val 20
25 30 Gly Gly Gln Ile Asp Glu Thr Leu Lys Phe Glu Thr Leu Val Arg
Pro 35 40 45 Thr Arg Pro Asp Gly Ser Met Leu Ser Ile Pro Trp Gln
Ala Gln Arg 50 55 60 Val His Gly Ile Ser Asp Glu Met Val Arg Arg
Ala Pro Ala Xaa Lys 65 70 75 80 Asp Val Leu Pro Asp Phe Phe Asp Phe
Val Asp Gly Ser Ala Val Val 85 90 95 Ala His Asn Val Ser Phe Asp
Gly Gly Phe Met Arg Ala Gly Ala Glu 100 105 110 Arg Leu Gly Leu Ser
Trp Ala Pro Glu Arg Glu Leu Cys Thr Met Gln 115 120 125 Leu Ser Arg
Arg Ala Phe Pro Arg Glu Arg Thr His Asn Leu Thr Val 130 135 140 Leu
Ala Glu Arg Leu Gly Leu Glu Phe Ala Pro Gly Gly Arg His Arg 145 150
155 160 Ser Tyr Gly Asp Val Gln Val Thr Ala Gln Ala Tyr Leu Arg Leu
Leu 165 170 175 Glu Leu Leu Gly Glu Arg 180 90 201 PRT Bacillus
subtilis 90 His Gly Ile Lys Met Ile Tyr Gly Met Glu Ala Asn Leu Val
Asp Asp 1 5 10 15 Gly Val Pro Ile Ala Tyr Asn Ala Ala His Arg Leu
Leu Glu Glu Glu 20 25 30 Thr Tyr Val Val Phe Asp Val Glu Thr Thr
Gly Leu Ser Ala Val Tyr 35 40 45 Asp Thr Ile Ile Glu Leu Ala Ala
Val Lys Val Lys Gly Gly Glu Ile 50 55 60 Ile Asp Lys Phe Glu Ala
Phe Ala Asn Pro His Arg Pro Leu Ser Ala 65 70 75 80 Thr Ile Ile Glu
Leu Thr Gly Ile Thr Asp Asp Met Leu Gln Asp Ala 85 90 95 Pro Asp
Val Val Asp Val Ile Arg Asp Phe Arg Glu Trp Ile Gly Asp 100 105 110
Asp Ile Leu Val Ala His Asn Ala Ser Phe Asp Met Gly Phe Leu Asn 115
120 125 Val Ala Tyr Lys Lys Leu Leu Glu Val Glu Lys Ala Lys Asn Pro
Val 130 135 140 Ile Asp Thr Leu Glu Leu Gly Arg Phe Leu Tyr Pro Glu
Phe Lys Asn 145 150 155 160 His Arg Leu Asn Thr Leu Cys Lys Lys Phe
Asp Ile Glu Leu Thr Gln 165 170 175 His His Arg Ala Ile Tyr Asp Thr
Glu Ala Thr Ala Tyr Leu Leu Leu 180 185 190 Lys Met Leu Lys Asp Ala
Ala Glu Lys 195 200 91 188 PRT Haemophilus influenzae PEPTIDE (47)
X at position 47 is undefined 91 Met Ile Asn Pro Asn Arg Gln Ile
Val Leu Asp Thr Glu Thr Thr Gly 1 5 10 15 Met Asn Gln Leu Gly Ala
His Tyr Glu Gly His Cys Ile Ile Glu Ile 20 25 30 Gly Ala Val Glu
Leu Ile Asn Arg Arg Tyr Thr Gly Asn Asn Xaa His 35 40 45 Ile Tyr
Ile Lys Pro Asp Arg Pro Xaa Asp Pro Asp Ala Ile Lys Val 50 55 60
His Gly Ile Thr Asp Glu Met Leu Ala Asp Lys Pro Glu Phe Lys Glu 65
70 75 80 Val Ala Gln Asp Phe Leu Asp Tyr Ile Asn Gly Ala Glu Leu
Leu Ile 85 90 95 His Asn Ala Pro Phe Asp Val Gly Phe Met Asp Tyr
Glu Phe Arg Lys 100 105 110 Leu Asn Leu Asn Val Lys Thr Asp Asp Ile
Cys Leu Val Thr Asp Thr 115 120 125 Leu Gln Met Ala Arg Gln Met Tyr
Pro Gly Lys Arg Asn Asn Leu Asp 130 135 140 Ala Leu Cys Asp Arg Leu
Gly Ile Asp Asn Ser Lys Arg Thr Leu His 145 150 155 160 Gly Ala Leu
Leu Asp Ala Glu Ile Leu Ala Asp Val Tyr Leu Met Met 165 170 175 Thr
Gly Gly Gln Thr Asn Leu Phe Asp Glu Glu Glu 180 185 92 189 PRT
Escherichia coli 92 Met Ser Thr Ala Ile Thr Arg Gln Ile Val Leu Asp
Thr Glu Thr Thr 1 5 10 15 Gly Met Asn Gln Ile Gly Ala His Ser Glu
Gly His Lys Ile Ile Glu 20 25 30 Ile Gly Ala Val Glu Val Val Asn
Arg Arg Leu Thr Gly Asn Asn Phe 35 40 45 His Val Tyr Leu Lys Asp
Arg Leu Val Asp Pro Glu Ala Phe Gly Val 50 55 60 His Gly Ile Ala
Val Asp Phe Leu Leu Asp Lys Pro Thr Phe Ala Glu 65 70 75 80 Val Ala
Val Glu Phe Met Asp Tyr Ile Arg Gly Ala Glu Leu Val Ile 85 90 95
His Asn Ala Ala Phe Asp Ile Gly Phe Met Asp Tyr Glu Phe Ser Leu 100
105 110 Leu Lys Arg Asp Ile Ala Lys Thr Asn Thr Phe Cys Lys Val Thr
Asp 115 120 125 Ser Leu Ala Val Ala Arg Lys Met Phe Pro Gly Lys Arg
Asn Ser Leu 130 135 140 Asp Ala Leu Cys Ala Arg Tyr Glu Ile Asp Asn
Ser Lys Arg Thr Leu 145 150 155 160 His Gly Ala Leu Leu Asp Ala Gln
Ile Leu Ala Glu Val Tyr Leu Ala 165 170 175 Met Thr Gly Gly Gln Thr
Ser Met Ala Phe Ala Met Glu 180 185 93 201 PRT Helicobacter pylori
93 Asn Leu Glu Tyr Leu Lys Ala Cys Gly Leu Asn Phe Ile Glu Thr Ser
1 5 10 15 Glu Asn Leu Ile Thr Leu Lys Asn Leu Lys Thr Pro Leu Lys
Asp Glu 20 25 30 Val Phe Ser Phe Ile Asp Leu Glu Thr Thr Gly Ser
Cys Pro Ile Lys 35 40 45 His Glu Ile Leu Glu Ile Gly Ala Val Gln
Val Lys Gly Gly Glu Ile 50 55 60 Ile Asn Arg Phe Glu Thr Leu Val
Lys Val Lys Ser Val Pro Asp Tyr 65 70 75 80 Ile Ala Glu Leu Thr Gly
Ile Thr Tyr Glu Asp Thr Leu Asn Ala Pro 85 90 95 Ser Ala His Glu
Ala Leu Gln Glu Leu Arg Leu Phe Leu Gly Asn Ser 100 105 110 Val Phe
Val Ala His Asn Ala Asn Phe Asp Tyr Asn Phe Leu Gly Arg 115 120 125
Tyr Phe Val Glu Lys Leu His Cys Pro Leu Leu Asn Leu Lys Leu Cys 130
135 140 Thr Leu Asp Leu Ser Lys Arg Ala Ile Leu Ser Met Arg Tyr Ser
Leu 145 150 155 160 Ser Phe Leu Lys Glu Leu Leu Gly Phe Gly Ile Glu
Val Ser His Arg 165 170 175 Ala Tyr Ala Asp Ala Leu Ala Ser Tyr Lys
Leu Phe Glu Ile Cys Leu 180 185 190 Leu Asn Leu Pro Ser Tyr Ile Lys
Thr 195 200 94 630 DNA Thermus thermophilus 94 atggtggagc
gggtggtgcg gacccttctg gacgggaggt tcctcctgga ggagggggtg 60
gggctttggg agtggcgcta cccctttccc ctggaggggg aggcggtggt ggtcctggac
120 ctggagacca cggggcttgc cggcctggac gaggtgattg aggtgggcct
cctccgcctg 180 gaggggggga ggcgcctccc cttccagagc ctcgtccggc
ccctcccgcc cgccgaagcc 240 cgttcgtgga acctcaccgg catcccccgg
gaggccctgg aggaggcccc ctccctggag 300 gaggttctgg agaaggccta
ccccctccgc ggcgacgcca ccttggtgat ccacaacgcc 360 gcctttgacc
tgggcttcct ccgcccggcc ttggagggcc tgggctaccg cctggaaaac 420
cccgtggtgg actccctgcg cttggccaga cggggcttac caggccttag gcgctacggc
480 ctggacgccc tctccgaggt cctggagctt ccccgaagga cctgccaccg
ggccctcgag 540 gacgtggagc gcaccctcgc cgtggtgcac gaggtatact
atatgcttac gtccggccgt 600 ccccgcacgc tttgggaact cgggaggtag 630 95
210 PRT Thermus thermophilus 95 Met Val Glu Arg Val Val Arg Thr Leu
Leu Asp Gly Arg Phe Leu Leu 1 5 10 15 Glu Glu Gly Val Gly Leu Trp
Glu Trp Arg Tyr Pro Phe Pro Leu Glu 20 25 30 Gly Glu Ala Val Val
Val Leu Asp Leu Glu Thr Thr Gly Leu Ala Gly 35 40 45 Leu Asp Glu
Val Ile Glu Val Gly Leu Leu Arg Leu Glu Gly Gly Arg 50 55 60 Arg
Leu Pro Phe Gln Ser Leu Val Arg Pro Leu Pro Pro Ala Glu Ala 65 70
75 80 Arg Ser Trp Asn Leu Thr Gly Ile Pro Arg Glu Ala Leu Glu Glu
Ala 85 90 95 Pro Ser Leu Glu Glu Val Leu Glu Lys Ala Tyr Pro Leu
Arg Gly Asp 100 105 110 Ala Thr Leu Val Ile His Asn Ala Ala Phe Asp
Leu Gly Phe Leu Arg 115 120 125 Pro Ala Leu Glu Gly Leu Gly Tyr Arg
Leu Glu Asn Pro Val Val Asp 130 135 140 Ser Leu Arg Leu Ala Arg Arg
Gly Leu Pro Gly Leu Arg Arg Tyr Gly 145 150 155 160 Leu Asp Ala Leu
Ser Glu Val Leu Glu Leu Pro Arg Arg Thr Cys His 165 170 175 Arg Ala
Leu Glu Asp Val Glu Arg Thr Leu Ala Val Val His Glu Val 180 185 190
Tyr Tyr Met Leu Thr Ser Gly Arg Pro Arg Thr Leu Trp Glu Leu Gly 195
200 205 Arg Glx 210 96 461 PRT Pseudomonas marcesans 96 Met Leu Glu
Ala Ser Trp Glu Lys Val Gln Ser Ser Leu Lys Gln Asn 1 5 10 15 Leu
Ser Lys Pro Ser Tyr Glu Thr Trp Ile Arg Pro Thr Glu Phe Ser 20 25
30 Gly Phe Lys Asn Gly Glu Leu Thr Leu Ile Ala Pro Asn Ser Phe Ser
35 40 45 Ser Ala Trp Leu Lys Asn Asn Tyr Ser Gln Thr Ile Gln Glu
Thr Ala 50 55 60 Glu Glu Ile Phe Gly Glu Pro Val Thr Val His Val
Lys Val Lys Ala 65 70 75 80 Asn Ala Glu Ser Ser Asp Glu His Tyr Ser
Ser Ala Pro Ile Thr Pro 85 90 95 Pro Leu Glu Ala Ser Pro Gly Ser
Val Asp Ser Ser Gly Ser Ser Leu 100 105 110 Arg Leu Ser Lys Lys Thr
Leu Pro Leu Leu Asn Leu Arg Tyr Val Phe 115 120 125 Asn Arg Phe Val
Val Gly Pro Asn Ser Arg Met Ala His Ala Ala Ala 130 135 140 Met Ala
Val Ala Glu Ser Pro Gly Arg Glu Phe Asn Pro Leu Phe Ile 145 150 155
160 Cys Gly Gly Val Gly Leu Gly Lys Thr His Leu Met Gln Ala Ile Gly
165 170 175 His Tyr Arg Leu Glu Ile Asp Pro Gly Ala Lys Val Ser Tyr
Val Ser 180 185 190 Thr Glu Thr Phe Thr Asn Asp Leu Ile Leu Ala Ile
Arg Gln Asp Arg 195 200 205 Met Gln Ala Phe Arg Asp Arg Tyr Arg Ala
Ala Asp Leu Ile Leu Val 210 215 220 Asp Asp Ile Gln Phe Ile Glu Gly
Lys Glu Tyr Thr Gln Glu Glu Phe 225 230 235 240 Phe His Thr Phe Asn
Ala Leu His Asp Ala Gly Ser Gln Ile Val Leu 245 250 255 Ala Ser Asp
Arg Pro Pro Ser Gln Ile Pro Arg Leu Gln Glu Arg Leu 260 265 270 Met
Ser Arg Phe Ser Met Gly Leu Ile Ala Asp Val Gln Ala Pro Asp 275 280
285 Leu Glu Thr Arg Met Ala Ile Leu Gln Lys Lys Ala Glu His Glu Arg
290 295 300 Val Gly Leu Pro Arg Asp Leu Ile Gln Phe Ile Ala Gly Arg
Phe Thr 305 310 315 320 Ser Asn Ile Arg Glu Leu Glu Gly Ala Leu Thr
Arg Ala Ile Ala Phe 325 330 335 Ala Ser Ile Thr Gly Leu Pro Met Thr
Val Asp Ser Ile Ala Pro Met 340 345 350 Leu Asp Pro Asn Gly Gln Gly
Val Glu Val Thr Pro Lys Gln Val Leu 355 360 365 Asp Lys Val Ala Glu
Val Phe Lys Val Thr Pro Asp Glu Met Arg Ser 370 375 380 Ala Ser Arg
Arg Arg Pro Val Ser Gln Ala Arg Gln Val Gly Met Tyr 385 390 395 400
Leu Met Arg Gln Gly Thr Asn Leu Ser Leu Pro Arg Ile Gly Asp Thr 405
410 415 Phe Gly Gly Lys Asp His Thr Thr Val Met Tyr Ala Ile Glu Gln
Val 420 425 430 Glu Lys Lys Leu Ser Ser Asp Pro Gln Ile Ala Ser Gln
Val Gln Lys 435 440 445 Ile Arg Asp Leu Leu Gln Ile Asp Ser Arg Arg
Lys Arg 450 455
460 97 447 PRT Synechocystis sp. 97 Met Val Ser Cys Glu Asn Leu Trp
Gln Gln Ala Leu Ala Ile Leu Ala 1 5 10 15 Thr Gln Leu Thr Lys Pro
Ala Phe Asp Thr Trp Ile Lys Ala Ser Val 20 25 30 Leu Ile Ser Leu
Gly Asp Gly Val Ala Thr Ile Gln Val Glu Asn Gly 35 40 45 Phe Val
Leu Asn His Leu Gln Lys Ser Tyr Gly Pro Leu Leu Met Glu 50 55 60
Val Leu Thr Asp Leu Thr Gly Gln Glu Ile Thr Val Lys Leu Ile Thr 65
70 75 80 Asp Gly Leu Glu Pro His Ser Leu Ile Gly Gln Glu Ser Ser
Leu Pro 85 90 95 Met Glu Thr Thr Pro Lys Asn Ala Thr Ala Leu Asn
Gly Lys Tyr Thr 100 105 110 Phe Ser Arg Phe Val Val Gly Pro Thr Asn
Arg Met Ala His Ala Ala 115 120 125 Ser Leu Ala Val Ala Glu Ser Pro
Gly Arg Glu Phe Asn Pro Leu Phe 130 135 140 Leu Cys Gly Gly Val Gly
Leu Gly Lys Thr His Leu Met Gln Ala Ile 145 150 155 160 Ala His Tyr
Arg Leu Glu Met Tyr Pro Asn Ala Lys Val Tyr Tyr Val 165 170 175 Ser
Thr Glu Arg Phe Thr Asn Asp Leu Ile Thr Ala Ile Arg Gln Asp 180 185
190 Asn Met Glu Asp Phe Arg Ser Tyr Tyr Arg Ser Ala Asp Phe Leu Leu
195 200 205 Ile Asp Asp Ile Gln Phe Ile Lys Gly Lys Glu Tyr Thr Gln
Glu Glu 210 215 220 Phe Phe His Thr Phe Asn Ser Leu His Glu Ala Gly
Lys Gln Val Val 225 230 235 240 Val Ala Ser Asp Arg Ala Pro Gln Arg
Ile Pro Gly Leu Gln Asp Arg 245 250 255 Leu Ile Ser Arg Phe Ser Met
Gly Leu Ile Ala Asp Ile Gln Val Pro 260 265 270 Asp Leu Glu Thr Arg
Met Ala Ile Leu Gln Lys Lys Ala Glu Tyr Asp 275 280 285 Arg Ile Arg
Leu Pro Lys Glu Val Ile Glu Tyr Ile Ala Ser His Tyr 290 295 300 Thr
Ser Asn Ile Arg Glu Leu Glu Gly Ala Leu Ile Arg Ala Ile Ala 305 310
315 320 Tyr Thr Ser Leu Ser Asn Val Ala Met Thr Val Glu Asn Ile Ala
Pro 325 330 335 Val Leu Asn Pro Pro Val Glu Lys Val Ala Ala Ala Pro
Glu Thr Ile 340 345 350 Ile Thr Ile Val Ala Gln His Tyr Gln Leu Lys
Val Glu Glu Leu Leu 355 360 365 Ser Asn Ser Arg Arg Arg Glu Val Ser
Leu Ala Arg Gln Val Gly Met 370 375 380 Tyr Leu Met Arg Gln His Thr
Asp Leu Ser Leu Pro Arg Ile Gly Glu 385 390 395 400 Ala Phe Gly Gly
Lys Asp His Thr Thr Val Met Tyr Ser Cys Asp Lys 405 410 415 Ile Thr
Gln Leu Gln Gln Lys Asp Trp Glu Thr Ser Gln Thr Leu Thr 420 425 430
Ser Leu Ser His Arg Ile Asn Ile Ala Gly Gln Ala Pro Glu Ser 435 440
445 98 446 PRT Bacillus subtilis 98 Met Glu Asn Ile Leu Asp Leu Trp
Asn Gln Ala Leu Ala Gln Ile Glu 1 5 10 15 Lys Lys Leu Ser Lys Pro
Ser Phe Glu Thr Trp Met Lys Ser Thr Lys 20 25 30 Ala His Ser Leu
Gln Gly Asp Thr Leu Thr Ile Thr Ala Pro Asn Glu 35 40 45 Phe Ala
Arg Asp Trp Leu Glu Ser Arg Tyr Leu His Leu Ile Ala Asp 50 55 60
Thr Ile Tyr Glu Leu Thr Gly Glu Glu Leu Ser Ile Lys Phe Val Ile 65
70 75 80 Pro Gln Asn Gln Asp Val Glu Asp Phe Met Pro Lys Pro Gln
Val Lys 85 90 95 Lys Ala Val Lys Glu Asp Thr Ser Asp Phe Pro Gln
Asn Met Leu Asn 100 105 110 Pro Lys Tyr Thr Phe Asp Thr Phe Val Ile
Gly Ser Gly Asn Arg Phe 115 120 125 Ala His Ala Ala Ser Leu Ala Val
Ala Glu Ala Pro Ala Lys Ala Tyr 130 135 140 Asn Pro Leu Phe Ile Tyr
Gly Gly Val Gly Leu Gly Lys Thr His Leu 145 150 155 160 Met His Ala
Ile Gly His Tyr Val Ile Asp His Asn Pro Ser Ala Lys 165 170 175 Val
Val Tyr Leu Ser Ser Glu Lys Phe Thr Asn Glu Phe Ile Asn Ser 180 185
190 Ile Arg Asp Asn Lys Ala Val Asp Phe Arg Asn Arg Tyr Arg Asn Val
195 200 205 Asp Val Leu Leu Ile Asp Asp Ile Gln Phe Leu Ala Gly Lys
Glu Gln 210 215 220 Thr Gln Glu Glu Phe Phe His Thr Phe Asn Thr Leu
His Glu Glu Ser 225 230 235 240 Lys Gln Ile Val Ile Ser Ser Asp Arg
Pro Pro Lys Glu Ile Pro Thr 245 250 255 Leu Glu Asp Arg Leu Arg Ser
Arg Phe Glu Trp Gly Leu Ile Thr Asp 260 265 270 Ile Thr Pro Pro Asp
Leu Glu Thr Arg Ile Ala Ile Leu Arg Lys Lys 275 280 285 Ala Lys Ala
Glu Gly Leu Asp Ile Pro Asn Glu Val Met Leu Tyr Ile 290 295 300 Ala
Asn Gln Ile Asp Ser Asn Ile Arg Glu Leu Glu Gly Ala Leu Ile 305 310
315 320 Arg Val Val Ala Tyr Ser Ser Leu Ile Asn Lys Asp Ile Asn Ala
Asp 325 330 335 Leu Ala Ala Glu Ala Leu Lys Asp Ile Ile Pro Ser Ser
Lys Pro Lys 340 345 350 Val Ile Thr Ile Lys Glu Ile Gln Arg Val Val
Gly Gln Gln Phe Asn 355 360 365 Ile Lys Leu Glu Asp Phe Lys Ala Lys
Lys Arg Thr Lys Ser Val Ala 370 375 380 Phe Pro Arg Gln Ile Ala Met
Tyr Leu Ser Arg Glu Met Thr Asp Ser 385 390 395 400 Ser Leu Pro Lys
Ile Gly Glu Glu Phe Gly Gly Arg Asp His Thr Thr 405 410 415 Val Ile
His Ala His Glu Lys Ile Ser Lys Leu Leu Ala Asp Asp Glu 420 425 430
Gln Leu Gln Gln His Val Lys Glu Ile Lys Glu Gln Leu Lys 435 440 445
99 507 PRT Mycobacterium tuberculosis 99 Met Thr Asp Asp Pro Gly
Ser Gly Phe Thr Thr Val Trp Asn Ala Val 1 5 10 15 Val Ser Glu Leu
Asn Gly Asp Pro Lys Val Asp Asp Gly Pro Ser Ser 20 25 30 Asp Ala
Asn Leu Ser Ala Pro Leu Thr Pro Gln Gln Arg Ala Trp Leu 35 40 45
Asn Leu Val Gln Pro Leu Thr Ile Val Glu Gly Phe Ala Leu Leu Ser 50
55 60 Val Pro Ser Ser Phe Val Gln Asn Glu Ile Glu Arg His Leu Arg
Ala 65 70 75 80 Pro Ile Thr Asp Ala Leu Ser Arg Arg Leu Gly His Gln
Ile Gln Leu 85 90 95 Gly Val Arg Ile Ala Pro Pro Ala Thr Asp Glu
Ala Asp Asp Thr Thr 100 105 110 Val Pro Pro Ser Glu Asn Pro Ala Thr
Thr Ser Pro Asp Thr Thr Thr 115 120 125 Asp Asn Asp Glu Ile Asp Asp
Ser Ala Ala Ala Arg Gly Asp Asn Gln 130 135 140 His Ser Trp Pro Ser
Tyr Phe Thr Glu Arg Pro His Asn Thr Asp Ser 145 150 155 160 Ala Thr
Ala Gly Val Thr Ser Leu Asn Arg Arg Tyr Thr Phe Asp Thr 165 170 175
Phe Val Ile Gly Ala Ser Asn Arg Phe Ala His Ala Ala Ala Leu Ala 180
185 190 Ile Ala Glu Ala Pro Ala Arg Ala Tyr Asn Pro Leu Phe Ile Trp
Gly 195 200 205 Glu Ser Gly Leu Gly Lys Thr His Leu Leu His Ala Ala
Gly Asn Tyr 210 215 220 Ala Gln Arg Leu Phe Pro Gly Met Arg Val Lys
Tyr Val Ser Thr Glu 225 230 235 240 Glu Phe Thr Asn Asp Phe Ile Asn
Ser Leu Arg Asp Asp Arg Lys Val 245 250 255 Ala Phe Lys Arg Ser Tyr
Arg Asp Val Asp Val Leu Leu Val Asp Asp 260 265 270 Ile Gln Phe Ile
Glu Gly Lys Glu Gly Ile Gln Glu Glu Phe Phe His 275 280 285 Thr Phe
Asn Thr Leu His Asn Ala Asn Lys Gln Ile Val Ile Ser Ser 290 295 300
Asp Arg Pro Pro Lys Gln Leu Ala Thr Leu Glu Asp Arg Leu Arg Thr 305
310 315 320 Arg Phe Glu Trp Gly Leu Ile Thr Asp Val Gln Pro Pro Glu
Leu Glu 325 330 335 Thr Arg Ile Ala Ile Leu Arg Lys Lys Ala Gln Met
Glu Arg Leu Ala 340 345 350 Val Pro Asp Asp Val Leu Glu Leu Ile Ala
Ser Ser Ile Glu Arg Asn 355 360 365 Ile Arg Glu Leu Glu Gly Ala Leu
Ile Arg Val Thr Ala Phe Ala Ser 370 375 380 Leu Asn Lys Thr Pro Ile
Asp Lys Ala Leu Ala Glu Ile Val Leu Arg 385 390 395 400 Asp Leu Ile
Ala Asp Ala Asn Thr Met Gln Ile Ser Ala Ala Thr Ile 405 410 415 Met
Ala Ala Thr Ala Glu Tyr Phe Asp Thr Thr Val Glu Glu Leu Arg 420 425
430 Gly Pro Gly Lys Thr Arg Ala Leu Ala Gln Ser Arg Gln Ile Ala Met
435 440 445 Tyr Leu Cys Arg Glu Leu Thr Asp Leu Ser Leu Pro Lys Ile
Gly Gln 450 455 460 Ala Phe Gly Arg Asp His Thr Thr Val Met Tyr Ala
Gln Arg Lys Ile 465 470 475 480 Leu Ser Glu Met Ala Glu Arg Arg Glu
Val Phe Asp His Val Lys Glu 485 490 495 Leu Thr Thr Arg Ile Arg Gln
Arg Ser Lys Arg 500 505 100 446 PRT Thermus thermophilus 100 Met
Ser His Glu Ala Val Trp Gln His Val Leu Glu His Ile Arg Arg 1 5 10
15 Ser Ile Thr Glu Val Glu Phe His Thr Trp Phe Glu Arg Ile Arg Pro
20 25 30 Leu Gly Ile Arg Asp Gly Val Leu Glu Leu Ala Val Pro Thr
Ser Phe 35 40 45 Ala Leu Asp Trp Ile Arg Arg His Tyr Ala Gly Leu
Ile Gln Glu Gly 50 55 60 Pro Arg Leu Leu Gly Ala Gln Ala Pro Arg
Phe Glu Leu Arg Val Val 65 70 75 80 Pro Gly Val Val Val Gln Glu Asp
Ile Phe Gln Pro Pro Pro Ser Pro 85 90 95 Pro Ala Gln Ala Gln Pro
Glu Asp Thr Phe Lys Thr Ser Trp Trp Gly 100 105 110 Pro Thr Thr Pro
Trp Pro His Gly Gly Ala Val Ala Val Ala Glu Ser 115 120 125 Pro Gly
Arg Ala Tyr Asn Pro Leu Phe Ile Tyr Gly Gly Arg Gly Leu 130 135 140
Gly Lys Thr Tyr Leu Met His Ala Val Gly Pro Leu Arg Ala Lys Arg 145
150 155 160 Phe Pro His Met Arg Leu Glu Tyr Val Ser Thr Glu Thr Phe
Thr Asn 165 170 175 Glu Leu Ile Asn Arg Pro Ser Ala Arg Asp Arg Met
Thr Glu Phe Arg 180 185 190 Glu Arg Tyr Arg Ser Val Asp Leu Leu Leu
Val Asp Asp Val Gln Phe 195 200 205 Ile Ala Gly Lys Glu Arg Thr Gln
Glu Glu Phe Phe His Thr Phe Asn 210 215 220 Ala Leu Tyr Glu Ala His
Lys Gln Ile Ile Leu Ser Ser Asp Arg Pro 225 230 235 240 Pro Lys Asp
Ile Leu Thr Leu Glu Ala Arg Leu Arg Ser Arg Phe Glu 245 250 255 Trp
Gly Leu Ile Thr Asp Asn Pro Ala Pro Asp Leu Glu Thr Arg Ile 260 265
270 Ala Ile Leu Lys Met Asn Ala Ser Ser Gly Pro Glu Asp Pro Glu Asp
275 280 285 Ala Leu Glu Tyr Ile Ala Arg Gln Val Thr Ser Asn Ile Arg
Glu Trp 290 295 300 Glu Gly Ala Leu Met Arg Ala Ser Pro Phe Ala Ser
Leu Asn Gly Val 305 310 315 320 Glu Leu Thr Arg Ala Val Ala Ala Lys
Ala Leu Arg His Leu Arg Pro 325 330 335 Arg Glu Leu Glu Ala Asp Pro
Leu Glu Ile Ile Arg Lys Ala Ala Gly 340 345 350 Pro Val Arg Pro Glu
Thr Pro Gly Gly Ala His Gly Glu Arg Arg Lys 355 360 365 Lys Glu Val
Val Leu Pro Arg Gln Leu Ala Met Tyr Leu Val Arg Glu 370 375 380 Leu
Thr Pro Ala Ser Leu Pro Glu Ile Gly Gln Leu Phe Gly Gly Arg 385 390
395 400 Asp His Thr Thr Val Arg Tyr Ala Ile Gln Lys Val Gln Glu Leu
Ala 405 410 415 Gly Lys Pro Asp Arg Glu Val Gln Gly Leu Leu Arg Thr
Leu Arg Glu 420 425 430 Ala Cys Thr Asp Pro Val Asp Asn Leu Trp Ile
Thr Cys Gly 435 440 445 101 467 PRT Escherichia coli 101 Met Ser
Leu Ser Leu Trp Gln Gln Cys Leu Ala Arg Leu Gln Asp Glu 1 5 10 15
Leu Pro Ala Thr Glu Phe Ser Met Trp Ile Arg Pro Leu Gln Ala Glu 20
25 30 Leu Ser Asp Asn Thr Leu Ala Leu Tyr Ala Pro Asn Arg Phe Val
Leu 35 40 45 Asp Trp Val Arg Asp Lys Tyr Leu Asn Asn Ile Asn Gly
Leu Leu Thr 50 55 60 Ser Phe Cys Gly Ala Asp Ala Pro Gln Leu Arg
Phe Glu Val Gly Thr 65 70 75 80 Lys Pro Val Thr Gln Thr Pro Gln Ala
Ala Val Thr Ser Asn Val Ala 85 90 95 Ala Pro Ala Gln Val Ala Gln
Thr Gln Pro Gln Arg Ala Ala Pro Ser 100 105 110 Thr Arg Ser Gly Trp
Asp Asn Val Pro Ala Pro Ala Glu Pro Thr Tyr 115 120 125 Arg Ser Asn
Val Asn Val Lys His Thr Phe Asp Asn Phe Val Glu Gly 130 135 140 Lys
Ser Asn Gln Leu Ala Arg Ala Ala Ala Arg Gln Val Ala Asp Asn 145 150
155 160 Pro Gly Gly Ala Tyr Asn Pro Leu Phe Leu Tyr Gly Gly Thr Gly
Leu 165 170 175 Gly Lys Thr His Leu Leu His Ala Val Gly Asn Gly Ile
Met Ala Arg 180 185 190 Lys Pro Asn Ala Lys Val Val Tyr Met His Ser
Glu Arg Phe Val Gln 195 200 205 Asp Met Val Lys Ala Leu Gln Asn Asn
Ala Ile Glu Glu Phe Lys Arg 210 215 220 Tyr Tyr Arg Ser Val Asp Ala
Leu Leu Ile Asp Asp Ile Gln Phe Phe 225 230 235 240 Ala Asn Lys Glu
Arg Ser Gln Glu Glu Phe Phe His Thr Phe Asn Ala 245 250 255 Leu Leu
Glu Gly Asn Gln Gln Ile Ile Leu Thr Ser Asp Arg Tyr Pro 260 265 270
Lys Glu Ile Asn Gly Val Glu Asp Arg Leu Lys Ser Arg Phe Gly Trp 275
280 285 Gly Leu Thr Val Ala Ile Glu Pro Pro Glu Leu Glu Thr Arg Val
Ala 290 295 300 Ile Leu Met Lys Lys Ala Asp Glu Asn Asp Ile Arg Leu
Pro Gly Glu 305 310 315 320 Val Ala Phe Phe Ile Ala Lys Arg Leu Arg
Ser Asn Val Arg Glu Leu 325 330 335 Glu Gly Ala Leu Asn Arg Val Ile
Ala Asn Ala Asn Phe Thr Gly Arg 340 345 350 Ala Ile Thr Ile Asp Phe
Val Arg Glu Ala Leu Arg Asp Leu Leu Ala 355 360 365 Leu Gln Glu Lys
Leu Val Thr Ile Asp Asn Ile Gln Lys Thr Val Ala 370 375 380 Glu Tyr
Tyr Lys Ile Lys Val Ala Asp Leu Leu Ser Lys Arg Arg Ser 385 390 395
400 Arg Ser Val Ala Arg Pro Arg Gln Met Ala Met Ala Leu Ala Lys Glu
405 410 415 Leu Thr Asn His Ser Leu Pro Glu Ile Gly Asp Ala Phe Gly
Gly Arg 420 425 430 Asp His Thr Thr Val Leu His Ala Cys Arg Lys Ile
Glu Gln Leu Arg 435 440 445 Glu Glu Ser His Asp Ile Lys Glu Asp Phe
Ser Asn Leu Ile Arg Thr 450 455 460 Leu Ser Ser 465 102 440 PRT
Thermatoga maritima 102 Met Lys Glu Arg Ile Leu Gln Glu Ile Lys Thr
Arg Val Asn Arg Lys 1 5 10 15 Ser Trp Glu Leu Trp Phe Ser Ser Phe
Asp Val Lys Ser Ile Glu Gly 20 25 30 Asn Lys Val Val Phe Ser Val
Gly Asn Leu Phe Ile Lys Glu Trp Leu 35 40 45 Glu Lys Lys Tyr Tyr
Ser Val Leu Ser Lys Ala Val Lys Val Val Leu 50 55 60 Gly Asn Asp
Ala Thr Phe Glu Ile Thr Tyr Glu Ala Phe Glu Pro His 65 70 75 80 Ser
Ser Tyr Ser Glu Pro Leu Val Lys Lys Arg Ala Val Leu Leu Thr 85 90
95 Pro Leu Asn Pro Asp Tyr Thr Phe Glu Asn Phe Val
Val Gly Pro Gly 100 105 110 Asn Ser Phe Ala Tyr His Ala Ala Leu Glu
Val Ala Lys His Pro Gly 115 120 125 Arg Tyr Asn Pro Leu Phe Ile Tyr
Gly Gly Val Gly Leu Gly Lys Thr 130 135 140 His Leu Leu Gln Ser Ile
Gly Asn Tyr Val Val Gln Asn Glu Pro Asp 145 150 155 160 Leu Arg Val
Met Tyr Ile Thr Ser Glu Lys Phe Leu Asn Asp Leu Val 165 170 175 Asp
Ser Met Lys Glu Gly Lys Leu Asn Glu Phe Arg Glu Lys Tyr Arg 180 185
190 Lys Lys Val Asp Ile Leu Leu Ile Asp Asp Val Gln Phe Leu Ile Gly
195 200 205 Lys Thr Gly Val Gln Thr Glu Leu Phe His Thr Phe Asn Glu
Leu His 210 215 220 Asp Ser Gly Lys Gln Ile Val Ile Cys Ser Asp Arg
Glu Pro Gln Lys 225 230 235 240 Leu Ser Glu Phe Gln Asp Arg Leu Val
Ser Arg Phe Gln Met Gly Leu 245 250 255 Val Ala Lys Leu Glu Pro Pro
Asp Glu Glu Thr Arg Lys Ser Ile Ala 260 265 270 Arg Lys Met Leu Glu
Ile Glu His Gly Glu Leu Pro Glu Glu Val Leu 275 280 285 Asn Phe Val
Ala Glu Asn Val Asp Asp Asn Leu Arg Arg Leu Arg Gly 290 295 300 Ala
Ile Ile Lys Leu Leu Val Tyr Lys Glu Thr Thr Gly Lys Glu Val 305 310
315 320 Asp Leu Lys Glu Ala Ile Leu Leu Leu Lys Asp Phe Ile Lys Pro
Asn 325 330 335 Arg Val Lys Ala Met Asp Pro Ile Asp Glu Leu Ile Glu
Ile Val Ala 340 345 350 Lys Val Thr Gly Val Pro Arg Glu Glu Ile Leu
Ser Asn Ser Arg Asn 355 360 365 Val Lys Ala Leu Thr Ala Arg Arg Ile
Gly Met Tyr Val Ala Lys Asn 370 375 380 Tyr Leu Lys Ser Ser Leu Arg
Thr Ile Ala Glu Lys Phe Asn Arg Ser 385 390 395 400 His Pro Val Val
Val Asp Ser Val Lys Lys Val Lys Asp Ser Leu Leu 405 410 415 Lys Gly
Asn Lys Gln Leu Lys Ala Leu Ile Asp Glu Val Ile Gly Glu 420 425 430
Ile Ser Arg Arg Ala Leu Ser Gly 435 440 103 457 PRT Helicobacter
pylori 103 Met Asp Thr Asn Asn Asn Ile Glu Lys Glu Ile Leu Ala Leu
Val Lys 1 5 10 15 Gln Asn Pro Lys Val Ser Leu Ile Glu Tyr Glu Asn
Tyr Phe Ser Gln 20 25 30 Leu Lys Tyr Asn Pro Asn Ala Ser Lys Ser
Asp Ile Ala Phe Phe Tyr 35 40 45 Ala Pro Asn Gln Val Leu Cys Thr
Thr Ile Thr Ala Lys Tyr Gly Ala 50 55 60 Leu Leu Lys Glu Ile Leu
Ser Gln Asn Lys Val Gly Met His Leu Ala 65 70 75 80 His Ser Val Asp
Val Arg Ile Glu Val Ala Pro Lys Ile Gln Ile Asn 85 90 95 Ala Gln
Ser Asn Ile Asn Tyr Lys Ala Ile Lys Thr Ser Val Lys Asp 100 105 110
Ser Tyr Thr Phe Glu Asn Phe Val Val Gly Ser Cys Asn Asn Thr Val 115
120 125 Tyr Glu Ile Ala Lys Lys Val Ala Gln Ser Asp Thr Pro Pro Tyr
Asn 130 135 140 Pro Val Leu Phe Tyr Gly Gly Thr Gly Leu Gly Lys Thr
His Ile Leu 145 150 155 160 Asn Ala Ile Gly Asn His Ala Leu Glu Lys
His Lys Lys Val Val Leu 165 170 175 Val Thr Ser Glu Asp Phe Leu Thr
Asp Phe Leu Lys His Leu Asp Asn 180 185 190 Lys Thr Met Asp Ser Phe
Lys Ala Lys Tyr Arg His Cys Asp Phe Phe 195 200 205 Leu Leu Asp Asp
Ala Gln Phe Leu Gln Gly Lys Pro Lys Leu Glu Glu 210 215 220 Glu Phe
Phe His Thr Phe Asn Glu Leu His Ala Asn Ser Lys Gln Ile 225 230 235
240 Val Leu Ile Ser Asp Arg Ser Pro Lys Asn Ile Ala Gly Leu Glu Asp
245 250 255 Arg Leu Lys Ser Arg Phe Glu Trp Gly Ile Thr Ala Lys Val
Met Pro 260 265 270 Pro Asp Leu Glu Thr Lys Leu Ser Ile Val Lys Gln
Lys Cys Gln Leu 275 280 285 Asn Gln Ile Thr Leu Pro Glu Glu Val Met
Glu Tyr Ile Ala Gln His 290 295 300 Ile Ser Asp Asn Ile Arg Gln Met
Glu Gly Ala Ile Ile Lys Ile Ser 305 310 315 320 Val Asn Ala Asn Leu
Met Asn Ala Ser Ile Asp Leu Asn Leu Ala Lys 325 330 335 Thr Val Leu
Glu Asp Leu Gln Lys Asp His Ala Glu Gly Ser Ser Leu 340 345 350 Glu
Asn Ile Leu Leu Ala Val Ala Gln Ser Leu Asn Leu Lys Ser Ser 355 360
365 Glu Ile Lys Val Ser Ser Arg Gln Lys Asn Val Ala Leu Ala Arg Lys
370 375 380 Leu Val Val Tyr Phe Ala Arg Leu Tyr Thr Pro Asn Pro Thr
Leu Ser 385 390 395 400 Leu Ala Gln Phe Leu Asp Leu Lys Asp His Ser
Ser Ile Ser Lys Met 405 410 415 Tyr Ser Gly Val Lys Lys Met Leu Glu
Glu Glu Lys Ser Pro Phe Val 420 425 430 Leu Ser Leu Arg Glu Glu Ile
Lys Asn Arg Leu Asn Glu Leu Asn Asp 435 440 445 Lys Lys Thr Ala Phe
Asn Ser Ser Glu 450 455 104 1305 DNA Thermus thermophilus 104
gtgtcgcacg aggccgtctg gcaacacgtt ctggagcaca tccgccgcag catcaccgag
60 gtggagttcc acacctggtt tgaaaggatc cgccccttgg ggatccggga
cggggtgctg 120 gagctcgccg tgcccacctc ctttgccctg gactggatcc
ggcgccacta cgccggcctc 180 atccaggagg gccctcggct cctcggggcc
caggcgcccc ggtttgagct ccgggtggtg 240 cccggggtcg tagtccagga
ggacatcttc cagcccccgc cgagcccccc ggcccaagct 300 caacccgaag
atacctttaa aacttcgtgg tggggcccaa caactccatg gccccacggc 360
ggcgccgtgg ccgtggccga gtcccccggc cgggcctaca accccctctt catctacggg
420 ggccgtggcc tgggaaagac ctacctgatg cacgccgtgg gcccactccg
tgcgaagcgc 480 ttcccccaca tgagattaga gtacgtttcc acggaaactt
tcaccaacga gctcatcaac 540 cggccatccg cgagggaccg gatgacggag
ttccgggagc ggtaccgctc cgtggacctc 600 ctgctggtgg acgacgtcca
gttcatcgcc ggaaaggagc gcacccagga ggagtttttc 660 cacaccttca
acgcccttta cgaggcccac aagcagatca tcctctcctc cgaccggccg 720
cccaaggaca tcctcaccct ggaggcgcgc ctgcggagcc gctttgagtg gggcctgatc
780 accgacaatc cagcccccga cctggaaacc cggatcgcca tcctgaagat
gaacgccagc 840 agcgggcctg aggatcccga ggacgccctg gagtacatcg
cccggcaggt cacctccaac 900 atccgggagt gggaaggggc cctcatgcgg
gcatcgcctt tcgcctccct caacggcgtt 960 gagctgaccc gcgccgtggc
ggccaaggct ctccgacatc ttcgccccag ggagctggag 1020 gcggacccct
tggagatcat ccgcaaagcg gcgggaccag ttcggcctga aaccccggga 1080
ggagctcacg gggagcgccg caagaaggag gtggtcctcc cccggcagct cgccatgtac
1140 ctggtgcggg agctcacccc ggcctccctg cccgagatcg accagctcaa
cgacgaccgg 1200 gaccacacca cggtcctcta cgccatccag aaggtccagg
agctcgcgga aagcgaccgg 1260 gaggtgcagg gcctcctccg caccctccgg
gaggcgtgca catga 1305 105 434 PRT Thermus thermophilus 105 Val Ser
His Glu Ala Val Trp Gln His Val Leu Glu His Ile Arg Arg 1 5 10 15
Ser Ile Thr Glu Val Glu Phe His Thr Trp Phe Glu Arg Ile Arg Pro 20
25 30 Leu Gly Ile Arg Asp Gly Val Leu Glu Leu Ala Val Pro Thr Ser
Phe 35 40 45 Ala Leu Asp Trp Ile Arg Arg His Tyr Ala Gly Leu Ile
Gln Glu Gly 50 55 60 Pro Arg Leu Leu Gly Ala Gln Ala Pro Arg Phe
Glu Leu Arg Val Val 65 70 75 80 Pro Gly Val Val Val Gln Glu Asp Ile
Phe Gln Pro Pro Pro Ser Pro 85 90 95 Pro Ala Gln Ala Gln Pro Glu
Asp Thr Phe Lys Thr Ser Trp Trp Gly 100 105 110 Pro Thr Thr Pro Trp
Pro His Gly Gly Ala Val Ala Val Ala Glu Ser 115 120 125 Pro Gly Arg
Ala Tyr Asn Pro Leu Phe Ile Tyr Gly Gly Arg Gly Leu 130 135 140 Gly
Lys Thr Tyr Leu Met His Ala Val Gly Pro Leu Arg Ala Lys Arg 145 150
155 160 Phe Pro His Met Arg Leu Glu Tyr Val Ser Thr Glu Thr Phe Thr
Asn 165 170 175 Glu Leu Ile Asn Arg Pro Ser Ala Arg Asp Arg Met Thr
Glu Phe Arg 180 185 190 Glu Arg Tyr Arg Ser Val Asp Leu Leu Leu Val
Asp Asp Val Gln Phe 195 200 205 Ile Ala Gly Lys Glu Arg Thr Gln Glu
Glu Phe Phe His Thr Phe Asn 210 215 220 Ala Leu Tyr Glu Ala His Lys
Gln Ile Ile Leu Ser Ser Asp Arg Pro 225 230 235 240 Pro Lys Asp Ile
Leu Thr Leu Glu Ala Arg Leu Arg Ser Arg Phe Glu 245 250 255 Trp Gly
Leu Ile Thr Asp Asn Pro Ala Pro Asp Leu Glu Thr Arg Ile 260 265 270
Ala Ile Leu Lys Met Asn Ala Ser Ser Gly Pro Glu Asp Pro Glu Asp 275
280 285 Ala Leu Glu Tyr Ile Ala Arg Gln Val Thr Ser Asn Ile Arg Glu
Trp 290 295 300 Glu Gly Ala Leu Met Arg Ala Ser Pro Phe Ala Ser Leu
Asn Gly Val 305 310 315 320 Glu Leu Thr Arg Ala Val Ala Ala Lys Ala
Leu Arg His Leu Arg Pro 325 330 335 Arg Glu Leu Glu Ala Asp Pro Leu
Glu Ile Ile Arg Lys Ala Ala Gly 340 345 350 Pro Val Arg Pro Glu Thr
Pro Gly Gly Ala His Gly Glu Arg Arg Lys 355 360 365 Lys Glu Val Val
Leu Pro Arg Gln Leu Ala Met Tyr Leu Val Arg Glu 370 375 380 Leu Thr
Pro Ala Ser Leu Pro Glu Ile Asp Gln Leu Asn Asp Asp Arg 385 390 395
400 Asp His Thr Thr Val Leu Tyr Ala Ile Gln Lys Val Gln Glu Leu Ala
405 410 415 Glu Ser Asp Arg Glu Val Gln Gly Leu Leu Arg Thr Leu Arg
Glu Ala 420 425 430 Cys Thr 106 1128 DNA Thermus thermophilus 106
atgaacataa cggttcccaa aaaactcctc tcggaccagc tttccctcct ggagcgcatc
60 gtcccctcta gaagcgccaa ccccctctac acctacctgg ggctttacgc
cgaggaaggg 120 gccttgatcc tcttcgggac caacggggag gtggacctcg
aggtccgcct ccccgccgag 180 gcccaaagcc ttccccgggt gctcgtcccc
gcccagccct tcttccagct ggtgcggagc 240 cttcctgggg acctcgtggc
cctcggcctc gcctcggagc cgggccaggg ggggcagctg 300 gagctctcct
ccgggcgttt ccgcacccgg ctcagcctgg cccctgccga gggctacccc 360
gagcttctgg tgcccgaggg ggaggacaag ggggccttcc ccctccggac gcggatgccc
420 tccggggagc tcgtcaaggc cttgacccac gtgcgctacg ccgcgagcaa
cgaggagtac 480 cgggccatct tccgcggggt gcagctggag ttctcccccc
agggcttccg ggcggtggcc 540 tccgacgggt accgcctcgc cctctacgac
ctgcccctgc cccaagggtt ccaggccaag 600 gccgtggtcc ccgcccggag
cgtggacgag atggtgcggg tcctgaaggg ggcggacggg 660 gccgaggccg
tcctcgccct gggcgagggg gtgttggccc tggccctcga gggcggaagc 720
ggggtccgga tggccctccg cctcatggaa ggggagttcc ccgactacca gagggtcatc
780 ccccaggagt tcgccctcaa ggtccaggtg gagggggagg ccctcaggga
ggcggtgcgc 840 cgggtgagcg tcctctccga ccggcagaac caccgggtgg
acctcctttt ggaggaaggc 900 cggatcctcc tctccgccga gggggactac
ggcaaggggc aggaggaggt gcccgcccag 960 gtggaggggc cggacatggc
cgtggcctac aacgcccgct acctcctcga ggccctcgcc 1020 cccgtggggg
accgggccca cctgggcatc tccgggccca cgagcccgag cctcatctgg 1080
ggggacgggg aggggtaccg ggcggtggtg gtgcccctca gggtctag 1128 107 376
PRT Thermus thermophilus 107 Met Asn Ile Thr Val Pro Lys Lys Leu
Leu Ser Asp Gln Leu Ser Leu 1 5 10 15 Leu Glu Arg Ile Val Pro Ser
Arg Ser Ala Asn Pro Leu Tyr Thr Tyr 20 25 30 Leu Gly Leu Tyr Ala
Glu Glu Gly Ala Leu Ile Leu Phe Gly Thr Asn 35 40 45 Gly Glu Val
Asp Leu Glu Val Arg Leu Pro Ala Glu Ala Gln Ser Leu 50 55 60 Pro
Arg Val Leu Val Pro Ala Gln Pro Phe Phe Gln Leu Val Arg Ser 65 70
75 80 Leu Pro Gly Asp Leu Val Ala Leu Gly Leu Ala Ser Glu Pro Gly
Gln 85 90 95 Gly Gly Gln Leu Glu Leu Ser Ser Gly Arg Phe Arg Thr
Arg Leu Ser 100 105 110 Leu Ala Pro Ala Glu Gly Tyr Pro Glu Leu Leu
Val Pro Glu Gly Glu 115 120 125 Asp Lys Gly Ala Phe Pro Leu Arg Thr
Arg Met Pro Ser Gly Glu Leu 130 135 140 Val Lys Ala Leu Thr His Val
Arg Tyr Ala Ala Ser Asn Glu Glu Tyr 145 150 155 160 Arg Ala Ile Phe
Arg Gly Val Gln Leu Glu Phe Ser Pro Gln Gly Phe 165 170 175 Arg Ala
Val Ala Ser Asp Gly Tyr Arg Leu Ala Leu Tyr Asp Leu Pro 180 185 190
Leu Pro Gln Gly Phe Gln Ala Lys Ala Val Val Pro Ala Arg Ser Val 195
200 205 Asp Glu Met Val Arg Val Leu Lys Gly Ala Asp Gly Ala Glu Ala
Val 210 215 220 Leu Ala Leu Gly Glu Gly Val Leu Ala Leu Ala Leu Glu
Gly Gly Ser 225 230 235 240 Gly Val Arg Met Ala Leu Arg Leu Met Glu
Gly Glu Phe Pro Asp Tyr 245 250 255 Gln Arg Val Ile Pro Gln Glu Phe
Ala Leu Lys Val Gln Val Glu Gly 260 265 270 Glu Ala Leu Arg Glu Ala
Val Arg Arg Val Ser Val Leu Ser Asp Arg 275 280 285 Gln Asn His Arg
Val Asp Leu Leu Leu Glu Glu Gly Arg Ile Leu Leu 290 295 300 Ser Ala
Glu Gly Asp Tyr Gly Lys Gly Gln Glu Glu Val Pro Ala Gln 305 310 315
320 Val Glu Gly Pro Asp Met Ala Val Ala Tyr Asn Ala Arg Tyr Leu Leu
325 330 335 Glu Ala Leu Ala Pro Val Gly Asp Arg Ala His Leu Gly Ile
Ser Gly 340 345 350 Pro Thr Ser Pro Ser Leu Ile Trp Gly Asp Gly Glu
Gly Tyr Arg Ala 355 360 365 Val Val Val Pro Leu Arg Val Glx 370 375
108 376 PRT Thermus thermophilus 108 Met Asn Ile Thr Val Pro Lys
Lys Leu Leu Ser Asp Gln Leu Ser Leu 1 5 10 15 Leu Glu Arg Ile Val
Pro Ser Arg Ser Ala Asn Pro Leu Tyr Thr Tyr 20 25 30 Leu Gly Leu
Tyr Ala Glu Glu Gly Ala Leu Ile Leu Phe Gly Thr Asn 35 40 45 Gly
Glu Val Asp Leu Glu Val Arg Leu Pro Ala Glu Ala Gln Ser Leu 50 55
60 Pro Arg Val Leu Val Pro Ala Gln Pro Phe Phe Gln Leu Val Arg Ser
65 70 75 80 Leu Pro Gly Asp Leu Val Ala Leu Gly Leu Ala Ser Glu Pro
Gly Gln 85 90 95 Gly Gly Gln Leu Glu Leu Ser Ser Gly Arg Phe Arg
Thr Arg Leu Ser 100 105 110 Leu Ala Pro Ala Glu Gly Tyr Pro Glu Leu
Leu Val Pro Glu Gly Glu 115 120 125 Asp Lys Gly Ala Phe Pro Leu Arg
Thr Arg Met Pro Ser Gly Glu Leu 130 135 140 Val Lys Ala Leu Thr His
Val Arg Tyr Ala Ala Ser Asn Glu Glu Tyr 145 150 155 160 Arg Ala Ile
Phe Arg Gly Val Gln Leu Glu Phe Ser Pro Gln Gly Phe 165 170 175 Arg
Ala Val Ala Ser Asp Gly Tyr Arg Leu Ala Leu Tyr Asp Leu Pro 180 185
190 Leu Pro Gln Gly Phe Gln Ala Lys Ala Val Val Pro Ala Arg Ser Val
195 200 205 Asp Glu Met Val Arg Val Leu Lys Gly Ala Asp Gly Ala Glu
Ala Val 210 215 220 Leu Ala Leu Gly Glu Gly Val Leu Ala Leu Ala Leu
Glu Gly Gly Ser 225 230 235 240 Gly Val Arg Met Ala Leu Arg Leu Met
Glu Gly Glu Phe Pro Asp Tyr 245 250 255 Gln Arg Val Ile Pro Gln Glu
Phe Ala Leu Lys Val Gln Val Glu Gly 260 265 270 Glu Ala Leu Arg Glu
Ala Val Arg Arg Val Ser Val Leu Ser Asp Arg 275 280 285 Gln Asn His
Arg Val Asp Leu Leu Leu Glu Glu Gly Arg Ile Leu Leu 290 295 300 Ser
Ala Glu Gly Asp Tyr Gly Lys Gly Gln Glu Glu Val Pro Ala Gln 305 310
315 320 Val Glu Gly Pro Asp Met Ala Val Ala Tyr Asn Ala Arg Tyr Leu
Leu 325 330 335 Glu Ala Leu Ala Pro Val Gly Asp Arg Ala His Leu Gly
Ile Ser Gly 340 345 350 Pro Thr Ser Pro Ser Leu Ile Trp Gly Asp Gly
Glu Gly Tyr Arg Ala 355 360 365 Val Val Val Pro Leu Arg Val Glx 370
375 109 367 PRT Escherichia coli 109 Met Lys Phe Thr Val Glu Arg
Glu His Leu Leu Lys Pro Leu Gln Gln 1 5 10 15 Val Ser Gly Pro Leu
Gly Gly Arg Pro Thr Leu Pro Ile Leu Gly Asn 20 25 30 Leu Leu Leu
Gln
Val Ala Asp Gly Thr Leu Ser Leu Thr Gly Thr Asp 35 40 45 Leu Glu
Met Glu Met Val Ala Arg Val Ala Leu Val Gln Pro His Glu 50 55 60
Pro Gly Ala Thr Thr Val Pro Ala Arg Lys Phe Phe Asp Ile Cys Arg 65
70 75 80 Gly Leu Pro Glu Gly Ala Glu Ile Ala Val Gln Leu Glu Gly
Glu Arg 85 90 95 Met Leu Val Arg Ser Gly Arg Ser Arg Phe Ser Leu
Ser Thr Leu Pro 100 105 110 Ala Ala Asp Phe Pro Asn Leu Asp Asp Trp
Gln Ser Glu Val Glu Phe 115 120 125 Thr Leu Pro Gln Ala Thr Met Lys
Arg Leu Ile Glu Ala Thr Gln Phe 130 135 140 Ser Met Ala His Gln Asp
Val Arg Tyr Tyr Leu Asn Gly Met Leu Phe 145 150 155 160 Glu Thr Glu
Gly Glu Glu Leu Arg Thr Val Ala Thr Asp Gly His Arg 165 170 175 Leu
Ala Val Cys Ser Met Pro Ile Gly Gln Ser Leu Pro Ser His Ser 180 185
190 Val Ile Val Pro Arg Lys Gly Val Ile Glu Leu Met Arg Met Leu Asp
195 200 205 Gly Gly Asp Asn Pro Leu Arg Val Gln Ile Gly Ser Asn Asn
Ile Arg 210 215 220 Ala His Val Gly Asp Phe Ile Phe Thr Ser Lys Leu
Val Asp Gly Arg 225 230 235 240 Phe Pro Asp Tyr Arg Arg Val Leu Pro
Lys Asn Pro Asp Lys His Leu 245 250 255 Glu Ala Gly Cys Asp Leu Leu
Lys Gln Ala Phe Ala Arg Ala Ala Ile 260 265 270 Leu Ser Asn Glu Lys
Phe Arg Gly Val Arg Leu Tyr Val Ser Glu Asn 275 280 285 Gln Leu Lys
Ile Thr Ala Asn Asn Pro Glu Gln Glu Glu Ala Glu Glu 290 295 300 Ile
Leu Asp Val Thr Tyr Ser Gly Ala Glu Met Glu Ile Gly Phe Asn 305 310
315 320 Val Ser Tyr Val Leu Asp Val Leu Asn Ala Leu Lys Cys Glu Asn
Val 325 330 335 Arg Met Met Leu Thr Asp Ser Val Ser Ser Val Gln Ile
Glu Asp Ala 340 345 350 Ala Ser Gln Ser Ala Ala Tyr Val Val Met Pro
Met Arg Leu Glx 355 360 365 110 367 PRT Proteus mirabilis 110 Met
Lys Phe Ile Ile Glu Arg Glu Gln Leu Leu Lys Pro Leu Gln Gln 1 5 10
15 Val Ser Gly Pro Leu Gly Gly Arg Pro Thr Leu Pro Ile Leu Gly Asn
20 25 30 Leu Leu Leu Lys Val Thr Glu Asn Thr Leu Ser Leu Thr Gly
Thr Asp 35 40 45 Leu Glu Met Glu Met Met Ala Arg Val Ser Leu Ser
Gln Ser His Glu 50 55 60 Ile Gly Ala Thr Thr Val Pro Ala Arg Lys
Phe Phe Asp Ile Trp Arg 65 70 75 80 Gly Leu Pro Glu Gly Ala Glu Ile
Ser Val Glu Leu Asp Gly Asp Arg 85 90 95 Leu Leu Val Arg Ser Gly
Arg Ser Arg Phe Ser Leu Ser Thr Leu Pro 100 105 110 Ala Ser Asp Phe
Pro Asn Leu Asp Asp Trp Gln Ser Glu Val Glu Phe 115 120 125 Thr Leu
Pro Gln Ala Thr Leu Lys Arg Leu Ile Glu Ser Thr Gln Phe 130 135 140
Ser Met Ala His Gln Asp Val Arg Tyr Tyr Leu Asn Gly Met Leu Phe 145
150 155 160 Glu Thr Glu Asn Thr Glu Leu Arg Thr Val Ala Thr Asp Gly
His Arg 165 170 175 Leu Ala Val Cys Ala Met Asp Ile Gly Gln Ser Leu
Pro Gly His Ser 180 185 190 Val Ile Val Pro Arg Lys Gly Val Ile Glu
Leu Met Arg Leu Leu Asp 195 200 205 Gly Ser Gly Glu Ser Leu Leu Gln
Leu Gln Ile Gly Ser Asn Asn Leu 210 215 220 Arg Ala His Val Gly Asp
Phe Ile Phe Thr Ser Lys Leu Val Asp Gly 225 230 235 240 Arg Phe Pro
Asp Tyr Arg Arg Val Leu Pro Lys Asn Pro Thr Lys Thr 245 250 255 Val
Ile Ala Gly Cys Asp Ile Leu Lys Gln Ala Phe Ser Arg Ala Ala 260 265
270 Ile Leu Ser Asn Glu Lys Phe Arg Gly Val Arg Ile Asn Leu Thr Asn
275 280 285 Gly Gln Leu Lys Ile Thr Ala Asn Asn Pro Glu Gln Glu Glu
Ala Glu 290 295 300 Glu Ile Val Asp Val Gln Tyr Gln Gly Glu Glu Met
Glu Ile Gly Phe 305 310 315 320 Asn Val Ser Tyr Leu Leu Asp Val Leu
Asn Thr Leu Lys Cys Glu Glu 325 330 335 Val Lys Leu Leu Leu Thr Asp
Ala Val Ser Ser Val Gln Val Glu Asn 340 345 350 Val Ala Ser Ala Ala
Ala Ala Tyr Val Val Met Pro Met Arg Leu 355 360 365 111 366 PRT
Haemophilus influenzae 111 Met Gln Phe Ser Ile Ser Arg Glu Asn Leu
Leu Lys Pro Leu Gln Gln 1 5 10 15 Val Cys Gly Val Leu Ser Asn Arg
Pro Asn Ile Pro Val Leu Asn Asn 20 25 30 Val Leu Leu Gln Ile Glu
Asp Tyr Arg Leu Thr Ile Thr Gly Thr Asp 35 40 45 Leu Glu Val Glu
Leu Ser Ser Gln Thr Gln Leu Ser Ser Ser Ser Glu 50 55 60 Asn Gly
Thr Phe Thr Ile Pro Ala Lys Lys Phe Leu Asp Ile Cys Arg 65 70 75 80
Thr Leu Ser Asp Asp Ser Glu Ile Thr Val Thr Phe Glu Gln Asp Arg 85
90 95 Ala Leu Val Gln Ser Gly Arg Ser Arg Phe Thr Leu Ala Thr Gln
Pro 100 105 110 Ala Glu Glu Tyr Pro Asn Leu Thr Asp Trp Gln Ser Glu
Val Asp Phe 115 120 125 Glu Leu Pro Gln Asn Thr Leu Arg Arg Leu Ile
Glu Ala Thr Gln Phe 130 135 140 Ser Met Ala Asn Gln Asp Ala Arg Tyr
Phe Leu Asn Gly Met Lys Phe 145 150 155 160 Glu Thr Glu Gly Asn Leu
Leu Arg Thr Val Ala Thr Asp Gly His Arg 165 170 175 Leu Ala Val Cys
Thr Ile Ser Leu Glu Gln Glu Leu Gln Asn His Ser 180 185 190 Val Ile
Leu Pro Arg Lys Gly Val Leu Glu Leu Val Arg Leu Leu Glu 195 200 205
Thr Asn Asp Glu Pro Ala Arg Leu Gln Ile Gly Thr Asn Asn Leu Arg 210
215 220 Val His Leu Lys Asn Thr Val Phe Thr Ser Lys Leu Ile Asp Gly
Arg 225 230 235 240 Phe Pro Asp Tyr Arg Arg Val Leu Pro Arg Asn Ala
Thr Lys Ile Val 245 250 255 Glu Gly Asn Trp Glu Met Leu Lys Gln Ala
Phe Ala Arg Ala Ser Ile 260 265 270 Leu Ser Asn Glu Arg Ala Arg Ser
Val Arg Leu Ser Leu Lys Glu Asn 275 280 285 Gln Leu Lys Ile Thr Ala
Ser Asn Thr Glu His Glu Glu Ala Glu Glu 290 295 300 Ile Val Asp Val
Asn Tyr Asn Gly Glu Glu Leu Glu Val Gly Phe Asn 305 310 315 320 Val
Thr Tyr Ile Leu Asp Val Leu Asn Ala Leu Lys Cys Asn Gln Val 325 330
335 Arg Met Cys Leu Thr Asp Ala Phe Ser Ser Cys Leu Ile Glu Asn Cys
340 345 350 Glu Asp Ser Ser Cys Glu Tyr Val Ile Met Pro Met Arg Leu
355 360 365 112 367 PRT Pseudomonas putida 112 Met His Phe Thr Ile
Gln Arg Glu Ala Leu Leu Lys Pro Leu Gln Leu 1 5 10 15 Val Ala Gly
Val Val Glu Arg Arg Gln Thr Leu Pro Val Leu Ser Asn 20 25 30 Val
Leu Leu Val Val Gln Gly Gln Gln Leu Ser Leu Thr Gly Thr Asp 35 40
45 Leu Glu Val Glu Leu Val Gly Arg Val Gln Leu Glu Glu Pro Ala Glu
50 55 60 Pro Gly Glu Ile Thr Val Pro Ala Arg Lys Leu Met Asp Ile
Cys Lys 65 70 75 80 Ser Leu Pro Asn Asp Ala Leu Ile Asp Ile Lys Val
Asp Glu Gln Lys 85 90 95 Leu Leu Val Lys Ala Gly Arg Ser Arg Phe
Thr Leu Ser Thr Leu Pro 100 105 110 Ala Asn Asp Phe Pro Thr Val Glu
Glu Gly Pro Gly Ser Leu Thr Cys 115 120 125 Asn Leu Glu Gln Ser Lys
Leu Arg Arg Leu Ile Glu Arg Thr Ser Phe 130 135 140 Ala Met Ala Gln
Gln Asp Val Arg Tyr Tyr Leu Asn Gly Met Leu Leu 145 150 155 160 Glu
Val Ser Arg Asn Thr Leu Arg Ala Val Ser Thr Asp Gly His Arg 165 170
175 Leu Ala Leu Cys Ser Met Ser Ala Pro Ile Glu Gln Glu Asp Arg His
180 185 190 Gln Val Ile Val Pro Arg Lys Gly Ile Leu Glu Leu Ala Arg
Leu Leu 195 200 205 Thr Asp Pro Glu Gly Met Val Ser Ile Val Leu Gly
Gln His His Ile 210 215 220 Arg Ala Thr Thr Gly Glu Phe Thr Phe Thr
Ser Lys Leu Val Asp Gly 225 230 235 240 Lys Phe Pro Asp Tyr Glu Arg
Val Leu Pro Lys Gly Gly Asp Lys Leu 245 250 255 Val Val Gly Asp Arg
Gln Ala Leu Arg Glu Ala Phe Ser Arg Thr Ala 260 265 270 Ile Leu Ser
Asn Glu Lys Tyr Arg Gly Ile Arg Leu Gln Leu Ala Ala 275 280 285 Gly
Gln Leu Lys Ile Gln Ala Asn Asn Pro Glu Gln Glu Glu Ala Glu 290 295
300 Glu Glu Ile Ser Val Asp Tyr Glu Gly Ser Ser Leu Glu Ile Gly Phe
305 310 315 320 Asn Val Ser Tyr Leu Leu Asp Val Leu Gly Val Met Thr
Thr Glu Gln 325 330 335 Val Arg Leu Ile Leu Ser Asp Ser Asn Ser Ser
Ala Leu Leu Gln Glu 340 345 350 Ala Gly Asn Asp Asp Ser Ser Tyr Val
Val Met Pro Met Arg Leu 355 360 365 113 366 PRT Buchnera aphidicola
113 Met Lys Phe Thr Ile Gln Asn Asp Ile Leu Thr Lys Asn Leu Lys Lys
1 5 10 15 Ile Thr Arg Val Leu Val Lys Asn Ile Ser Phe Pro Ile Leu
Glu Asn 20 25 30 Ile Leu Ile Gln Val Glu Asp Gly Thr Leu Ser Leu
Thr Thr Thr Asn 35 40 45 Leu Glu Ile Glu Leu Ile Ser Lys Ile Glu
Ile Ile Thr Lys Tyr Ile 50 55 60 Pro Gly Lys Thr Thr Ile Ser Gly
Arg Lys Ile Leu Asn Ile Cys Arg 65 70 75 80 Thr Leu Ser Glu Lys Ser
Lys Ile Lys Met Gln Leu Lys Asn Lys Lys 85 90 95 Met Tyr Ile Ser
Ser Glu Asn Ser Asn Tyr Ile Leu Ser Thr Leu Ser 100 105 110 Ala Asp
Thr Phe Pro Asn His Gln Asn Phe Asp Tyr Ile Ser Lys Phe 115 120 125
Asp Ile Ser Ser Asn Ile Leu Lys Glu Met Ile Glu Lys Thr Glu Phe 130
135 140 Ser Met Gly Lys Gln Asp Val Arg Tyr Tyr Leu Asn Gly Met Leu
Leu 145 150 155 160 Glu Lys Lys Asp Lys Phe Leu Arg Ser Val Ala Thr
Asp Gly Tyr Arg 165 170 175 Leu Ala Ile Ser Tyr Thr Gln Leu Lys Lys
Asp Ile Asn Phe Phe Ser 180 185 190 Ile Ile Ile Pro Asn Lys Ala Val
Met Glu Leu Leu Lys Leu Leu Asn 195 200 205 Thr Gln Pro Gln Leu Leu
Asn Ile Leu Ile Gly Ser Asn Ser Ile Arg 210 215 220 Ile Tyr Thr Lys
Asn Leu Ile Phe Thr Thr Gln Leu Ile Glu Gly Glu 225 230 235 240 Tyr
Pro Asp Tyr Lys Ser Val Leu Phe Lys Glu Lys Lys Asn Pro Ile 245 250
255 Ile Thr Asn Ser Ile Leu Leu Lys Lys Ser Leu Leu Arg Val Ala Ile
260 265 270 Leu Ala His Glu Lys Phe Cys Gly Ile Glu Ile Lys Ile Glu
Asn Gly 275 280 285 Lys Phe Lys Val Leu Ser Asp Asn Gln Glu Glu Glu
Thr Ala Glu Asp 290 295 300 Leu Phe Glu Ile Asp Tyr Phe Gly Glu Lys
Ile Glu Ile Ser Ile Asn 305 310 315 320 Val Tyr Tyr Leu Leu Asp Val
Ile Asn Asn Ile Lys Ser Glu Asn Ile 325 330 335 Ala Leu Phe Leu Asn
Lys Ser Lys Ser Ser Ile Gln Ile Glu Ala Glu 340 345 350 Asn Asn Ser
Ser Asn Ala Tyr Val Val Met Leu Leu Lys Arg 355 360 365 114 39 DNA
Artificial Sequence Description of Artificial Sequence primer 114
gtgtggatcc tcgtccccct catgcgcgac caggaaggg 39 115 27 DNA Artificial
Sequence Description of Artificial Sequence primer 115 gtgtggatcc
gtggtgacct tagccac 27 116 30 DNA Artificial Sequence Description of
Artificial Sequence primer 116 ttcgtgtccg aggaccttgt ggtccacaac 30
117 3514 DNA Aquifex aeolicus 117 atgagtaagg atttcgtcca ccttcacctg
cacacccagt tctcactcct ggacggggct 60 ataaagatag acgagctcgt
gaaaaaggca aaggagtatg gatacaaagc tgtcggaatg 120 tcagaccacg
gaaacctctt cggttcgtat aaattctaca aagccctgaa ggcggaagga 180
attaagccca taatcggcat ggaagcctac tttaccacgg gttcgaggtt tgacagaaag
240 actaaaacga gcgaggacaa cataaccgac aagtacaacc accacctcat
acttatagca 300 aaggacgaaa aggtctaaag aacttaatga agctctcaac
cctcgcctac aaagaaggtt 360 tttactacaa acccagaatt gattacgaac
tccttgaaaa gtacggggag ggcctaatag 420 cccttaccgc atgcctgaaa
ggtgttccca cctactacgc ttctataaac gaagtgaaaa 480 aggcggagga
atgggtaaag aagttcaagg atatattcgg agatgacctt tatttagaac 540
ttcaagcgaa caacattcca gaacaggaag tggcaaacag gaacttaata gagatagcca
600 aaaagtacga tgtgaaactc atagcgacgc aggacgccca ctacctcaat
cccgaagaca 660 ggtacgccca cacggttctt atggcacttc aaatgaaaaa
gaccattcac gaactgagtt 720 cgggaaactt caagtgttca aacgaagacc
ttcactttgc tccacccgag tacatgtgga 780 aaaagtttga aggtaagttc
gaaggctggg aaaaggcact cctgaacact ctcgaggtaa 840 tggaaaagac
agcggacagc tttgagatat ttgaaaactc cacctacctc cttcccaagt 900
acgacgttcc gcccgacaaa acccttgagg aatacctcag agaactcgcg tacaaaggtt
960 taagacagag gatagaaagg ggacaagcta aggatactaa agagtactgg
gagaggctcg 1020 agtacgaact ggaagttata aacaaaatgg gctttgcggg
atacttcttg atagttcagg 1080 acttcataaa ctgggctaag aaaaacgaca
tacctgttgg acccggaagg ggaagtgctg 1140 gaggttccct cgtcgcatac
gccatcggaa taacggacgt tgaccctata aagcacggat 1200 tcctttttga
gaggttctta aaccccgaaa gggtttccat gccggatata gacgtggatt 1260
tctgtcagga caacagggaa aaggtcatag agtacgtaag gaacaagtac ggacacgaca
1320 acgtagctca gataatcacc tacaacgtaa tgaaggcgaa gcaaacactg
agagacgtcg 1380 caagggccat gggactcccc tactccaccg cggacaaact
cgcaaaactc attcctcagg 1440 gggacgttca gggaacgtgg ctcagtctgg
aagagatgta caaaacgcct gtggaggaac 1500 tccttcagaa gtacggagaa
cacagaacgg acatagagga caacgtaaag aagttcagac 1560 agatatgcga
agaaagtccg gagataaaac agctcgttga gacggccctg aagcttgaag 1620
gtctcacgag acacacctcc ctccacgccg cgggagtggt tatagcacca aagcccttga
1680 gcgagctcgt tcccctctac tacgataaag agggcgaagt cgcaacccag
tacgacatgg 1740 ttcagctcga agaactcggt ctcctgaaga tggacttcct
cggactcaaa accctcacag 1800 aactgaaact catgaaagaa ctcataaagg
aaagacacgg agtggatata aacttccttg 1860 aacttcccct tgacgacccg
aaagtttaca aactccttca ggaaggaaaa accacgggag 1920 tgttccagct
cgaaagcagg ggaatgaaag aactcctgaa gaaactaaag cccgacagct 1980
ttgacgacat cgttgcggtc ctcgcactct acagacccgg acctctaaag agcggactcg
2040 ttgacacata cattaagaga aagcacggaa aagaacccgt tgagtacccc
ttcccggagc 2100 ttgaacccgt ccttaaggaa acctacggag taatcgttta
tcaggaacag gtgatgaaga 2160 tgtctcagat actttccggc tttactcccg
gagaggcgga taccctcaga aaggcgatag 2220 gtaagaagaa agcggattta
atggctcaga tgaaagacaa gttcatacag ggagcggtgg 2280 aaaggggata
ccctgaagaa aagataagga agctctggga agacatagag aagttcgctt 2340
cctactcctt caacaagtct cactcggtag cttacgggta catctcctac tggaccgcct
2400 acgttaaagc ccactatccc gcggagttct tcgcggtaaa actcacaact
gaaaagaacg 2460 acaacaagtt cctcaacctc ataaaagacg ctaaactctt
cggatttgag atacttcccc 2520 ccgacataaa caagagtgat gtaggattta
cgatagaagg tgaaaacagg ataaggttcg 2580 ggcttgcgag gataaaggga
gtgggagagg aaactgctaa gataatcgtt gaagctagaa 2640 agaagtataa
gcagttcaaa gggcttgcgg acttcataaa caaaaccaag aacaggaaga 2700
taaacaagaa agtcgtggaa gcactcgtaa aggcaggggc ttttgacttt actaagaaaa
2760 agaggaaaga actactcgct aaagtggcaa actctgaaaa agcattaatg
gctacacaaa 2820 actccctttt cggtgcaccg aaagaagaag tggaagaact
cgacccctta aagcttgaaa 2880 aggaagttct cggtttttac atttcagggc
acccccttga caactacgaa aagctcctca 2940 agaaccgcta cacacccatt
gaagatttag aagagtggga caaggaaagc gaagcggtgc 3000 ttacaggagt
tatcacggaa ctcaaagtaa aaaagacgaa aaacggagat tacatggcgg 3060
tcttcaacct cgttgacaag acgggactaa tagagtgtgt cgtcttcccg ggagtttacg
3120 aagaggcaaa ggaactgata gaagaggaca gagtagtggt agtcaaaggt
tttctggacg 3180 aggaccttga aacggaaaat gtcaagttcg tggtgaaaga
ggttttctcc cctgaggagt 3240 tcgcaaagga gatgaggaat accctttata
tattcttaaa aagagagcaa gccctaaacg 3300 gcgttgccga aaaactaaag
ggaattattg aaaacaacag gacggaggac ggatacaact 3360 tggttctcac
ggttgatctg ggagactact tcgttgattt agcactccca caagatatga 3420
aactaaaggc tgacagaaag gttgtagagg
agatagaaaa actgggagtg aaggtcataa 3480 tttagtaaat aacccttact
tccgagtagt cccc 3514 118 1161 PRT Aquifex aeolicus 118 Met Ser Lys
Asp Phe Val His Leu His Leu His Thr Gln Phe Ser Leu 1 5 10 15 Leu
Asp Gly Ala Ile Lys Ile Asp Glu Leu Val Lys Lys Ala Lys Glu 20 25
30 Tyr Gly Tyr Lys Ala Val Gly Met Ser Asp His Gly Asn Leu Phe Gly
35 40 45 Ser Tyr Lys Phe Tyr Lys Ala Leu Lys Ala Glu Gly Ile Lys
Pro Ile 50 55 60 Ile Gly Met Glu Ala Tyr Phe Thr Thr Gly Ser Arg
Phe Asp Arg Lys 65 70 75 80 Thr Lys Thr Ser Glu Asp Asn Ile Thr Asp
Lys Tyr Asn His His Leu 85 90 95 Ile Leu Ile Ala Lys Asp Asp Lys
Gly Leu Lys Asn Leu Met Lys Leu 100 105 110 Ser Thr Leu Ala Tyr Lys
Glu Gly Phe Tyr Tyr Lys Pro Arg Ile Asp 115 120 125 Tyr Glu Leu Leu
Glu Lys Tyr Gly Glu Gly Leu Ile Ala Leu Thr Ala 130 135 140 Cys Leu
Lys Gly Val Pro Thr Tyr Tyr Ala Ser Ile Asn Glu Val Lys 145 150 155
160 Lys Ala Glu Glu Trp Val Lys Lys Phe Lys Asp Ile Phe Gly Asp Asp
165 170 175 Leu Tyr Leu Glu Leu Gln Ala Asn Asn Ile Pro Glu Gln Glu
Val Ala 180 185 190 Asn Arg Asn Leu Ile Glu Ile Ala Lys Lys Tyr Asp
Val Lys Leu Ile 195 200 205 Ala Thr Gln Asp Ala His Tyr Leu Asn Pro
Glu Asp Arg Tyr Ala His 210 215 220 Thr Val Leu Met Ala Leu Gln Met
Lys Lys Thr Ile His Glu Leu Ser 225 230 235 240 Ser Gly Asn Phe Lys
Cys Ser Asn Glu Asp Leu His Phe Ala Pro Pro 245 250 255 Glu Tyr Met
Trp Lys Lys Phe Glu Gly Lys Phe Glu Gly Trp Glu Lys 260 265 270 Ala
Leu Leu Asn Thr Leu Glu Val Met Glu Lys Thr Ala Asp Ser Phe 275 280
285 Glu Ile Phe Glu Asn Ser Thr Tyr Leu Leu Pro Lys Tyr Asp Val Pro
290 295 300 Pro Asp Lys Thr Leu Glu Glu Tyr Leu Arg Glu Leu Ala Tyr
Lys Gly 305 310 315 320 Leu Arg Gln Arg Ile Glu Arg Gly Gln Ala Lys
Asp Thr Lys Glu Tyr 325 330 335 Trp Glu Arg Leu Glu Tyr Glu Leu Glu
Val Ile Asn Lys Met Gly Phe 340 345 350 Ala Gly Tyr Phe Leu Ile Val
Gln Asp Phe Ile Asn Trp Ala Lys Lys 355 360 365 Asn Asp Ile Pro Val
Gly Pro Gly Arg Gly Ser Ala Gly Gly Ser Leu 370 375 380 Val Ala Tyr
Ala Ile Gly Ile Thr Asp Val Asp Pro Ile Lys His Gly 385 390 395 400
Phe Leu Phe Glu Arg Phe Leu Asn Pro Glu Arg Val Ser Met Pro Asp 405
410 415 Ile Asp Val Asp Phe Cys Gln Asp Asn Arg Glu Lys Val Ile Glu
Tyr 420 425 430 Val Arg Asn Lys Tyr Gly His Asp Asn Val Ala Gln Ile
Ile Thr Tyr 435 440 445 Asn Val Met Lys Ala Lys Gln Thr Leu Arg Asp
Val Ala Arg Ala Met 450 455 460 Gly Leu Pro Tyr Ser Thr Ala Asp Lys
Leu Ala Lys Leu Ile Pro Gln 465 470 475 480 Gly Asp Val Gln Gly Thr
Trp Leu Ser Leu Glu Glu Met Tyr Lys Thr 485 490 495 Pro Val Glu Glu
Leu Leu Gln Lys Tyr Gly Glu His Arg Thr Asp Ile 500 505 510 Glu Asp
Asn Val Lys Lys Phe Arg Gln Ile Cys Glu Glu Ser Pro Glu 515 520 525
Ile Lys Gln Leu Val Glu Thr Ala Leu Lys Leu Glu Gly Leu Thr Arg 530
535 540 His Thr Ser Leu His Ala Ala Gly Val Val Ile Ala Pro Lys Pro
Leu 545 550 555 560 Ser Glu Leu Val Pro Leu Tyr Tyr Asp Lys Glu Gly
Glu Val Ala Thr 565 570 575 Gln Tyr Asp Met Val Gln Leu Glu Glu Leu
Gly Leu Leu Lys Met Asp 580 585 590 Phe Leu Gly Leu Lys Thr Leu Thr
Glu Leu Lys Leu Met Lys Glu Leu 595 600 605 Ile Lys Glu Arg His Gly
Val Asp Ile Asn Phe Leu Glu Leu Pro Leu 610 615 620 Asp Asp Pro Lys
Val Tyr Lys Leu Leu Gln Glu Gly Lys Thr Thr Gly 625 630 635 640 Val
Phe Gln Leu Glu Ser Arg Gly Met Lys Glu Leu Leu Lys Lys Leu 645 650
655 Lys Pro Asp Ser Phe Asp Asp Ile Val Ala Val Leu Ala Leu Tyr Arg
660 665 670 Pro Gly Pro Leu Lys Ser Gly Leu Val Asp Thr Tyr Ile Lys
Arg Lys 675 680 685 His Gly Lys Glu Pro Val Glu Tyr Pro Phe Pro Glu
Leu Glu Pro Val 690 695 700 Leu Lys Glu Thr Tyr Gly Val Ile Val Tyr
Gln Glu Gln Val Met Lys 705 710 715 720 Met Ser Gln Ile Leu Ser Gly
Phe Thr Pro Gly Glu Ala Asp Thr Leu 725 730 735 Arg Lys Ala Ile Gly
Lys Lys Lys Ala Asp Leu Met Ala Gln Met Lys 740 745 750 Asp Lys Phe
Ile Gln Gly Ala Val Glu Arg Gly Tyr Pro Glu Glu Lys 755 760 765 Ile
Arg Lys Leu Trp Glu Asp Ile Glu Lys Phe Ala Ser Tyr Ser Phe 770 775
780 Asn Lys Ser His Ser Val Ala Tyr Gly Tyr Ile Ser Tyr Trp Thr Ala
785 790 795 800 Tyr Val Lys Ala His Tyr Pro Ala Glu Phe Phe Ala Val
Lys Leu Thr 805 810 815 Thr Glu Lys Asn Asp Asn Lys Phe Leu Asn Leu
Ile Lys Asp Ala Lys 820 825 830 Leu Phe Gly Phe Glu Ile Leu Pro Pro
Asp Ile Asn Lys Ser Asp Val 835 840 845 Gly Phe Thr Ile Glu Gly Glu
Asn Arg Ile Arg Phe Gly Leu Ala Arg 850 855 860 Ile Lys Gly Val Gly
Glu Glu Thr Ala Lys Ile Ile Val Glu Ala Arg 865 870 875 880 Lys Lys
Tyr Lys Gln Phe Lys Gly Leu Ala Asp Phe Ile Asn Lys Thr 885 890 895
Lys Asn Arg Lys Ile Asn Lys Lys Val Val Glu Ala Leu Val Lys Ala 900
905 910 Gly Ala Phe Asp Phe Thr Lys Lys Lys Arg Lys Glu Leu Leu Ala
Lys 915 920 925 Val Ala Asn Ser Glu Lys Ala Leu Met Ala Thr Gln Asn
Ser Leu Phe 930 935 940 Gly Ala Pro Lys Glu Glu Val Glu Glu Leu Asp
Pro Leu Lys Leu Glu 945 950 955 960 Lys Glu Val Leu Gly Phe Tyr Ile
Ser Gly His Pro Leu Asp Asn Tyr 965 970 975 Glu Lys Leu Leu Lys Asn
Arg Tyr Thr Pro Ile Glu Asp Leu Glu Glu 980 985 990 Trp Asp Lys Glu
Ser Glu Ala Val Leu Thr Gly Val Ile Thr Glu Leu 995 1000 1005 Lys
Val Lys Lys Thr Lys Asn Gly Asp Tyr Met Ala Val Phe Asn Leu 1010
1015 1020 Val Asp Lys Thr Gly Leu Ile Glu Cys Val Val Phe Pro Gly
Val Tyr 1025 1030 1035 1040 Glu Glu Ala Lys Glu Leu Ile Glu Glu Asp
Arg Val Val Val Val Lys 1045 1050 1055 Gly Phe Leu Asp Glu Asp Leu
Glu Thr Glu Asn Val Lys Phe Val Val 1060 1065 1070 Lys Glu Val Phe
Ser Pro Glu Glu Phe Ala Lys Glu Met Arg Asn Thr 1075 1080 1085 Leu
Tyr Ile Phe Leu Lys Arg Glu Gln Ala Leu Asn Gly Val Ala Glu 1090
1095 1100 Lys Leu Lys Gly Ile Ile Glu Asn Asn Arg Thr Glu Asp Gly
Tyr Asn 1105 1110 1115 1120 Leu Val Leu Thr Val Asp Leu Gly Asp Tyr
Phe Val Asp Leu Ala Leu 1125 1130 1135 Pro Gln Asp Met Lys Leu Lys
Ala Asp Arg Lys Val Val Glu Glu Ile 1140 1145 1150 Glu Lys Leu Gly
Val Lys Val Ile Ile 1155 1160 119 2408 DNA Aquifex aeolicus 119
atgaactacg ttcccttcgc gagaaagtac agaccgaaat tcttcaggga agtaatagga
60 caggaagctc ccgtaaggat actcaaaaac gctataaaaa acgacagagt
ggctcacgcc 120 tacctctttg ccggaccgag gggggttggg aagacgacta
ttgcaagaat tctcgcaaaa 180 gctttgaact gtaaaaatcc ctccaaaggt
gagccctgcg gtgagtgcga aaactgcagg 240 gagatagaca ggggtgtgtt
ccctgactta attgaaatgg atgccgcctc aaacaggggt 300 atagacgacg
taagggcatt aaaagaagcg gtcaattaca aacctataaa aggaaagtac 360
aaggtttaca taatagacga agctcacatg ctcacgaaag aagctttcaa cgctctctta
420 aaaaccctcg aagagccccc tcccagaact gttttcgtcc tttgtaccac
ggagtacgac 480 aaaattcttc ccacgatact ctcaaggtgt cagaggataa
tcttctcaaa ggtaagaaag 540 gaaaaagtaa tagagtatct aaaaaagata
tgtgaaaagg aagggattga gtgcgaagag 600 ggagcccttg aggttctggc
tcatgcctct gaagggtgca tgagggatgc agcctctctc 660 ctggaccagg
cgagcgttta cggggaaggc agggtaacaa aagaagtagt ggagaacttc 720
ctcggaattc tcagtcagga aagcgttagg agttttctga aattgcttct gaactcagaa
780 gtggacgaag ctataaagtt cctcagagaa ctctcagaaa agggctacaa
cctgaccaag 840 ttttgggaga tgttagaaga ggaagtgaga aacgcaattt
tagtaaagag cctgaaaaat 900 cccgaaagcg tggttcagaa ctggcaggat
tacgaagact tcaaagacta ccctctggaa 960 gccctcctct acgttgagaa
cctgataaac aggggtaaag ttgaagcgag aacgagagaa 1020 cccttaagag
cctttgaact cgcggtaata aagagcctta tagtcaaaga cataattccc 1080
gtatcccagc tcggaagtgt ggtaaaggaa accaaaaagg aagaaaagaa agttgaagta
1140 aaagaagagc caaaagtaaa agaagaaaaa ccaaaggagc aggaagagga
caggttccag 1200 aaagttttaa acgctgtgga cggcaaaatc cttaaaagaa
tacttgaagg ggcaaaaagg 1260 gaagaaagag acggaaaaat cgtcctaaag
atagaagcct cttatctgag aaccatgaaa 1320 aaggaatttg actcactaaa
ggagactttt ccttttttag agtttgaacc cgtggaggat 1380 aaaaaaaaac
ctcagaagtc cagcgggacg aggctgtttt aaaggtaaag gagctcttca 1440
atgcaaaaat actcaaagta cgaagtaaaa gctaaggtca taaaggtgag aatgcccgtg
1500 gaagagatag ggctgtttaa cgcactaata gacggcttgc ccaggtacgc
actcacgagg 1560 acgaaggaaa agggaaaggg agaagttttc gttttagcga
ctccttataa agtcaaggaa 1620 ttgatggaag ctatggaggg tatgaaaaaa
cacataaagg atttagaaat cctcggagag 1680 acggatgagg atttaacttt
ttaaagtatg ggtgtatctg agcaaaggtt taagctaaaa 1740 acaaacctga
aacccgcagg ggaccagccg aaagccataa aaaaactcct tgaaaaccta 1800
aggaaaggcg taaaagaaca aacacttctc ggagtcacgg gaagcggaaa gacttttact
1860 ctagcaaacg taatagcgaa gtacaacaaa ccaactcttg tggtagttca
caacaaaatt 1920 ctcgcggcac agctatacag ggagtttaaa gaactattcc
ctgaaaacgc tgtagagtac 1980 tttgtctctt actacgacta ttaccaacct
gaagcctaca ttcccgaaaa agatttatac 2040 atagaaaagg acgcgagtat
aaacgaaagc tggaacgttt cagacactcc gccacgatat 2100 ccgttctaga
aaggagggac gttatagtag ttgcttcagt ttcttgcata tacggactcg 2160
ggaaacctga gcactacgaa aacctgagga taaaactcca aaggggaata agactgaact
2220 tgagtaagct cctgaggaaa ctcgttgagc taggatatca gagaaatgac
tttgccataa 2280 agagggctac cttctcggtt aggggagacg tggttgagat
agtcccttct cacacggaag 2340 attacctcgt gagggtagag ttctgggacg
acgaagttga aagaatagtc ctcatggacg 2400 ctctgaac 2408 120 473 PRT
Aquifex aeolicus 120 Met Asn Tyr Val Pro Phe Ala Arg Lys Tyr Arg
Pro Lys Phe Phe Arg 1 5 10 15 Glu Val Ile Gly Gln Glu Ala Pro Val
Arg Ile Leu Lys Asn Ala Ile 20 25 30 Lys Asn Asp Arg Val Ala His
Ala Tyr Leu Phe Ala Gly Pro Arg Gly 35 40 45 Val Gly Lys Thr Thr
Ile Ala Arg Ile Leu Ala Lys Ala Leu Asn Cys 50 55 60 Lys Asn Pro
Ser Lys Gly Glu Pro Cys Gly Glu Cys Glu Asn Cys Arg 65 70 75 80 Glu
Ile Asp Arg Gly Val Phe Pro Asp Leu Ile Glu Met Asp Ala Ala 85 90
95 Ser Asn Arg Gly Ile Asp Asp Val Arg Ala Leu Lys Glu Ala Val Asn
100 105 110 Tyr Lys Pro Ile Lys Gly Lys Tyr Lys Val Tyr Ile Ile Asp
Glu Ala 115 120 125 His Met Leu Thr Lys Glu Ala Phe Asn Ala Leu Leu
Lys Thr Leu Glu 130 135 140 Glu Pro Pro Pro Arg Thr Val Phe Val Leu
Cys Thr Thr Glu Tyr Asp 145 150 155 160 Lys Ile Leu Pro Thr Ile Leu
Ser Arg Cys Gln Arg Ile Ile Phe Ser 165 170 175 Lys Val Arg Lys Glu
Lys Val Ile Glu Tyr Leu Lys Lys Ile Cys Glu 180 185 190 Lys Glu Gly
Ile Glu Cys Glu Glu Gly Ala Leu Glu Val Leu Ala His 195 200 205 Ala
Ser Glu Gly Cys Met Arg Asp Ala Ala Ser Leu Leu Asp Gln Ala 210 215
220 Ser Val Tyr Gly Glu Gly Arg Val Thr Lys Glu Val Val Glu Asn Phe
225 230 235 240 Leu Gly Ile Leu Ser Gln Glu Ser Val Arg Ser Phe Leu
Lys Leu Leu 245 250 255 Leu Asn Ser Glu Val Asp Glu Ala Ile Lys Phe
Leu Arg Glu Leu Ser 260 265 270 Glu Lys Gly Tyr Asn Leu Thr Lys Phe
Trp Glu Met Leu Glu Glu Glu 275 280 285 Val Arg Asn Ala Ile Leu Val
Lys Ser Leu Lys Asn Pro Glu Ser Val 290 295 300 Val Gln Asn Trp Gln
Asp Tyr Glu Asp Phe Lys Asp Tyr Pro Leu Glu 305 310 315 320 Ala Leu
Leu Tyr Val Glu Asn Leu Ile Asn Arg Gly Lys Val Glu Ala 325 330 335
Arg Thr Arg Glu Pro Leu Arg Ala Phe Glu Leu Ala Val Ile Lys Ser 340
345 350 Leu Ile Val Lys Asp Ile Ile Pro Val Ser Gln Leu Gly Ser Val
Val 355 360 365 Lys Glu Thr Lys Lys Glu Glu Lys Lys Val Glu Val Lys
Glu Glu Pro 370 375 380 Lys Val Lys Glu Glu Lys Pro Lys Glu Gln Glu
Glu Asp Arg Phe Gln 385 390 395 400 Lys Val Leu Asn Ala Val Asp Gly
Lys Ile Leu Lys Arg Ile Leu Glu 405 410 415 Gly Ala Lys Arg Glu Glu
Arg Asp Gly Lys Ile Val Leu Lys Ile Glu 420 425 430 Ala Ser Tyr Leu
Arg Thr Met Lys Lys Glu Phe Asp Ser Leu Lys Glu 435 440 445 Thr Phe
Pro Phe Leu Glu Phe Glu Pro Val Glu Asp Lys Lys Lys Pro 450 455 460
Gln Lys Ser Ser Gly Thr Arg Leu Phe 465 470 121 1090 DNA Aquifex
aeolicus 121 atgcgcgtta aggtggacag ggaggagctt gaagaggttc ttaaaaaagc
aagagaaagc 60 acggaaaaaa aagccgcact cccgatactc gcgaacttct
tactctccgc aaaagaggaa 120 aacttaatcg taagggcaac ggacttggaa
aactaccttg tagtctccgt aaagggggag 180 gttgaagagg aaggagaggt
ttgcgtccac tctcaaaaac tctacgatat agtcaagaac 240 ttaaattccg
cttacgttta ccttcatacg gaaggtgaaa aactcgtcat aacgggagga 300
aagagtacgt acaaacttcc gacagctccc gcggaggact ttcccgaatt tccagaaatc
360 gtagaaggag gagaaacact ttcgggaaac cttctcgtta acggaataga
aaaggtagag 420 tacgccatag cgaaggaaga agcgaacata gcccttcagg
gaatgtatct gagaggatac 480 gaggacagaa ttcactttgt gttcggacgg
tcacaggctt gcactttatg aacctctacg 540 taaacattga aaagagtgaa
gacgagtctt ttgcttactt ctccactccc gagtggaaac 600 tcgccgttag
ctcctggaag gagaattccc ggactacatg agtgtcatcc ctgaggagtt 660
ttcggcggaa gtcttgtttg agacagagga agtcttaaag gttttaaaga ggttgaaggc
720 tttaagcgaa ggaaaagttt ttcccgtgaa gattacctta agcgaaaacc
ttgccatctt 780 tgagttcgcg gatccggagt tcggagaagc gagagaggaa
attgaagtgg agtacacggg 840 agagcccttt gagataggat tcaacggaaa
taccttatgg aggcgcttga cgcctacgac 900 agcgaaagag tgtggttcaa
gttcacaacc cccgacacgg ccactttatt ggaggctgaa 960 gattacgaaa
aggaacctta caagtgcata ataatgccga tgagggtgta gccatgaaaa 1020
aagctttaat ctttttattg agcttgagcc ttttaattcc tgcgtttagc gaagccaaac
1080 ccaagtcttc 1090 122 363 PRT Aquifex aeolicus 122 Met Arg Val
Lys Val Asp Arg Glu Glu Leu Glu Glu Val Leu Lys Lys 1 5 10 15 Ala
Arg Glu Ser Thr Glu Lys Lys Ala Ala Leu Pro Ile Leu Ala Asn 20 25
30 Phe Leu Leu Ser Ala Lys Glu Glu Asn Leu Ile Val Arg Ala Thr Asp
35 40 45 Leu Glu Asn Tyr Leu Val Val Ser Val Lys Gly Glu Val Glu
Glu Glu 50 55 60 Gly Glu Val Cys Val His Ser Gln Lys Leu Tyr Asp
Ile Val Lys Asn 65 70 75 80 Leu Asn Ser Ala Tyr Val Tyr Leu His Thr
Glu Gly Glu Lys Leu Val 85 90 95 Ile Thr Gly Gly Lys Ser Thr Tyr
Lys Leu Pro Thr Ala Pro Ala Glu 100 105 110 Asp Phe Pro Glu Phe Pro
Glu Ile Val Glu Gly Gly Glu Thr Leu Ser 115 120 125 Gly Asn Leu Leu
Val Asn Gly Ile Glu Lys Val Glu Tyr Ala Ile Ala 130 135 140 Lys Glu
Glu Ala Asn Ile Ala Leu Gln Gly Met Tyr Leu Arg Gly Tyr 145 150 155
160 Glu Asp Arg Ile His Phe Val Gly Ser Asp Gly His Arg Leu Ala Leu
165 170 175 Tyr Glu Pro Leu Gly Glu Phe Ser Lys Glu Leu Leu Ile Pro
Arg Lys 180 185 190
Ser Leu Lys Val Leu Lys Lys Leu Ile Thr Gly Ile Glu Asp Val Asn 195
200 205 Ile Glu Lys Ser Glu Asp Glu Ser Phe Ala Tyr Phe Ser Thr Pro
Glu 210 215 220 Trp Lys Leu Ala Val Arg Leu Leu Glu Gly Glu Phe Pro
Asp Tyr Met 225 230 235 240 Ser Val Ile Pro Glu Glu Phe Ser Ala Glu
Val Leu Phe Glu Thr Glu 245 250 255 Glu Val Leu Lys Val Leu Lys Arg
Leu Lys Ala Leu Ser Glu Gly Lys 260 265 270 Val Phe Pro Val Lys Ile
Thr Leu Ser Glu Asn Leu Ala Ile Phe Glu 275 280 285 Phe Ala Asp Pro
Glu Phe Gly Glu Ala Arg Glu Glu Ile Glu Val Glu 290 295 300 Tyr Thr
Gly Glu Pro Phe Glu Ile Gly Phe Asn Gly Lys Tyr Leu Met 305 310 315
320 Glu Ala Leu Asp Ala Tyr Asp Ser Glu Arg Val Trp Phe Lys Phe Thr
325 330 335 Thr Pro Asp Thr Ala Thr Leu Leu Glu Ala Glu Asp Tyr Glu
Lys Glu 340 345 350 Pro Tyr Lys Cys Ile Ile Met Pro Met Arg Val 355
360 123 1093 DNA Aquifex aeolicus 123 gtggaaacca caatattcca
gttccagaaa acttttttca caaaacctcc gaaggagagg 60 gtcttcgtcc
ttcatggaga agagcagtat ctcataagaa cctttttgtc taagctgaag 120
gaaaagtacg gggagaatta cacggttctg tggggggatg agataagcga ggaggaattc
180 tacactgccc tttccgagac cagtatattc ggcggttcaa aggaaaaagc
ggtggtcatt 240 tacaacttcg gggatttcct gaagaagctc ggaaggaaga
aaaaggaaaa agaaaggctt 300 ataaaagtcc tcagaaacgt aaagagtaac
tacgtattta tagtgtacga tgcgaaactc 360 cagaaacagg aactttcttc
ggaacctctg aaatccgtag cgtctttcgg cggtatagtg 420 gtagcaaaca
ggctgagcaa ggagaggata aaacagctcg tccttaagaa gttcaaagaa 480
aaagggataa acgtagaaaa cgatgccctt gaataccttc tccagctcac gggttacaac
540 ttgatggagc tcaaacttga ggttgaaaaa ctgatagatt acgcaagtga
aaagaaaatt 600 ttaacactcg atgaggtaaa gagagtagcc ttctcagtct
cagaaaacgt aaacgtattt 660 gagttcgttg atttactcct cttaaaagat
tacgaaaagg ctcttaaagt tttggactcc 720 ctcatttcct tcggaataca
ccccctccag attatgaaaa tcctgtcctc ctatgctcta 780 aaactttaca
ccctcaagag gcttgaagag aagggagagg acctgaataa ggcgatggaa 840
agcgtgggaa taaagaacaa ctttctcaag atgaagttca aatcttactt aaaggcaaac
900 tctaaagagg acttgaagaa cctaatcctc tccctccaga ggatagacgc
tttttctaaa 960 ctttactttc aggacacagt gcagttgctg gggatttctt
gacctcaaga ctggagaggg 1020 aagttgtgaa aaatacttct catggtggat
aatctttttt atgaagtttg cggtttgcgt 1080 ttttcccggt tct 1093 124 350
PRT Aquifex aeolicus 124 Val Glu Thr Thr Ile Phe Gln Phe Gln Lys
Thr Phe Phe Thr Lys Pro 1 5 10 15 Pro Lys Glu Arg Val Phe Val Leu
His Gly Glu Glu Gln Tyr Leu Ile 20 25 30 Arg Thr Phe Leu Ser Lys
Leu Lys Glu Lys Tyr Gly Glu Asn Tyr Thr 35 40 45 Val Leu Trp Gly
Asp Glu Ile Ser Glu Glu Glu Phe Tyr Thr Ala Leu 50 55 60 Ser Glu
Thr Ser Ile Phe Gly Gly Ser Lys Glu Lys Ala Val Val Ile 65 70 75 80
Tyr Asn Phe Gly Asp Phe Leu Lys Lys Leu Gly Arg Lys Lys Lys Glu 85
90 95 Lys Glu Arg Leu Ile Lys Val Leu Arg Asn Val Lys Ser Asn Tyr
Val 100 105 110 Phe Ile Val Tyr Asp Ala Lys Leu Gln Lys Gln Glu Leu
Ser Ser Glu 115 120 125 Pro Leu Lys Ser Val Ala Ser Phe Gly Gly Ile
Val Val Ala Asn Arg 130 135 140 Leu Ser Lys Glu Arg Ile Lys Gln Leu
Val Leu Lys Lys Phe Lys Glu 145 150 155 160 Lys Gly Ile Asn Val Glu
Asn Asp Ala Leu Glu Tyr Leu Leu Gln Leu 165 170 175 Thr Gly Tyr Asn
Leu Met Glu Leu Lys Leu Glu Val Glu Lys Leu Ile 180 185 190 Asp Tyr
Ala Ser Glu Lys Lys Ile Leu Thr Leu Asp Glu Val Lys Arg 195 200 205
Val Ala Phe Ser Val Ser Glu Asn Val Asn Val Phe Glu Phe Val Asp 210
215 220 Leu Leu Leu Leu Lys Asp Tyr Glu Lys Ala Leu Lys Val Leu Asp
Ser 225 230 235 240 Leu Ile Ser Phe Gly Ile His Pro Leu Gln Ile Met
Lys Ile Leu Ser 245 250 255 Ser Tyr Ala Leu Lys Leu Tyr Thr Leu Lys
Arg Leu Glu Glu Lys Gly 260 265 270 Glu Asp Leu Asn Lys Ala Met Glu
Ser Val Gly Ile Lys Asn Asn Phe 275 280 285 Leu Lys Met Lys Phe Lys
Ser Tyr Leu Lys Ala Asn Ser Lys Glu Asp 290 295 300 Leu Lys Asn Leu
Ile Leu Ser Leu Gln Arg Ile Asp Ala Phe Ser Lys 305 310 315 320 Leu
Tyr Phe Gln Asp Thr Val Gln Leu Leu Arg Asp Phe Leu Thr Ser 325 330
335 Arg Leu Glu Arg Glu Val Val Lys Asn Thr Ser His Gly Gly 340 345
350 125 1051 DNA Aquifex aeolicus 125 atggaaaaag tttttttgga
aaaactccag aaaaccttgc acatacccgg aggactcctt 60 ttttacggca
aagaaggaag cggaaagacg aaaacagctt ttgaatttgc aaaaggtatt 120
ttatgtaagg aaaacgtacc tggggatgcg gaagttgtcc ctcctgcaaa cacgtaaacg
180 agctggagga agccttcttt aaaggagaaa tagaagactt taaagtttat
aagacaagga 240 cggtaaaaag cacttcgttt accttatggg cgaacatccc
gactttgtgg taataatccc 300 gagcggacat tacataaaga tagaacagat
aagggaagtt aagaactttg cctatgtgaa 360 gcccgcacta agcaggagaa
aagtaattat aatagacgac gcccacgcga tgacctctca 420 ggcggcaaac
gctcttttaa aggtattgga agagccacct gcggacacca cctttatctt 480
gaccacgaac aggcgttctg caatcctgcc gactatcctc tccagaactt ttcaagtgga
540 gttcaagggc ttttcagtaa aagaggttat ggaaatagcg aaagtagacg
aggaaatagc 600 gaaactctct ggaggcagtc taaaaagggc tatcttacta
aaggaaaaca aagatatcct 660 aaacaaagta aaggaattct tggaaaacga
gccgttaaaa gtttacaagc ttgcaagtga 720 attcgaaaag tgggaacctg
aaaagcaaaa actcttcctt gaaattatgg aagaattggt 780 atctcaaaaa
ttgaccgaag agaaaaaaga caattacacc taccttcttg atacgatcag 840
actctttaaa gacggactcg caaggggtgt aaacgaacct ctgtggctgt ttacgttagc
900 cgttcaggcg gattaataaa ccgttattga ttccgtaaca tttaaacctt
aatctaaatt 960 atgagagcct ttgaaggagg tctggtatgg aaaatttgaa
gattagatat atagatacga 1020 ggaagatagg aaccgtgagc ggtgtaaaag t 1051
126 305 PRT Aquifex aeolicus 126 Met Glu Lys Val Phe Leu Glu Lys
Leu Gln Lys Thr Leu His Ile Pro 1 5 10 15 Gly Gly Leu Leu Phe Tyr
Gly Lys Glu Gly Ser Gly Lys Thr Lys Thr 20 25 30 Ala Phe Glu Phe
Ala Lys Gly Ile Leu Cys Lys Glu Asn Val Pro Trp 35 40 45 Gly Cys
Gly Ser Cys Pro Ser Cys Lys His Val Asn Glu Leu Glu Glu 50 55 60
Ala Phe Phe Lys Gly Glu Ile Glu Asp Phe Lys Val Tyr Lys Asp Lys 65
70 75 80 Asp Gly Lys Lys His Phe Val Tyr Leu Met Gly Glu His Pro
Asp Phe 85 90 95 Val Val Ile Ile Pro Ser Gly His Tyr Ile Lys Ile
Glu Gln Ile Arg 100 105 110 Glu Val Lys Asn Phe Ala Tyr Val Lys Pro
Ala Leu Ser Arg Arg Lys 115 120 125 Val Ile Ile Ile Asp Asp Ala His
Ala Met Thr Ser Gln Ala Ala Asn 130 135 140 Ala Leu Leu Lys Val Leu
Glu Glu Pro Pro Ala Asp Thr Thr Phe Ile 145 150 155 160 Leu Thr Thr
Asn Arg Arg Ser Ala Ile Leu Pro Thr Ile Leu Ser Arg 165 170 175 Thr
Phe Gln Val Glu Phe Lys Gly Phe Ser Val Lys Glu Val Met Glu 180 185
190 Ile Ala Lys Val Asp Glu Glu Ile Ala Lys Leu Ser Gly Gly Ser Leu
195 200 205 Lys Arg Ala Ile Leu Leu Lys Glu Asn Lys Asp Ile Leu Asn
Lys Val 210 215 220 Lys Glu Phe Leu Glu Asn Glu Pro Leu Lys Val Tyr
Lys Leu Ala Ser 225 230 235 240 Glu Phe Glu Lys Trp Glu Pro Glu Lys
Gln Lys Leu Phe Leu Glu Ile 245 250 255 Met Glu Glu Leu Val Ser Gln
Lys Leu Thr Glu Glu Lys Lys Asp Asn 260 265 270 Tyr Thr Tyr Leu Leu
Asp Thr Ile Arg Leu Phe Lys Asp Gly Leu Ala 275 280 285 Arg Gly Val
Asn Glu Pro Leu Trp Leu Phe Thr Leu Ala Val Gln Ala 290 295 300 Asp
305 127 630 DNA Aquifex aeolicus 127 atgaacttcc tgaaaaagtt
ccttttactg agaaaagctc aaaagtctcc ttacttcgaa 60 gagttctacg
aagaaatcga tttgaaccag aaggtgaaag atgcaaggtt tgtagttttt 120
gactgcgaag ccacagaact cgacgtaaag aaggcaaaac tcctttcaat aggtgcggtt
180 gaggttaaaa acctggaaat agacctctct aaatcttttt acgagatact
caaaagtgac 240 gagataaagg cggcggagat acatggaata accagggaag
acgttgaaaa gtacggaaag 300 gaaccaaagg aagtaatata cgactttctg
aagtacataa agggaagcgt tctcgttggc 360 tactacgtga agtttgacgt
ctcactcgtt gagaagtact ccataaagta cttccagtat 420 ccaatcatca
actacaagtt agacctgttt agtttcgtga agagagagta ccagagtggc 480
aggagtcttg acgaccttat gaaggaactc ggtgtagaaa taagggcaag gcacaacgcc
540 cttgaagatg cctacataac cgctcttctt ttcctaaagt acgtttaccc
gaacagggag 600 tacagactaa aggatctccc gattttcctt 630 128 210 PRT
Aquifex aeolicus 128 Met Asn Phe Leu Lys Lys Phe Leu Leu Leu Arg
Lys Ala Gln Lys Ser 1 5 10 15 Pro Tyr Phe Glu Glu Phe Tyr Glu Glu
Ile Asp Leu Asn Gln Lys Val 20 25 30 Lys Asp Ala Arg Phe Val Val
Phe Asp Cys Glu Ala Thr Glu Leu Asp 35 40 45 Val Lys Lys Ala Lys
Leu Leu Ser Ile Gly Ala Val Glu Val Lys Asn 50 55 60 Leu Glu Ile
Asp Leu Ser Lys Ser Phe Tyr Glu Ile Leu Lys Ser Asp 65 70 75 80 Glu
Ile Lys Ala Ala Glu Ile His Gly Ile Thr Arg Glu Asp Val Glu 85 90
95 Lys Tyr Gly Lys Glu Pro Lys Glu Val Ile Tyr Asp Phe Leu Lys Tyr
100 105 110 Ile Lys Gly Ser Val Leu Val Gly Tyr Tyr Val Lys Phe Asp
Val Ser 115 120 125 Leu Val Glu Lys Tyr Ser Ile Lys Tyr Phe Gln Tyr
Pro Ile Ile Asn 130 135 140 Tyr Lys Leu Asp Leu Phe Ser Phe Val Lys
Arg Glu Tyr Gln Ser Gly 145 150 155 160 Arg Ser Leu Asp Asp Leu Met
Lys Glu Leu Gly Val Glu Ile Arg Ala 165 170 175 Arg His Asn Ala Leu
Glu Asp Ala Tyr Ile Thr Ala Leu Leu Phe Leu 180 185 190 Lys Tyr Val
Tyr Pro Asn Arg Glu Tyr Arg Leu Lys Asp Leu Pro Ile 195 200 205 Phe
Leu 210 129 526 DNA Aquifex aeolicus 129 atgctcaata aggtttttat
aataggaaga cttacgggtg accccgttat aacttatcta 60 ccgagcggaa
cgcccgtagt agagtttact ctggcttaca acagaaggta taaaaaccag 120
aacggtgaat ttcaggagga aagtcacttc tttgacgtaa aggcgtacgg aaaaatggct
180 gaagactggg ctacacgctt ctcgaaagga tacctcgtac tcgtagaggg
aagactctcc 240 caggaaaagt gggagaaaga aggaaagaag ttctcaaagg
tcaggataat agcggaaaac 300 gtaagattaa taaacaggcc gaaaggtgct
gaacttcaag cagaagaaga ggaggaagtt 360 cctcccattg aggaggaaat
tgaaaaactc ggtaaagagg aagagaagcc ttttaccgat 420 gaagaggacg
aaataccttt ttaattttga ggaggttaaa gtatggtagt gagagctcct 480
aagaagaaag tttgtatgta ctgtgaacaa aagagagagc cagatt 526 130 147 PRT
Aquifex aeolicus 130 Met Leu Asn Lys Val Phe Ile Ile Gly Arg Leu
Thr Gly Asp Pro Val 1 5 10 15 Ile Thr Tyr Leu Pro Ser Gly Thr Pro
Val Val Glu Phe Thr Leu Ala 20 25 30 Tyr Asn Arg Arg Tyr Lys Asn
Gln Asn Gly Glu Phe Gln Glu Glu Ser 35 40 45 His Phe Phe Asp Val
Lys Ala Tyr Gly Lys Met Ala Glu Asp Trp Ala 50 55 60 Thr Arg Phe
Ser Lys Gly Tyr Leu Val Leu Val Glu Gly Arg Leu Ser 65 70 75 80 Gln
Glu Lys Trp Glu Lys Glu Gly Lys Lys Phe Ser Lys Val Arg Ile 85 90
95 Ile Ala Glu Asn Val Arg Leu Ile Asn Arg Pro Lys Gly Ala Glu Leu
100 105 110 Gln Ala Glu Glu Glu Glu Glu Val Pro Pro Ile Glu Glu Glu
Ile Glu 115 120 125 Lys Leu Gly Lys Glu Glu Glu Lys Pro Phe Thr Asp
Glu Glu Asp Glu 130 135 140 Ile Pro Phe 145 131 1472 DNA Aquifex
aeolicus 131 atgcaatttg tggataaact tccctgtgac gaatccgccg agagggcggt
tcttggcagt 60 atgcttgaag accccgaaaa catacctctg gtacttgaat
accttaaaga agaagacttc 120 tgcatagacg agcacaagct acttttcagg
gttcttacaa acctctggtc cgagtacggc 180 aataagctcg atttcgtatt
aataaaggat caccttgaaa agaaaaactt actccagaaa 240 atacctatag
actggctcga agaactctac gaggaggcgg tatcccctga cacgcttgag 300
gaagtctgca aaatagtaaa acaacgttcc gcacagaggg cgataattca actcggtata
360 gaactcattc acaaaggaaa ggaaaacaaa gactttcaca cattaatcga
ggaagcccag 420 agcaggatat tttccatagc ggaaagtgct acatctacgc
agttttacca tgtgaaagac 480 gttgcggaag aagttataga actcatttat
aaattcaaaa gctctgacag gctagtcacg 540 ggactcccaa gcggtttcac
ggaactcgat ctaaagacga cgggattcca ccctggagac 600 ttaataatac
tcgccgcaag acccggtatg gggaaaaccg cctttatgct ctccataatc 660
tacaatctcg caaaagacga gggaaaaccc tcagctgtat tttccttgga aatgagcaag
720 gaacagctcg ttatgagact cctctctatg atgtcggagg tcccactttt
caagataagg 780 tctggaagta tatcgaatga agatttaaag aagcttgaag
caagcgcaat agaactcgca 840 aagtacgaca tatacctcga cgacacaccc
gctctcacta caacggattt aaggataagg 900 gcaagaaagc tcagaaagga
aaaggaagtt gagttcgtgg cggtggacta cttgcaactt 960 ctgagaccgc
cagtccgaaa gagttcaaga caggaggaag tggcagaggt ttcaagaaac 1020
ttaaaagccc ttgcaaagga acttcacatt cccgttatgg cacttgcgca gctctcccgt
1080 gaggtggaaa agaggagtga taaaagaccc cagcttgcgg acctcagaga
atccggacag 1140 atagaacagg acgcagacct aatccttttc ctccacagac
ccgagtacta caagaaaaag 1200 ccaaatcccg aagagcaggg tatagcggaa
gtgataatag ccaagcaaag gcaaggaccc 1260 acggacattg tgaagctcgc
atttattaag gagtacacta agtttgcaaa cctagaagcc 1320 cttcctgaac
aacctcctga agaagaggaa ctttccgaaa ttattgaaac acaggaggat 1380
gaaggattcg aagatattga cttctgaaaa ttaaggtttt ataattttat cttggctatc
1440 cggggtagct caatcggcag agcgggtggc tg 1472 132 438 PRT Aquifex
aeolicus 132 Met Gln Phe Val Asp Lys Leu Pro Cys Asp Glu Ser Ala
Glu Arg Ala 1 5 10 15 Val Leu Gly Ser Met Leu Glu Asp Pro Glu Asn
Ile Pro Leu Val Leu 20 25 30 Glu Tyr Leu Lys Glu Glu Asp Phe Cys
Ile Asp Glu His Lys Leu Leu 35 40 45 Phe Arg Val Leu Thr Asn Leu
Trp Ser Glu Tyr Gly Asn Lys Leu Asp 50 55 60 Phe Val Leu Ile Lys
Asp His Leu Glu Lys Lys Asn Leu Leu Gln Lys 65 70 75 80 Ile Pro Ile
Asp Trp Leu Glu Glu Leu Tyr Glu Glu Ala Val Ser Pro 85 90 95 Asp
Thr Leu Glu Glu Val Cys Lys Ile Val Lys Gln Arg Ser Ala Gln 100 105
110 Arg Ala Ile Ile Gln Leu Gly Ile Thr Ser Thr Gln Phe Tyr His Val
115 120 125 Lys Asp Val Ala Glu Glu Val Ile Glu Leu Ile Tyr Lys Phe
Lys Ser 130 135 140 Ser Asp Arg Leu Val Thr Gly Leu Pro Ser Gly Phe
Thr Glu Leu Asp 145 150 155 160 Leu Lys Thr Thr Gly Phe His Pro Gly
Asp Leu Ile Ile Leu Ala Ala 165 170 175 Arg Pro Gly Met Gly Lys Thr
Ala Phe Met Leu Ser Ile Ile Tyr Asn 180 185 190 Leu Ala Lys Asp Glu
Gly Lys Pro Ser Ala Val Phe Ser Leu Glu Met 195 200 205 Ser Lys Glu
Gln Leu Val Met Arg Leu Leu Ser Met Met Ser Glu Val 210 215 220 Pro
Leu Phe Lys Ile Arg Ser Gly Ser Ile Ser Asn Glu Asp Leu Lys 225 230
235 240 Lys Leu Glu Ala Ser Ala Ile Glu Leu Ala Lys Tyr Asp Ile Tyr
Leu 245 250 255 Asp Asp Thr Pro Ala Leu Thr Thr Thr Asp Leu Arg Ile
Arg Ala Arg 260 265 270 Lys Leu Arg Lys Glu Lys Glu Val Glu Phe Val
Ala Val Asp Tyr Leu 275 280 285 Gln Leu Leu Arg Pro Pro Val Arg Lys
Ser Ser Arg Gln Glu Glu Val 290 295 300 Ala Glu Val Ser Arg Asn Leu
Lys Ala Leu Ala Lys Glu Leu His Ile 305 310 315 320 Pro Val Met Ala
Leu Ala Gln Leu Ser Arg Glu Val Glu Lys Arg Ser 325 330 335 Asp Lys
Arg Pro Gln Leu Ala Asp Leu Arg Glu Ser Gly Gln Ile Glu 340 345 350
Gln Asp Ala Asp Leu Ile Leu Phe Leu His Arg Pro Glu Tyr Tyr Lys 355
360 365 Lys Lys Pro Asn Pro Glu Glu Gln Gly Ile Ala Glu Val Ile Ile
Ala 370 375 380 Lys Gln Arg Gln Gly Pro Thr Asp Ile Val Lys Leu Ala
Phe Ile Lys 385 390 395 400 Glu Tyr Thr Lys Phe Ala Asn Leu Glu Ala
Leu Pro Glu Gln Pro Pro 405 410 415 Glu Glu Glu Glu Leu Ser Glu
Ile Ile Glu Thr Gln Glu Asp Glu Gly 420 425 430 Phe Glu Asp Ile Asp
Phe 435 133 1526 DNA Aquifex aeolicus 133 atgtcctcgg acatagacga
acttagacgg gaaatagata tagtagacgt catttccgaa 60 tacttaaact
tagagaaggt aggttccaat tacagaacga actgtccctt tcaccctgac 120
gatacaccct ccttttacgt gtctccaagt aaacaaatat tcaagtgttt cggttgcggg
180 gtagggggag acgcgataaa gttcgtttcc ctttacgagg acatctccta
ttttgaagcc 240 gcccttgaac tcgcaaaacg ctacggaaag aaattagacc
ttgaaaagat atcaaaagac 300 gaaaaggtat acgtggctct tgacagggtt
tgtgatttct acagggaaag ccttctcaaa 360 aacagagagg caagtgagta
cgtaaagagt aggggaatag accctaaagt agcgaggaag 420 tttgatcttg
ggtacgcacc ttccagtgaa gcactcgtaa aagtcttaaa agagaacgat 480
cttttagagg cttaccttga aactaaaaac ctcctttctc ctacgaaggg tgtttacagg
540 gatctctttc ttcggcgtgt cgtgatcccg ataaaggatc cgaggggaag
agttataggt 600 ttcggtggaa ggaggatagt agaggacaaa tctcccaagt
acataaactc tccagacagc 660 agggtattta aaaaggggga gaacttattc
ggtctttacg aggcaaagga gtatataaag 720 gaagaaggat ttgcgatact
tgtggaaggg tactttgacc ttttgagact tttttccgag 780 ggaataagga
acgttgttgc acccctcggt acagccctga cccaaaatca ggcaaacctc 840
ctttccaagt tcacaaaaaa ggtctacatc ctttacgacg gagatgatgc gggaagaaag
900 gctatgaaaa gtgccattcc cctactcctc agtgcaggag tggaagttta
tcccgtttac 960 ctccccgaag gatacgatcc cgacgagttt ataaaggaat
tcgggaaaga ggaattaaga 1020 agactgataa acagctcagg ggagctcttt
gaaacgctca taaaaaccgc aagggaaaac 1080 ttagaggaga aaacgcgtga
gttcaggtat tatctgggct ttatttccga tggagtaagg 1140 cgctttgctc
tggcttcgga gtttcacacc aagtacaaag ttcctatgga aattttatta 1200
atgaaaattg aaaaaaattc tcaagaaaaa gaaattaaac tctcctttaa ggaaaaaatc
1260 ttcctgaaag gactgataga attaaaacca aaaatagacc ttgaagtcct
gaacttaagt 1320 cctgagttaa aggaactcgc agttaacgcc ttaaacggag
aggagcattt acttccaaaa 1380 gaagttctcg agtaccaggt ggataacttg
gagaaacttt ttaacaacat ccttagggat 1440 ttacaaaaat ctgggaaaaa
gaggaagaaa agagggttga aaaatgtaaa tacttaatta 1500 actttaataa
atttttagag ttagga 1526 134 498 PRT Aquifex aeolicus 134 Met Ser Ser
Asp Ile Asp Glu Leu Arg Arg Glu Ile Asp Ile Val Asp 1 5 10 15 Val
Ile Ser Glu Tyr Leu Asn Leu Glu Lys Val Gly Ser Asn Tyr Arg 20 25
30 Thr Asn Cys Pro Phe His Pro Asp Asp Thr Pro Ser Phe Tyr Val Ser
35 40 45 Pro Ser Lys Gln Ile Phe Lys Cys Phe Gly Cys Gly Val Gly
Gly Asp 50 55 60 Ala Ile Lys Phe Val Ser Leu Tyr Glu Asp Ile Ser
Tyr Phe Glu Ala 65 70 75 80 Ala Leu Glu Leu Ala Lys Arg Tyr Gly Lys
Lys Leu Asp Leu Glu Lys 85 90 95 Ile Ser Lys Asp Glu Lys Val Tyr
Val Ala Leu Asp Arg Val Cys Asp 100 105 110 Phe Tyr Arg Glu Ser Leu
Leu Lys Asn Arg Glu Ala Ser Glu Tyr Val 115 120 125 Lys Ser Arg Gly
Ile Asp Pro Lys Val Ala Arg Lys Phe Asp Leu Gly 130 135 140 Tyr Ala
Pro Ser Ser Glu Ala Leu Val Lys Val Leu Lys Glu Asn Asp 145 150 155
160 Leu Leu Glu Ala Tyr Leu Glu Thr Lys Asn Leu Leu Ser Pro Thr Lys
165 170 175 Gly Val Tyr Arg Asp Leu Phe Leu Arg Arg Val Val Ile Pro
Ile Lys 180 185 190 Asp Pro Arg Gly Arg Val Ile Gly Phe Gly Gly Arg
Arg Ile Val Glu 195 200 205 Asp Lys Ser Pro Lys Tyr Ile Asn Ser Pro
Asp Ser Arg Val Phe Lys 210 215 220 Lys Gly Glu Asn Leu Phe Gly Leu
Tyr Glu Ala Lys Glu Tyr Ile Lys 225 230 235 240 Glu Glu Gly Phe Ala
Ile Leu Val Glu Gly Tyr Phe Asp Leu Leu Arg 245 250 255 Leu Phe Ser
Glu Gly Ile Arg Asn Val Val Ala Pro Leu Gly Thr Ala 260 265 270 Leu
Thr Gln Asn Gln Ala Asn Leu Leu Ser Lys Phe Thr Lys Lys Val 275 280
285 Tyr Ile Leu Tyr Asp Gly Asp Asp Ala Gly Arg Lys Ala Met Lys Ser
290 295 300 Ala Ile Pro Leu Leu Leu Ser Ala Gly Val Glu Val Tyr Pro
Val Tyr 305 310 315 320 Leu Pro Glu Gly Tyr Asp Pro Asp Glu Phe Ile
Lys Glu Phe Gly Lys 325 330 335 Glu Glu Leu Arg Arg Leu Ile Asn Ser
Ser Gly Glu Leu Phe Glu Thr 340 345 350 Leu Ile Lys Thr Ala Arg Glu
Asn Leu Glu Glu Lys Thr Arg Glu Phe 355 360 365 Arg Tyr Tyr Leu Gly
Phe Ile Ser Asp Gly Val Arg Arg Phe Ala Leu 370 375 380 Ala Ser Glu
Phe His Thr Lys Tyr Lys Val Pro Met Glu Ile Leu Leu 385 390 395 400
Met Lys Ile Glu Lys Asn Ser Gln Glu Lys Glu Ile Lys Leu Ser Phe 405
410 415 Lys Glu Lys Ile Phe Leu Lys Gly Leu Ile Glu Leu Lys Pro Lys
Ile 420 425 430 Asp Leu Glu Val Leu Asn Leu Ser Pro Glu Leu Lys Glu
Leu Ala Val 435 440 445 Asn Ala Leu Asn Gly Glu Glu His Leu Leu Pro
Lys Glu Val Leu Glu 450 455 460 Tyr Gln Val Asp Asn Leu Glu Lys Leu
Phe Asn Asn Ile Leu Arg Asp 465 470 475 480 Leu Gln Lys Ser Gly Lys
Lys Arg Lys Lys Arg Gly Leu Lys Asn Val 485 490 495 Asn Thr 135 705
DNA Aquifex aeolicus 135 atgcaagata ccgctacctg cagtatttgt
caggggacgg gattcgtaaa gaccgaagac 60 aacaaggtaa ggctctgcga
atgcaggttc aagaaaaggg atgtaaacag ggaactaaac 120 atcccaaaga
ggtactggaa cgccaactta gacacttacc accccaagaa cgtatcccag 180
aacagggcac ttttgacgat aagggtcttc gtccacaact tcaatcccga ggaagggaaa
240 gggcttacct ttgtaggatc tcctggagtc ggcaaaactc accttgcggt
tgcaacatta 300 aaagcgattt atgagaagaa gggaatcaga ggatacttct
tcgatacgaa ggatctaata 360 ttcaggttaa aacacttaat ggacgaggga
aaggatacaa agtttttaaa aactgtctta 420 aactcaccgg ttttggttct
cgacgacctc ggttctgaga ggctcagtga ctggcagagg 480 gaactcatct
cttacataat cacttacagg tataacaacc ttaagagcac gataataacc 540
acgaattact cactccagag ggaagaagag agtagcgtga ggataagtgc ggatcttgca
600 agcagactcg gagaaaacgt agtttcaaaa atttacgaga tgaacgagtt
gctcgttata 660 aagggttccg acctcaggaa gtctaaaaag ctatcaaccc catct
705 136 235 PRT Aquifex aeolicus 136 Met Gln Asp Thr Ala Thr Cys
Ser Ile Cys Gln Gly Thr Gly Phe Val 1 5 10 15 Lys Thr Glu Asp Asn
Lys Val Arg Leu Cys Glu Cys Arg Phe Lys Lys 20 25 30 Arg Asp Val
Asn Arg Glu Leu Asn Ile Pro Lys Arg Tyr Trp Asn Ala 35 40 45 Asn
Leu Asp Thr Tyr His Pro Lys Asn Val Ser Gln Asn Arg Ala Leu 50 55
60 Leu Thr Ile Arg Val Phe Val His Asn Phe Asn Pro Glu Glu Gly Lys
65 70 75 80 Gly Leu Thr Phe Val Gly Ser Pro Gly Val Gly Lys Thr His
Leu Ala 85 90 95 Val Ala Thr Leu Lys Ala Ile Tyr Glu Lys Lys Gly
Ile Arg Gly Tyr 100 105 110 Phe Phe Asp Thr Lys Asp Leu Ile Phe Arg
Leu Lys His Leu Met Asp 115 120 125 Glu Gly Lys Asp Thr Lys Phe Leu
Lys Thr Val Leu Asn Ser Pro Val 130 135 140 Leu Val Leu Asp Asp Leu
Gly Ser Glu Arg Leu Ser Asp Trp Gln Arg 145 150 155 160 Glu Leu Ile
Ser Tyr Ile Ile Thr Tyr Arg Tyr Asn Asn Leu Lys Ser 165 170 175 Thr
Ile Ile Thr Thr Asn Tyr Ser Leu Gln Arg Glu Glu Glu Ser Ser 180 185
190 Val Arg Ile Ser Ala Asp Leu Ala Ser Arg Leu Gly Glu Asn Val Val
195 200 205 Ser Lys Ile Tyr Glu Met Asn Glu Leu Leu Val Ile Lys Gly
Ser Asp 210 215 220 Leu Arg Lys Ser Lys Lys Leu Ser Thr Pro Ser 225
230 235 137 4101 DNA Thermatoga maritima 137 atgaaaaaga ttgaaaattt
gaagtggaaa aatgtctcgt ttaaaagcct ggaaatagat 60 cccgatgcag
gtgtggttct cgtttccgtg gaaaaattct ccgaagagat agaagacctt 120
gtgcgtttac tggagaagaa gacgcggttt cgagtcatcg tgaacggtgt tcaaaaaagt
180 aacggggatc taaggggaaa gatactttcc cttctcaacg gtaatgtgcc
ttacataaaa 240 gatgttgttt tcgaaggaaa caggctgatt ctgaaagtgc
ttggagattt cgcgcgggac 300 aggatcgcct ccaaactcag aagcacgaaa
aaacagctcg atgaactgct gcctcccgga 360 acagagatca tgctggaggt
tgtggagcct ccggaagatc ttttgaaaaa ggaagtacca 420 caaccagaaa
agagagaaga accaaagggt gaagaattga agatcgagga tgaaaaccac 480
atctttggac agaaacccag aaagatcgtc ttcaccccct caaaaatctt tgagtacaac
540 aaaaagacat cggtgaaggg caagatcttc aaaatagaga agatcgaggg
gaaaagaacg 600 gtccttctga tttacctgac agacggagaa gattctctga
tctgcaaagt cttcaacgac 660 gttgaaaagg tcgaagggaa agtatcggtg
ggagacgtga tcgttgccac aggagacctc 720 cttctcgaaa acggggagcc
caccctttac gtgaagggaa tcacaaaact tcccgaagcg 780 aaaaggatgg
acaaatctcc ggttaagagg gtggagctcc acgcccatac caagttcagc 840
gatcaggacg caataacaga tgtgaacgaa tatgtgaaac gagccaagga atggggcttt
900 cccgcgatag ccctcacgga tcatgggaac gttcaggcca taccttactt
ctacgacgcg 960 gcgaaagaag ctggaataaa gcccattttc ggtatcgaag
cgtatctggt gagtgacgtg 1020 gagcccgtca taaggaatct ctccgacgat
tcgacgtttg gagatgccac gttcgtcgtc 1080 ctcgacttcg agacgacggg
tctcgacccg caggtggatg agatcatcga gataggagcg 1140 gtgaagatac
agggtggcca gatagtggac gagtaccaca ctctcataaa gccttccagg 1200
gagatctcaa gaaaaagttc ggagatcacc ggaatcactc aagagatgct ggaaaacaag
1260 agaagcatcg aggaagttct gccggagttc ctcggttttc tggaagattc
catcatcgta 1320 gcacacaacg ccaacttcga ctacagattt ctgaggctgt
ggatcaaaaa agtgatggga 1380 ttggactggg aaagacccta catagatacg
ctcgccctcg caaagtccct tctcaaactg 1440 agaagctact ctctggattc
cgttgtggaa aagctcggat tgggtccctt ccggcaccac 1500 agggccctgg
atgacgcgag ggtcaccgct caggttttcc tcaggttcgt tgagatgatg 1560
aagaagatcg gtatcacgaa gctttcagaa atggagaagt tgaaggatac gatagactac
1620 accgcgttga aacccttcca ctgcacgatc ctcgttcaga acaaaaaggg
attgaaaaac 1680 ctatacaaac tggtttctga ttcctatata aagtacttct
acggtgttcc gaggatcctc 1740 aaaagtgagc tcatcgagaa cagagaagga
ctgctcgtgg gtagcgcgtg tatctccggt 1800 gagctcggac gtgccgccct
cgaaggagcg agtgattcag aactcgaaga gatcgcgaag 1860 ttctacgact
acatagaagt catgccgctc gacgttatag ccgaagatga agaagaccta 1920
gacagagaaa gactgaaaga agtgtaccga aaactctaca gaatagcgaa aaaattgaac
1980 aagttcgtcg tcatgaccgg tgatgttcat ttcctcgatc ccgaagatgc
caggggcaga 2040 gctgcacttc tggcacctca gggaaacaga aacttcgaga
atcagcccgc actctacctc 2100 agaacgaccg aagaaatgct cgagaaggcg
atagagatat tcgaagatga agagatcgcg 2160 agggaagtcg tgatagagaa
tcccaacaga atagccgata tgatcgagga agtgcagccg 2220 ctcgagaaaa
aacttcaccc gccgatcata gagaacgccg atgaaatagt gagaaacctc 2280
accatgaagc gggcgtacga gatctacggt gatccgcttc ccgaaatcgt ccagaagcgt
2340 gtggaaaagg aactgaacgc catcataaat catggatacg ccgttctcta
tctcatcgct 2400 caggagctcg ttcagaaatc tatgagcgat ggttacgtgg
ttggatccag aggatccgtc 2460 gggtcttcac tcgtggccaa tctcctcgga
ataacagagg tgaatcccct accaccacat 2520 tacaggtgtc cagagtgcaa
atactttgaa gttgtcgaag acgacagata cggagcgggt 2580 tacgaccttc
ccaacaagaa ctgtccaaga tgtggggctc ctctcagaaa agacggccac 2640
ggcataccgt ttgaaacgtt catggggttc gagggtgaca aggtccccga catagatctc
2700 aacttctcag gagagtatca ggaacgtgct catcgttttg tggaagaact
cttcggtaaa 2760 gaccacgtct atagggcggg aaccataaac accatcgcgg
aaagaagtgc ggtgggttac 2820 gtgagaagct acgaagagaa aaccggaaag
aagctcagaa aggcggaaat ggaaagactc 2880 gtttccatga tcacgggagt
gaagagaacg acgggtcagc acccaggggg gctcatgatc 2940 ataccgaaag
acaaagaagt ctacgatttc actcccatac agtatccagc caacgataga 3000
aacgcaggtg tgttcaccac gcacttcgca tacgagacga tccatgatga cctggtgaag
3060 atagatgcgc tcggccacga tgatcccact ttcatcaaga tgctcaagga
cctcaccgga 3120 atcgatccca tgacgattcc catggatgac cccgatacgc
tcgccatatt cagttctgtg 3180 aagcctcttg gtgtggatcc cgttgagctg
gaaagcgatg tgggaacgta cggaattccg 3240 gagttcggaa ccgagtttgt
gaggggaatg ctcgttgaaa cgagaccaaa gagtttcgcc 3300 gagcttgtga
gaatctcagg actgtcacac ggtacggacg tctggttgaa caacgcacgt 3360
gattggataa acctcggcta cgccaagctc tccgaggtta tctcgtgtag ggacgacatc
3420 atgaacttcc tcatacacaa aggaatggaa ccgtcacttg ccttcaagat
catggaaaac 3480 gtcaggaagg gaaagggtat cacagaagag atggagagcg
agatgagaag gctgaaggtt 3540 ccagaatggt tcatcgaatc ctgtaaaagg
atcaaatatc tcttcccgaa agctcacgct 3600 gtggcttacg tgagtatggc
cttcagaatt gcttacttca aggttcacta tcctcttcag 3660 ttttacgcgg
cgtacttcac gataaaaggt gatcagttcg atccggttct cgtactcagg 3720
ggaaaagaag ccataaagag gcgcttgaga gaactcaaag cgatgcctgc caaagacgcc
3780 cagaagaaaa acgaagtgag tgttctggag gttgccctgg aaatgatact
gagaggtttt 3840 tccttcctac cgcccgacat cttcaaatcc gacgcgaaga
aatttctgat agaaggaaac 3900 tcgctgagaa ttccgttcaa caaacttcca
ggactgggtg acagcgttgc cgagtcgata 3960 atcagagcca gggaagaaaa
gccgttcact tcggtggaag atctcatgaa gaggaccaag 4020 gtcaacaaaa
atcacataga gctgatgaaa agcctgggtg ttctcgggga ccttccagag 4080
acggaacagt tcacgctttt c 4101 138 1367 PRT Thermatoga maritima 138
Met Lys Lys Ile Glu Asn Leu Lys Trp Lys Asn Val Ser Phe Lys Ser 1 5
10 15 Leu Glu Ile Asp Pro Asp Ala Gly Val Val Leu Val Ser Val Glu
Lys 20 25 30 Phe Ser Glu Glu Ile Glu Asp Leu Val Arg Leu Leu Glu
Lys Lys Thr 35 40 45 Arg Phe Arg Val Ile Val Asn Gly Val Gln Lys
Ser Asn Gly Asp Leu 50 55 60 Arg Gly Lys Ile Leu Ser Leu Leu Asn
Gly Asn Val Pro Tyr Ile Lys 65 70 75 80 Asp Val Val Phe Glu Gly Asn
Arg Leu Ile Leu Lys Val Leu Gly Asp 85 90 95 Phe Ala Arg Asp Arg
Ile Ala Ser Lys Leu Arg Ser Thr Lys Lys Gln 100 105 110 Leu Asp Glu
Leu Leu Pro Pro Gly Thr Glu Ile Met Leu Glu Val Val 115 120 125 Glu
Pro Pro Glu Asp Leu Leu Lys Lys Glu Val Pro Gln Pro Glu Lys 130 135
140 Arg Glu Glu Pro Lys Gly Glu Glu Leu Lys Ile Glu Asp Glu Asn His
145 150 155 160 Ile Phe Gly Gln Lys Pro Arg Lys Ile Val Phe Thr Pro
Ser Lys Ile 165 170 175 Phe Glu Tyr Asn Lys Lys Thr Ser Val Lys Gly
Lys Ile Phe Lys Ile 180 185 190 Glu Lys Ile Glu Gly Lys Arg Thr Val
Leu Leu Ile Tyr Leu Thr Asp 195 200 205 Gly Glu Asp Ser Leu Ile Cys
Lys Val Phe Asn Asp Val Glu Lys Val 210 215 220 Glu Gly Lys Val Ser
Val Gly Asp Val Ile Val Ala Thr Gly Asp Leu 225 230 235 240 Leu Leu
Glu Asn Gly Glu Pro Thr Leu Tyr Val Lys Gly Ile Thr Lys 245 250 255
Leu Pro Glu Ala Lys Arg Met Asp Lys Ser Pro Val Lys Arg Val Glu 260
265 270 Leu His Ala His Thr Lys Phe Ser Asp Gln Asp Ala Ile Thr Asp
Val 275 280 285 Asn Glu Tyr Val Lys Arg Ala Lys Glu Trp Gly Phe Pro
Ala Ile Ala 290 295 300 Leu Thr Asp His Gly Asn Val Gln Ala Ile Pro
Tyr Phe Tyr Asp Ala 305 310 315 320 Ala Lys Glu Ala Gly Ile Lys Pro
Ile Phe Gly Ile Glu Ala Tyr Leu 325 330 335 Val Ser Asp Val Glu Pro
Val Ile Arg Asn Leu Ser Asp Asp Ser Thr 340 345 350 Phe Gly Asp Ala
Thr Phe Val Val Leu Asp Phe Glu Thr Thr Gly Leu 355 360 365 Asp Pro
Gln Val Asp Glu Ile Ile Glu Ile Gly Ala Val Lys Ile Gln 370 375 380
Gly Gly Gln Ile Val Asp Glu Tyr His Thr Leu Ile Lys Pro Ser Arg 385
390 395 400 Glu Ile Ser Arg Lys Ser Ser Glu Ile Thr Gly Ile Thr Gln
Glu Met 405 410 415 Leu Glu Asn Lys Arg Ser Ile Glu Glu Val Leu Pro
Glu Phe Leu Gly 420 425 430 Phe Leu Glu Asp Ser Ile Ile Val Ala His
Asn Ala Asn Phe Asp Tyr 435 440 445 Arg Phe Leu Arg Leu Trp Ile Lys
Lys Val Met Gly Leu Asp Trp Glu 450 455 460 Arg Pro Tyr Ile Asp Thr
Leu Ala Leu Ala Lys Ser Leu Leu Lys Leu 465 470 475 480 Arg Ser Tyr
Ser Leu Asp Ser Val Val Glu Lys Leu Gly Leu Gly Pro 485 490 495 Phe
Arg His His Arg Ala Leu Asp Asp Ala Arg Val Thr Ala Gln Val 500 505
510 Phe Leu Arg Phe Val Glu Met Met Lys Lys Ile Gly Ile Thr Lys Leu
515 520 525 Ser Glu Met Glu Lys Leu Lys Asp Thr Ile Asp Tyr Thr Ala
Leu Lys 530 535 540 Pro Phe His Cys Thr Ile Leu Val Gln Asn Lys Lys
Gly Leu Lys Asn 545 550 555 560 Leu Tyr Lys Leu Val Ser Asp Ser Tyr
Ile Lys Tyr Phe Tyr Gly Val 565 570 575 Pro Arg Ile Leu Lys Ser Glu
Leu Ile Glu Asn Arg Glu Gly Leu Leu 580 585 590 Val Gly Ser Ala Cys
Ile Ser Gly Glu Leu Gly Arg Ala Ala Leu Glu 595 600 605 Gly Ala Ser
Asp Ser Glu Leu Glu Glu Ile Ala Lys Phe Tyr Asp Tyr 610 615 620 Ile
Glu Val Met Pro
Leu Asp Val Ile Ala Glu Asp Glu Glu Asp Leu 625 630 635 640 Asp Arg
Glu Arg Leu Lys Glu Val Tyr Arg Lys Leu Tyr Arg Ile Ala 645 650 655
Lys Lys Leu Asn Lys Phe Val Val Met Thr Gly Asp Val His Phe Leu 660
665 670 Asp Pro Glu Asp Ala Arg Gly Arg Ala Ala Leu Leu Ala Pro Gln
Gly 675 680 685 Asn Arg Asn Phe Glu Asn Gln Pro Ala Leu Tyr Leu Arg
Thr Thr Glu 690 695 700 Glu Met Leu Glu Lys Ala Ile Glu Ile Phe Glu
Asp Glu Glu Ile Ala 705 710 715 720 Arg Glu Val Val Ile Glu Asn Pro
Asn Arg Ile Ala Asp Met Ile Glu 725 730 735 Glu Val Gln Pro Leu Glu
Lys Lys Leu His Pro Pro Ile Ile Glu Asn 740 745 750 Ala Asp Glu Ile
Val Arg Asn Leu Thr Met Lys Arg Ala Tyr Glu Ile 755 760 765 Tyr Gly
Asp Pro Leu Pro Glu Ile Val Gln Lys Arg Val Glu Lys Glu 770 775 780
Leu Asn Ala Ile Ile Asn His Gly Tyr Ala Val Leu Tyr Leu Ile Ala 785
790 795 800 Gln Glu Leu Val Gln Lys Ser Met Ser Asp Gly Tyr Val Val
Gly Ser 805 810 815 Arg Gly Ser Val Gly Ser Ser Leu Val Ala Asn Leu
Leu Gly Ile Thr 820 825 830 Glu Val Asn Pro Leu Pro Pro His Tyr Arg
Cys Pro Glu Cys Lys Tyr 835 840 845 Phe Glu Val Val Glu Asp Asp Arg
Tyr Gly Ala Gly Tyr Asp Leu Pro 850 855 860 Asn Lys Asn Cys Pro Arg
Cys Gly Ala Pro Leu Arg Lys Asp Gly His 865 870 875 880 Gly Ile Pro
Phe Glu Thr Phe Met Gly Phe Glu Gly Asp Lys Val Pro 885 890 895 Asp
Ile Asp Leu Asn Phe Ser Gly Glu Tyr Gln Glu Arg Ala His Arg 900 905
910 Phe Val Glu Glu Leu Phe Gly Lys Asp His Val Tyr Arg Ala Gly Thr
915 920 925 Ile Asn Thr Ile Ala Glu Arg Ser Ala Val Gly Tyr Val Arg
Ser Tyr 930 935 940 Glu Glu Lys Thr Gly Lys Lys Leu Arg Lys Ala Glu
Met Glu Arg Leu 945 950 955 960 Val Ser Met Ile Thr Gly Val Lys Arg
Thr Thr Gly Gln His Pro Gly 965 970 975 Gly Leu Met Ile Ile Pro Lys
Asp Lys Glu Val Tyr Asp Phe Thr Pro 980 985 990 Ile Gln Tyr Pro Ala
Asn Asp Arg Asn Ala Gly Val Phe Thr Thr His 995 1000 1005 Phe Ala
Tyr Glu Thr Ile His Asp Asp Leu Val Lys Ile Asp Ala Leu 1010 1015
1020 Gly His Asp Asp Pro Thr Phe Ile Lys Met Leu Lys Asp Leu Thr
Gly 1025 1030 1035 1040 Ile Asp Pro Met Thr Ile Pro Met Asp Asp Pro
Asp Thr Leu Ala Ile 1045 1050 1055 Phe Ser Ser Val Lys Pro Leu Gly
Val Asp Pro Val Glu Leu Glu Ser 1060 1065 1070 Asp Val Gly Thr Tyr
Gly Ile Pro Glu Phe Gly Thr Glu Phe Val Arg 1075 1080 1085 Gly Met
Leu Val Glu Thr Arg Pro Lys Ser Phe Ala Glu Leu Val Arg 1090 1095
1100 Ile Ser Gly Leu Ser His Gly Thr Asp Val Trp Leu Asn Asn Ala
Arg 1105 1110 1115 1120 Asp Trp Ile Asn Leu Gly Tyr Ala Lys Leu Ser
Glu Val Ile Ser Cys 1125 1130 1135 Arg Asp Asp Ile Met Asn Phe Leu
Ile His Lys Gly Met Glu Pro Ser 1140 1145 1150 Leu Ala Phe Lys Ile
Met Glu Asn Val Arg Lys Gly Lys Gly Ile Thr 1155 1160 1165 Glu Glu
Met Glu Ser Glu Met Arg Arg Leu Lys Val Pro Glu Trp Phe 1170 1175
1180 Ile Glu Ser Cys Lys Arg Ile Lys Tyr Leu Phe Pro Lys Ala His
Ala 1185 1190 1195 1200 Val Ala Tyr Val Ser Met Ala Phe Arg Ile Ala
Tyr Phe Lys Val His 1205 1210 1215 Tyr Pro Leu Gln Phe Tyr Ala Ala
Tyr Phe Thr Ile Lys Gly Asp Gln 1220 1225 1230 Phe Asp Pro Val Leu
Val Leu Arg Gly Lys Glu Ala Ile Lys Arg Arg 1235 1240 1245 Leu Arg
Glu Leu Lys Ala Met Pro Ala Lys Asp Ala Gln Lys Lys Asn 1250 1255
1260 Glu Val Ser Val Leu Glu Val Ala Leu Glu Met Ile Leu Arg Gly
Phe 1265 1270 1275 1280 Ser Phe Leu Pro Pro Asp Ile Phe Lys Ser Asp
Ala Lys Lys Phe Leu 1285 1290 1295 Ile Glu Gly Asn Ser Leu Arg Ile
Pro Phe Asn Lys Leu Pro Gly Leu 1300 1305 1310 Gly Asp Ser Val Ala
Glu Ser Ile Ile Arg Ala Arg Glu Glu Lys Pro 1315 1320 1325 Phe Thr
Ser Val Glu Asp Leu Met Lys Arg Thr Lys Val Asn Lys Asn 1330 1335
1340 His Ile Glu Leu Met Lys Ser Leu Gly Val Leu Gly Asp Leu Pro
Glu 1345 1350 1355 1360 Thr Glu Gln Phe Thr Leu Phe 1365 139 567
DNA Thermatoga maritima 139 gtgctcgcca tgatatggaa cgacaccgtt
ttttgcgtcg tagacacaga aaccacggga 60 accgatccct ttgccggaga
ccggatagtt gaaatagccg ctgttcctgt cttcaagggg 120 aagatctaca
gaaacaaagc gtttcactct ctcgtgaatc ccagaataag aatccctgcg 180
ctgattcaga aagttcacgg tatcagcaac atggacatcg tggaagcgcc agacatggac
240 acagtttacg atcttttcag ggattacgtg aagggaacgg tgctcgtgtt
tcacaacgcc 300 aacttcgacc tcacttttct ggatatgatg gcaaaggaaa
cgggaaactt tccaataacg 360 aatccctaca tcgacacact cgatctttca
gaagagatct ttggaaggcc tcattctctc 420 aaatggctct ccgaaagact
tggaataaaa accacgatac ggcaccgtgc tcttccagat 480 gccctggtga
ccgcaagagt ttttgtgaag cttgttgaat ttcttggtga aaacagggtc 540
aacgaattca tacgtggaaa acggggg 567 140 189 PRT Thermatoga maritima
140 Met Leu Ala Met Ile Trp Asn Asp Thr Val Phe Cys Val Val Asp Thr
1 5 10 15 Glu Thr Thr Gly Thr Asp Pro Phe Ala Gly Asp Arg Ile Val
Glu Ile 20 25 30 Ala Ala Val Pro Val Phe Lys Gly Lys Ile Tyr Arg
Asn Lys Ala Phe 35 40 45 His Ser Leu Val Asn Pro Arg Ile Arg Ile
Pro Ala Leu Ile Gln Lys 50 55 60 Val His Gly Ile Ser Asn Met Asp
Ile Val Glu Ala Pro Asp Met Asp 65 70 75 80 Thr Val Tyr Asp Leu Phe
Arg Asp Tyr Val Lys Gly Thr Val Leu Val 85 90 95 Phe His Asn Ala
Asn Phe Asp Leu Thr Phe Leu Asp Met Met Ala Lys 100 105 110 Glu Thr
Gly Asn Phe Pro Ile Thr Asn Pro Tyr Ile Asp Thr Leu Asp 115 120 125
Leu Ser Glu Glu Ile Phe Gly Arg Pro His Ser Leu Lys Trp Leu Ser 130
135 140 Glu Arg Leu Gly Ile Lys Thr Thr Ile Arg His Arg Ala Leu Pro
Asp 145 150 155 160 Ala Leu Val Thr Ala Arg Val Phe Val Lys Leu Val
Glu Phe Leu Gly 165 170 175 Glu Asn Arg Val Asn Glu Phe Ile Arg Gly
Lys Arg Gly 180 185 141 1434 DNA Thermatoga maritima 141 gtggaagttc
tttacaggaa gtacaggcca aagacttttt ctgaggttgt caatcaggat 60
catgtgaaga aggcaataat cggtgctatt cagaagaaca gcgtggccca cggatacata
120 ttcgccggtc cgaggggaac ggggaagact actcttgcca gaattctcgc
aaaatccctg 180 aactgtgaga acagaaaggg agttgaaccc tgcaattcct
gcagagcctg cagagagata 240 gacgagggaa ccttcatgga cgtgatagag
ctcgacgcgg cctccaacag aggaatagac 300 gagatcagaa gaatcagaga
cgccgttgga tacaggccga tggaaggtaa atacaaagtc 360 tacataatag
acgaagttca catgctcacg aaagaagcct tcaacgcgct cctcaaaaca 420
ctcgaagaac ctccttccca cgtcgtgttc gtgctggcaa cgacaaacct tgagaaggtt
480 cctcccacga ttatctcgag atgtcaggtt ttcgagttca gaaacattcc
cgacgagctc 540 atcgaaaaga ggctccagga agttgcggag gctgaaggaa
tagagataga cagggaagct 600 ctgagcttca tcgcaaaaag agcctctgga
ggcttgagag acgcgctcac catgctcgag 660 caggtgtgga agttctcgga
aggaaagata gatctcgaga cggtacacag ggcgctcggg 720 ttgataccga
tacaggttgt tcgcgattac gtgaacgcta tcttttctgg tgatgtgaaa 780
agggtcttca ccgttctcga cgacgtctat tacagcggga aggactacga ggtgctcatt
840 caggaagcag tcgaggatct ggtcgaagac ctggaaaggg agagaggggt
ttaccaggtt 900 tcagcgaacg atatagttca ggtttcgaga caacttctga
atcttctgag agagataaag 960 ttcgccgaag aaaaacgact cgtctgtaaa
gtgggttcgg cttacatagc gacgaggttc 1020 tccaccacaa acgttcagga
aaacgatgtc agagaaaaaa acgataattc aaatgtacag 1080 cagaaagaag
agaagaaaga aacggtgaag gcaaaagaag aaaaacagga agacagcgag 1140
ttcgagaaac gcttcaaaga actcatggaa gaactgaaag aaaagggcga tctctctatc
1200 tttgtcgctc tcagcctctc agaggtgcag tttgacggag aaaaggtgat
tatttctttt 1260 gattcatcga aagctatgca ttacgagttg atgaagaaaa
aactgcctga gctggaaaac 1320 attttttcta gaaaactcgg gaaaaaagta
gaagttgaac ttcgactgat gggaaaagaa 1380 gaaacaatcg agaaggtttc
tcagaagatc ctgagattgt ttgaacagga ggga 1434 142 478 PRT Thermatoga
maritima 142 Met Glu Val Leu Tyr Arg Lys Tyr Arg Pro Lys Thr Phe
Ser Glu Val 1 5 10 15 Val Asn Gln Asp His Val Lys Lys Ala Ile Ile
Gly Ala Ile Gln Lys 20 25 30 Asn Ser Val Ala His Gly Tyr Ile Phe
Ala Gly Pro Arg Gly Thr Gly 35 40 45 Lys Thr Thr Leu Ala Arg Ile
Leu Ala Lys Ser Leu Asn Cys Glu Asn 50 55 60 Arg Lys Gly Val Glu
Pro Cys Asn Ser Cys Arg Ala Cys Arg Glu Ile 65 70 75 80 Asp Glu Gly
Thr Phe Met Asp Val Ile Glu Leu Asp Ala Ala Ser Asn 85 90 95 Arg
Gly Ile Asp Glu Ile Arg Arg Ile Arg Asp Ala Val Gly Tyr Arg 100 105
110 Pro Met Glu Gly Lys Tyr Lys Val Tyr Ile Ile Asp Glu Val His Met
115 120 125 Leu Thr Lys Glu Ala Phe Asn Ala Leu Leu Lys Thr Leu Glu
Glu Pro 130 135 140 Pro Ser His Val Val Phe Val Leu Ala Thr Thr Asn
Leu Glu Lys Val 145 150 155 160 Pro Pro Thr Ile Ile Ser Arg Cys Gln
Val Phe Glu Phe Arg Asn Ile 165 170 175 Pro Asp Glu Leu Ile Glu Lys
Arg Leu Gln Glu Val Ala Glu Ala Glu 180 185 190 Gly Ile Glu Ile Asp
Arg Glu Ala Leu Ser Phe Ile Ala Lys Arg Ala 195 200 205 Ser Gly Gly
Leu Arg Asp Ala Leu Thr Met Leu Glu Gln Val Trp Lys 210 215 220 Phe
Ser Glu Gly Lys Ile Asp Leu Glu Thr Val His Arg Ala Leu Gly 225 230
235 240 Leu Ile Pro Ile Gln Val Val Arg Asp Tyr Val Asn Ala Ile Phe
Ser 245 250 255 Gly Asp Val Lys Arg Val Phe Thr Val Leu Asp Asp Val
Tyr Tyr Ser 260 265 270 Gly Lys Asp Tyr Glu Val Leu Ile Gln Glu Ala
Val Glu Asp Leu Val 275 280 285 Glu Asp Leu Glu Arg Glu Arg Gly Val
Tyr Gln Val Ser Ala Asn Asp 290 295 300 Ile Val Gln Val Ser Arg Gln
Leu Leu Asn Leu Leu Arg Glu Ile Lys 305 310 315 320 Phe Ala Glu Glu
Lys Arg Leu Val Cys Lys Val Gly Ser Ala Tyr Ile 325 330 335 Ala Thr
Arg Phe Ser Thr Thr Asn Val Gln Glu Asn Asp Val Arg Glu 340 345 350
Lys Asn Asp Asn Ser Asn Val Gln Gln Lys Glu Glu Lys Lys Glu Thr 355
360 365 Val Lys Ala Lys Glu Glu Lys Gln Glu Asp Ser Glu Phe Glu Lys
Arg 370 375 380 Phe Lys Glu Leu Met Glu Glu Leu Lys Glu Lys Gly Asp
Leu Ser Ile 385 390 395 400 Phe Val Ala Leu Ser Leu Ser Glu Val Gln
Phe Asp Gly Glu Lys Val 405 410 415 Ile Ile Ser Phe Asp Ser Ser Lys
Ala Met His Tyr Glu Leu Met Lys 420 425 430 Lys Lys Leu Pro Glu Leu
Glu Asn Ile Phe Ser Arg Lys Leu Gly Lys 435 440 445 Lys Val Glu Val
Glu Leu Arg Leu Met Gly Lys Glu Glu Thr Ile Glu 450 455 460 Lys Val
Ser Gln Lys Ile Leu Arg Leu Phe Glu Gln Glu Gly 465 470 475 143
1098 DNA Thermatoga maritima 143 atgaaagtaa ccgtcacgac tcttgaattg
aaagacaaaa taaccatcgc ctcaaaagcg 60 ctcgcaaaga aatccgtgaa
acccattctt gctggatttc ttttcgaagt gaaagatgga 120 aatttctaca
tctgcgcgac cgatctcgag accggagtca aagcaaccgt gaatgccgct 180
gaaatctccg gtgaggcacg ttttgtggta ccaggagatg tcattcagaa gatggtcaag
240 gttctcccag atgagataac ggaactttct ttagaggggg atgctcttgt
tataagttct 300 ggaagcaccg ttttcaggat caccaccatg cccgcggacg
aatttccaga gataacgcct 360 gccgagtctg gaataacctt cgaagttgac
acttcgctcc tcgaggaaat ggttgaaaag 420 gtcatcttcg ccgctgccaa
agacgagttc atgcgaaatc tgaatggagt tttctgggaa 480 ctccacaaga
atcttctcag gctggttgca agtgatggtt tcagacttgc acttgctgaa 540
gagcagatag aaaacgagga agaggcgagt ttcttgctct ctttgaagag catgaaagaa
600 gttcaaaacg tgctggacaa cacaacggag ccgactataa cggtgaggta
cgatggaaga 660 agggtttctc tgtcgacaaa tgatgtagaa acggtgatga
gagtggtcga cgctgaattt 720 cccgattaca aaagggtgat ccccgaaact
ttcaaaacga aagtggtggt ttccagaaaa 780 gaactcaggg aatctttgaa
gagggtgatg gtgattgcca gcaagggaag cgagtccgtg 840 aagttcgaaa
tagaagaaaa cgttatgaga cttgtgagca agagcccgga ttatggagaa 900
gtggtcgatg aagttgaagt tcaaaaagaa ggggaagatc tcgtgatcgc tttcaacccg
960 aagttcatcg aggacgtttt gaagcacatt gagactgaag aaatcgaaat
gaacttcgtt 1020 gattctacca gtccatgtca gataaatcca ctcgatattt
ctggatacct ttacatagtg 1080 atgcccatca gactggca 1098 144 366 PRT
Thermatoga maritima 144 Met Lys Val Thr Val Thr Thr Leu Glu Leu Lys
Asp Lys Ile Thr Ile 1 5 10 15 Ala Ser Lys Ala Leu Ala Lys Lys Ser
Val Lys Pro Ile Leu Ala Gly 20 25 30 Phe Leu Phe Glu Val Lys Asp
Gly Asn Phe Tyr Ile Cys Ala Thr Asp 35 40 45 Leu Glu Thr Gly Val
Lys Ala Thr Val Asn Ala Ala Glu Ile Ser Gly 50 55 60 Glu Ala Arg
Phe Val Val Pro Gly Asp Val Ile Gln Lys Met Val Lys 65 70 75 80 Val
Leu Pro Asp Glu Ile Thr Glu Leu Ser Leu Glu Gly Asp Ala Leu 85 90
95 Val Ile Ser Ser Gly Ser Thr Val Phe Arg Ile Thr Thr Met Pro Ala
100 105 110 Asp Glu Phe Pro Glu Ile Thr Pro Ala Glu Ser Gly Ile Thr
Phe Glu 115 120 125 Val Asp Thr Ser Leu Leu Glu Glu Met Val Glu Lys
Val Ile Phe Ala 130 135 140 Ala Ala Lys Asp Glu Phe Met Arg Asn Leu
Asn Gly Val Phe Trp Glu 145 150 155 160 Leu His Lys Asn Leu Leu Arg
Leu Val Ala Ser Asp Gly Phe Arg Leu 165 170 175 Ala Leu Ala Glu Glu
Gln Ile Glu Asn Glu Glu Glu Ala Ser Phe Leu 180 185 190 Leu Ser Leu
Lys Ser Met Lys Glu Val Gln Asn Val Leu Asp Asn Thr 195 200 205 Thr
Glu Pro Thr Ile Thr Val Arg Tyr Asp Gly Arg Arg Val Ser Leu 210 215
220 Ser Thr Asn Asp Val Glu Thr Val Met Arg Val Val Asp Ala Glu Phe
225 230 235 240 Pro Asp Tyr Lys Arg Val Ile Pro Glu Thr Phe Lys Thr
Lys Val Val 245 250 255 Val Ser Arg Lys Glu Leu Arg Glu Ser Leu Lys
Arg Val Met Val Ile 260 265 270 Ala Ser Lys Gly Ser Glu Ser Val Lys
Phe Glu Ile Glu Glu Asn Val 275 280 285 Met Arg Leu Val Ser Lys Ser
Pro Asp Tyr Gly Glu Val Val Asp Glu 290 295 300 Val Glu Val Gln Lys
Glu Gly Glu Asp Leu Val Ile Ala Phe Asn Pro 305 310 315 320 Lys Phe
Ile Glu Asp Val Leu Lys His Ile Glu Thr Glu Glu Ile Glu 325 330 335
Met Asn Phe Val Asp Ser Thr Ser Pro Cys Gln Ile Asn Pro Leu Asp 340
345 350 Ile Ser Gly Tyr Leu Tyr Ile Val Met Pro Ile Arg Leu Ala 355
360 365 145 972 DNA Thermatoga maritima 145 atgccagtca cgtttctcac
aggtactgca gaaactcaga aggaagaatt gataaagaaa 60 ctcctgaagg
atggtaacgt ggagtacata aggatccatc cggaggatcc cgacaagatc 120
gatttcataa ggtctttact caggacaaag acgatctttt ccaacaagac gatcattgac
180 atcgtcaatt tcgatgagtg gaaagcacag gagcagaagc gtctcgttga
acttttgaaa 240 aacgtaccgg aagacgttca tatcttcatc cgttctcaaa
aaacaggtgg aaagggagta 300 gcgctggagc ttccgaagcc atgggaaacg
gacaagtggc ttgagtggat agaaaagcgc 360 ttcagggaga atggtttgct
catcgataaa gatgcccttc agctgttttt ctccaaggtt 420 ggaacgaacg
acctgatcat agaaagggag attgaaaaac tgaaagctta ttccgaggac 480
agaaagataa cggtagaaga cgtggaagag gtcgttttta cctatcagac tccgggatac
540 gatgattttt gctttgctgt ttccgaagga aaaaggaagc tcgctcactc
tcttctgtcg 600 cagctgtgga aaaccacaga gtccgtggtg attgccactg
tccttgcgaa tcacttcttg 660 gatctcttca aaatcctcgt tcttgtgaca
aagaaaagat actacacctg gcctgatgtg 720
tccagggtgt ccaaagagct gggaattccc gttcctcgtg tggctcgttt cctcggtttc
780 tcctttaaga cctggaaatt caaggtgatg aaccacctcc tctactacga
tgtgaagaag 840 gttagaaaga tactgaggga tctctacgat ctggacagag
ccgtgaaaag cgaagaagat 900 ccaaaaccgt tcttccacga gttcatagaa
gaggtggcac tggatgtata ttctcttcag 960 agagatgaag aa 972 146 324 PRT
Thermatoga maritima 146 Met Pro Val Thr Phe Leu Thr Gly Thr Ala Glu
Thr Gln Lys Glu Glu 1 5 10 15 Leu Ile Lys Lys Leu Leu Lys Asp Gly
Asn Val Glu Tyr Ile Arg Ile 20 25 30 His Pro Glu Asp Pro Asp Lys
Ile Asp Phe Ile Arg Ser Leu Leu Arg 35 40 45 Thr Lys Thr Ile Phe
Ser Asn Lys Thr Ile Ile Asp Ile Val Asn Phe 50 55 60 Asp Glu Trp
Lys Ala Gln Glu Gln Lys Arg Leu Val Glu Leu Leu Lys 65 70 75 80 Asn
Val Pro Glu Asp Val His Ile Phe Ile Arg Ser Gln Lys Thr Gly 85 90
95 Gly Lys Gly Val Ala Leu Glu Leu Pro Lys Pro Trp Glu Thr Asp Lys
100 105 110 Trp Leu Glu Trp Ile Glu Lys Arg Phe Arg Glu Asn Gly Leu
Leu Ile 115 120 125 Asp Lys Asp Ala Leu Gln Leu Phe Phe Ser Lys Val
Gly Thr Asn Asp 130 135 140 Leu Ile Ile Glu Arg Glu Ile Glu Lys Leu
Lys Ala Tyr Ser Glu Asp 145 150 155 160 Arg Lys Ile Thr Val Glu Asp
Val Glu Glu Val Val Phe Thr Tyr Gln 165 170 175 Thr Pro Gly Tyr Asp
Asp Phe Cys Phe Ala Val Ser Glu Gly Lys Arg 180 185 190 Lys Leu Ala
His Ser Leu Leu Ser Gln Leu Trp Lys Thr Thr Glu Ser 195 200 205 Val
Val Ile Ala Thr Val Leu Ala Asn His Phe Leu Asp Leu Phe Lys 210 215
220 Ile Leu Val Leu Val Thr Lys Lys Arg Tyr Tyr Thr Trp Pro Asp Val
225 230 235 240 Ser Arg Val Ser Lys Glu Leu Gly Ile Pro Val Pro Arg
Val Ala Arg 245 250 255 Phe Leu Gly Phe Ser Phe Lys Thr Trp Lys Phe
Lys Val Met Asn His 260 265 270 Leu Leu Tyr Tyr Asp Val Lys Lys Val
Arg Lys Ile Leu Arg Asp Leu 275 280 285 Tyr Asp Leu Asp Arg Ala Val
Lys Ser Glu Glu Asp Pro Lys Pro Phe 290 295 300 Phe His Glu Phe Ile
Glu Glu Val Ala Leu Asp Val Tyr Ser Leu Gln 305 310 315 320 Arg Asp
Glu Glu 147 936 DNA Thermatoga maritima 147 atgaacgatt tgatcagaaa
gtacgctaaa gatcaactgg aaactttgaa aaggatcata 60 gaaaagtctg
aaggaatatc catcctcata aatggagaag atctctcgta tccgagagaa 120
gtatcccttg aacttcccga gtacgtggag aaatttcccc cgaaggcctc ggatgttctg
180 gagatagatc ccgaggggga gaacataggc atagacgaca tcagaacgat
aaaggacttc 240 ctgaactaca gccccgagct ctacacgaga aagtacgtga
tagtccacga ctgtgaaaga 300 atgacccagc aggcggcgaa cgcgtttctg
aaggcccttg aagaaccacc agaatacgct 360 gtgatcgttc tgaacactcg
ccgctggcat tatctactgc cgacgataaa gagccgagtg 420 ttcagagtgg
ttgtgaacgt tccaaaggag ttcagagatc tcgtgaaaga gaaaatagga 480
gatctctggg aggaacttcc acttcttgag agagacttca aaacggctct cgaagcctac
540 aaacttggtg cggaaaaact ttctggattg atggaaagtc tcaaagtttt
ggagacggaa 600 aaactcttga aaaaggtcct ttcaaaaggc ctcgaaggtt
atctcgcatg tagggagctc 660 ctggagagat tttcaaaggt ggaatcgaag
gaattctttg cgctttttga tcaggtgact 720 aacacgataa caggaaaaga
cgcgtttctt ttgatccaga gactgacaag aatcattctc 780 cacgaaaaca
catgggaaag cgttgaagat caaaaaagcg tgtctttcct cgattcaatt 840
ctcagggtga agatagcgaa tctgaacaac aaactcactc tgatgaacat cctcgcgata
900 cacagagaga gaaagagagg tgtcaacgct tggagc 936 148 311 PRT
Thermatoga maritima 148 Met Asn Asp Leu Ile Arg Lys Tyr Ala Lys Asp
Gln Leu Glu Thr Leu 1 5 10 15 Lys Arg Ile Ile Glu Lys Ser Glu Gly
Ile Ser Ile Leu Ile Asn Gly 20 25 30 Glu Asp Leu Ser Tyr Pro Arg
Glu Val Ser Leu Glu Leu Pro Glu Tyr 35 40 45 Val Glu Lys Phe Pro
Pro Lys Ala Ser Asp Val Leu Glu Ile Asp Pro 50 55 60 Glu Gly Glu
Asn Ile Gly Ile Asp Asp Ile Arg Thr Ile Lys Asp Phe 65 70 75 80 Leu
Asn Tyr Ser Pro Glu Leu Tyr Thr Arg Lys Tyr Val Ile Val His 85 90
95 Asp Cys Glu Arg Met Thr Gln Gln Ala Ala Asn Ala Phe Leu Lys Ala
100 105 110 Leu Glu Glu Pro Pro Glu Tyr Ala Val Ile Val Leu Asn Thr
Arg Arg 115 120 125 Trp His Tyr Leu Leu Pro Thr Ile Lys Ser Arg Val
Phe Arg Val Val 130 135 140 Val Asn Val Pro Lys Glu Phe Arg Asp Leu
Val Lys Glu Lys Ile Gly 145 150 155 160 Asp Leu Trp Glu Glu Leu Pro
Leu Leu Glu Arg Asp Phe Lys Thr Ala 165 170 175 Leu Glu Ala Tyr Lys
Leu Gly Ala Glu Lys Leu Ser Gly Leu Met Glu 180 185 190 Ser Leu Lys
Val Leu Glu Thr Glu Lys Leu Leu Lys Lys Val Leu Ser 195 200 205 Lys
Gly Leu Glu Gly Tyr Leu Ala Cys Arg Glu Leu Leu Glu Arg Phe 210 215
220 Ser Lys Val Glu Ser Lys Glu Phe Phe Ala Leu Phe Asp Gln Val Thr
225 230 235 240 Asn Thr Ile Thr Gly Lys Asp Ala Phe Leu Leu Ile Gln
Arg Leu Thr 245 250 255 Arg Ile Ile Leu His Glu Asn Thr Trp Glu Ser
Val Glu Asp Lys Ser 260 265 270 Val Ser Phe Leu Asp Ser Ile Leu Arg
Val Lys Ile Ala Asn Leu Asn 275 280 285 Asn Lys Leu Thr Leu Met Asn
Ile Leu Ala Ile His Arg Glu Arg Lys 290 295 300 Arg Gly Val Asn Ala
Trp Ser 305 310 149 423 DNA Thermatoga maritima 149 atgtctttct
tcaacaagat catactcata ggaagactcg tgagagatcc cgaagagaga 60
tacacgctca gcggaactcc agtcaccacc ttcaccatag cggtggacag ggttcccaga
120 aagaacgcgc cggacgacgc tcaaacgact gatttcttca ggatcgtcac
ctttggaaga 180 ctggcagagt tcgctagaac ctatctcacc aaaggaaggc
tcgttctcgt cgaaggtgaa 240 atgagaatga gaagatggga aacacccact
ggagaaaaga gggtatctcc ggaggttgtc 300 gcaaacgttg ttagattcat
ggacagaaaa cctgctgaaa cagttagcga gactgaagag 360 gagctggaaa
taccggaaga agacttttcc agcgatacct tcagtgaaga tgaaccacca 420 ttt 423
150 141 PRT Thermatoga maritima 150 Met Ser Phe Phe Asn Lys Ile Ile
Leu Ile Gly Arg Leu Val Arg Asp 1 5 10 15 Pro Glu Glu Arg Tyr Thr
Leu Ser Gly Thr Pro Val Thr Thr Phe Thr 20 25 30 Ile Ala Val Asp
Arg Val Pro Arg Lys Asn Ala Pro Asp Asp Ala Gln 35 40 45 Thr Thr
Asp Phe Phe Arg Ile Val Thr Phe Gly Arg Leu Ala Glu Phe 50 55 60
Ala Arg Thr Tyr Leu Thr Lys Gly Arg Leu Val Leu Val Glu Gly Glu 65
70 75 80 Met Arg Met Arg Arg Trp Glu Thr Pro Thr Gly Glu Lys Arg
Val Ser 85 90 95 Pro Glu Val Val Ala Asn Val Val Arg Phe Met Asp
Arg Lys Pro Ala 100 105 110 Glu Thr Val Ser Glu Thr Glu Glu Glu Leu
Glu Ile Pro Glu Glu Asp 115 120 125 Phe Ser Ser Asp Thr Phe Ser Glu
Asp Glu Pro Pro Phe 130 135 140 151 1353 DNA Thermatoga maritima
151 atgcgtgttc ccccgcacaa cttagaggcc gaagttgctg tgctcggaag
catattgata 60 gatccgtcgg taataaacga cgttcttgaa attttgagcc
acgaagattt ctatctgaaa 120 aaacaccaac acatcttcag agcgatggaa
gagctttacg acgaaggaaa accggtggac 180 gtggtttccg tctgtgacaa
gcttcaaagc atgggaaaac tcgaggaagt aggtggagat 240 ctggaagtgg
cccagctcgc tgaggctgtg cccagttctg cacacgcact tcactacgcg 300
gagatcgtca aggaaaaatc cattctgagg aaactcattg agatctccag aaaaatctca
360 gaaagtgcct acatggaaga agatgtggag atcctgctcg acaacgcaga
aaagatgatc 420 ttcgagatct cagagatgaa aacgacaaaa tcctacgatc
atctgagagg catcatgcac 480 cgggtgtttg aaaacctgga gaacttcagg
gaaagagcca accttataga acccggtgtg 540 ctcataacgg gactaccaac
gggattcaaa agtctggaca aacagaccac agggttccac 600 agctccgatc
tggtgataat agcagcgaga ccctccatgg gaaaaacctc cttcgcactc 660
tcaatagcga ggaacatggc tgtcaatttc gaaatccccg tcggaatatt cagtctcgag
720 atgtccaagg aacagctcgc tcaaagacta ctcagcatgg agtccggtgt
ggatctttac 780 agcatcagaa caggatacct ggatcaggag aagtgggaaa
gactcacaat agcggcttct 840 aaactctaca aagcacccat agttgtggac
gatgagtcac tcctcgatcc gcgatcgttg 900 agggcaaaag cgagaaggat
gaaaaaagaa tacgatgtaa aagccatttt tgtcgactat 960 ctccagctca
tgcacctgaa aggaagaaaa gaaagcagac agcaggagat atccgagatc 1020
tcgagatctc tgaagctcct tgcgagggaa ctcgacatag tggtgatagc gctttcacag
1080 ctttcgaggg ccgtagaaca gagagaagac aaaagaccga ggctgagtga
cctcagggaa 1140 tccggtgcga tagaacagga cgcagacaca gtcatcttca
tctacaggga ggaatattac 1200 aggagcaaaa aatccaaaga ggaaagcaag
cttcacgaac ctcacgaagc tgaaatcata 1260 ataggtaaac agagaaacgg
tcccgttgga acgatcactc tgatcttcga ccccagaacg 1320 gttacgttcc
atgaagtcga tgtggtgcat tca 1353 152 451 PRT Thermatoga maritima 152
Met Arg Val Pro Pro His Asn Leu Glu Ala Glu Val Ala Val Leu Gly 1 5
10 15 Ser Ile Leu Ile Asp Pro Ser Val Ile Asn Asp Val Leu Glu Ile
Leu 20 25 30 Ser His Glu Asp Phe Tyr Leu Lys Lys His Gln His Ile
Phe Arg Ala 35 40 45 Met Glu Glu Leu Tyr Asp Glu Gly Lys Pro Val
Asp Val Val Ser Val 50 55 60 Cys Asp Lys Leu Gln Ser Met Gly Lys
Leu Glu Glu Val Gly Gly Asp 65 70 75 80 Leu Glu Val Ala Gln Leu Ala
Glu Ala Val Pro Ser Ser Ala His Ala 85 90 95 Leu His Tyr Ala Glu
Ile Val Lys Glu Lys Ser Ile Leu Arg Lys Leu 100 105 110 Ile Glu Ile
Ser Arg Lys Ile Ser Glu Ser Ala Tyr Met Glu Glu Asp 115 120 125 Val
Glu Ile Leu Leu Asp Asn Ala Glu Lys Met Ile Phe Glu Ile Ser 130 135
140 Glu Met Lys Thr Thr Lys Ser Tyr Asp His Leu Arg Gly Ile Met His
145 150 155 160 Arg Val Phe Glu Asn Leu Glu Asn Phe Arg Glu Arg Ala
Asn Leu Ile 165 170 175 Glu Pro Gly Val Leu Ile Thr Gly Leu Pro Thr
Gly Phe Lys Ser Leu 180 185 190 Asp Lys Gln Thr Thr Gly Phe His Ser
Ser Asp Leu Val Ile Ile Ala 195 200 205 Ala Arg Pro Ser Met Gly Lys
Thr Ser Phe Ala Leu Ser Ile Ala Arg 210 215 220 Asn Met Ala Val Asn
Phe Glu Ile Pro Val Gly Ile Phe Ser Leu Glu 225 230 235 240 Met Ser
Lys Glu Gln Leu Ala Gln Arg Leu Leu Ser Met Glu Ser Gly 245 250 255
Val Asp Leu Tyr Ser Ile Arg Thr Gly Tyr Leu Asp Gln Glu Lys Trp 260
265 270 Glu Arg Leu Thr Ile Ala Ala Ser Lys Leu Tyr Lys Ala Pro Ile
Val 275 280 285 Val Asp Asp Glu Ser Leu Leu Asp Pro Arg Ser Leu Arg
Ala Lys Ala 290 295 300 Arg Arg Met Lys Lys Glu Tyr Asp Val Lys Ala
Ile Phe Val Asp Tyr 305 310 315 320 Leu Gln Leu Met His Leu Lys Gly
Arg Lys Glu Ser Arg Gln Gln Glu 325 330 335 Ile Ser Glu Ile Ser Arg
Ser Leu Lys Leu Leu Ala Arg Glu Leu Asp 340 345 350 Ile Val Val Ile
Ala Leu Ser Gln Leu Ser Arg Ala Val Glu Gln Arg 355 360 365 Glu Asp
Lys Arg Pro Arg Leu Ser Asp Leu Arg Glu Ser Gly Ala Ile 370 375 380
Glu Gln Asp Ala Asp Thr Val Ile Phe Ile Tyr Arg Glu Glu Tyr Tyr 385
390 395 400 Arg Ser Lys Lys Ser Lys Glu Glu Ser Lys Leu His Glu Pro
His Glu 405 410 415 Ala Glu Ile Ile Ile Gly Lys Gln Arg Asn Gly Pro
Val Gly Thr Ile 420 425 430 Thr Leu Ile Phe Asp Pro Arg Thr Val Thr
Phe His Glu Val Asp Val 435 440 445 Val His Ser 450 153 1695 DNA
Thermatoga maritima 153 gtgattcctc gagaggtcat cgaggaaata aaagaaaagg
ttgacatcgt agaggtcatt 60 tccgagtacg tgaatcttac ccgggtaggt
tcctcctaca gggctctctg tccctttcat 120 tcagaaacca atccttcttt
ctacgttcat ccgggtttga agatatacca ttgtttcggc 180 tgcggtgcga
gtggagacgt catcaaattt cttcaagaaa tggaagggat cagtttccag 240
gaagcgctgg aaagacttgc caaaagagct gggattgatc tttctctcta cagaacagaa
300 gggacttctg aatacggaaa atacattcgt ttgtacgaag aaacgtggaa
aaggtacgtc 360 aaagagctgg agaaatcgaa agaggcaaaa gactatttaa
aaagcagagg cttctctgaa 420 gaagatatag caaagttcgg ctttgggtac
gtccccaaga gatccagcat ctctatagaa 480 gttgcagaag gcatgaacat
aacactggaa gaacttgtca gatacggtat cgcgctgaaa 540 aagggtgatc
gattcgttga tagattcgaa ggaagaatcg ttgttccaat aaagaacgac 600
agtggtcata ttgtggcttt tggtgggcgt gctctcggca acgaagaacc gaagtatttg
660 aactctccag agaccaggta tttttcgaag aagaagaccc tttttctctt
cgatgaggcg 720 aaaaaagtgg caaaagaggt tggttttttc gtcatcaccg
aaggctactt cgacgcgctc 780 gcattcagaa aggatggaat accaacggcg
gtcgctgttc ttggggcgag tctttcaaga 840 gaggcgattc taaaactttc
ggcgtattcg aaaaacgtca tactgtgttt cgataatgac 900 aaagcaggct
tcagagccac tctcaaatcc ctcgaggatc tcctagacta cgaattcaac 960
gtgcttgtgg caaccccctc tccttacaaa gacccagatg aactctttca gaaagaagga
1020 gaaggttcat tgaaaaagat gctgaaaaac tcgcgttcgt tcgaatattt
tctggtgacg 1080 gctggtgagg tcttctttga caggaacagc cccgcgggtg
tgagatccta cctttctttc 1140 ctcaaaggtt gggtccaaaa gatgagaagg
aaaggatatt tgaaacacat agaaaatctc 1200 gtgaatgagg tttcatcttc
tctccagata ccagaaaacc agattttgaa cttttttgaa 1260 agcgacaggt
ctaacactat gcctgttcat gagaccaagt cgtcaaaggt ttacgatgag 1320
gggagaggac tggcttattt gtttttgaac tacgaggatt tgagggaaaa gattctggaa
1380 ctggacttag aggtactgga agataaaaac gcgagggagt ttttcaagag
agtctcactg 1440 ggagaagatt tgaacaaagt catagaaaac ttcccaaaag
agctgaaaga ctggattttt 1500 gagacaatag aaagcattcc tcctccaaag
gatcccgaga aattcctcgg tgacctctcc 1560 gaaaagttga aaatccgacg
gatagagaga cgtatcgcag aaatagatga tatgataaag 1620 aaagcttcaa
acgatgaaga aaggcgtctt cttctctcta tgaaagtgga tctcctcaga 1680
aaaataaaga ggagg 1695 154 565 PRT Thermatoga maritima 154 Met Ile
Pro Arg Glu Val Ile Glu Glu Ile Lys Glu Lys Val Asp Ile 1 5 10 15
Val Glu Val Ile Ser Glu Tyr Val Asn Leu Thr Arg Val Gly Ser Ser 20
25 30 Tyr Arg Ala Leu Cys Pro Phe His Ser Glu Thr Asn Pro Ser Phe
Tyr 35 40 45 Val His Pro Gly Leu Lys Ile Tyr His Cys Phe Gly Cys
Gly Ala Ser 50 55 60 Gly Asp Val Ile Lys Phe Leu Gln Glu Met Glu
Gly Ile Ser Phe Gln 65 70 75 80 Glu Ala Leu Glu Arg Leu Ala Lys Arg
Ala Gly Ile Asp Leu Ser Leu 85 90 95 Tyr Arg Thr Glu Gly Thr Ser
Glu Tyr Gly Lys Tyr Ile Arg Leu Tyr 100 105 110 Glu Glu Thr Trp Lys
Arg Tyr Val Lys Glu Leu Glu Lys Ser Lys Glu 115 120 125 Ala Lys Asp
Tyr Leu Lys Ser Arg Gly Phe Ser Glu Glu Asp Ile Ala 130 135 140 Lys
Phe Gly Phe Gly Tyr Val Pro Lys Arg Ser Ser Ile Ser Ile Glu 145 150
155 160 Val Ala Glu Gly Met Asn Ile Thr Leu Glu Glu Leu Val Arg Tyr
Gly 165 170 175 Ile Ala Leu Lys Lys Gly Asp Arg Phe Val Asp Arg Phe
Glu Gly Arg 180 185 190 Ile Val Val Pro Ile Lys Asn Asp Ser Gly His
Ile Val Ala Phe Gly 195 200 205 Gly Arg Ala Leu Gly Asn Glu Glu Pro
Lys Tyr Leu Asn Ser Pro Glu 210 215 220 Thr Arg Tyr Phe Ser Lys Lys
Lys Thr Leu Phe Leu Phe Asp Glu Ala 225 230 235 240 Lys Lys Val Ala
Lys Glu Val Gly Phe Phe Val Ile Thr Glu Gly Tyr 245 250 255 Phe Asp
Ala Leu Ala Phe Arg Lys Asp Gly Ile Pro Thr Ala Val Ala 260 265 270
Val Leu Gly Ala Ser Leu Ser Arg Glu Ala Ile Leu Lys Leu Ser Ala 275
280 285 Tyr Ser Lys Asn Val Ile Leu Cys Phe Asp Asn Asp Lys Ala Gly
Phe 290 295 300 Arg Ala Thr Leu Lys Ser Leu Glu Asp Leu Leu Asp Tyr
Glu Phe Asn 305 310 315 320 Val Leu Val Ala Thr Pro Ser Pro Tyr Lys
Asp Pro Asp Glu Leu Phe 325 330 335 Gln Lys Glu Gly Glu Gly Ser Leu
Lys Lys Met Leu Lys Asn Ser Arg 340 345 350 Ser Phe Glu Tyr Phe Leu
Val Thr Ala Gly Glu Val Phe Phe Asp Arg 355 360 365 Asn Ser Pro Ala
Gly Val Arg Ser Tyr Leu Ser Phe Leu Lys Gly Trp 370 375 380 Val Gln
Lys Met Arg Arg Lys Gly Tyr Leu Lys His
Ile Glu Asn Leu 385 390 395 400 Val Asn Glu Val Ser Ser Ser Leu Gln
Ile Pro Glu Asn Gln Ile Leu 405 410 415 Asn Phe Phe Glu Ser Asp Arg
Ser Asn Thr Met Pro Val His Glu Thr 420 425 430 Lys Ser Ser Lys Val
Tyr Asp Glu Gly Arg Gly Leu Ala Tyr Leu Phe 435 440 445 Leu Asn Tyr
Glu Asp Leu Arg Glu Lys Ile Leu Glu Leu Asp Leu Glu 450 455 460 Val
Leu Glu Asp Lys Asn Ala Arg Glu Phe Phe Lys Arg Val Ser Leu 465 470
475 480 Gly Glu Asp Leu Asn Lys Val Ile Glu Asn Phe Pro Lys Glu Leu
Lys 485 490 495 Asp Trp Ile Phe Glu Thr Ile Glu Ser Ile Pro Pro Pro
Lys Asp Pro 500 505 510 Glu Lys Phe Leu Gly Asp Leu Ser Glu Lys Leu
Lys Ile Arg Arg Ile 515 520 525 Glu Arg Arg Ile Ala Glu Ile Asp Asp
Met Ile Lys Lys Ala Ser Asn 530 535 540 Asp Glu Glu Arg Arg Leu Leu
Leu Ser Met Lys Val Asp Leu Leu Arg 545 550 555 560 Lys Ile Lys Arg
Arg 565 155 804 DNA Thermus thermophilus 155 atggctctac acccggctca
ccctggggca ataatcgggc acgaggccgt tctcgccctc 60 cttccccgcc
tcaccgccca gaccctgctc ttctccggcc ccgagggggt ggggcggcgc 120
accgtggccc gctggtacgc ctgggggctc aaccgcggct tccccccgcc ctccctgggg
180 gagcacccgg acgtcctcga ggtggggccc aaggcccggg acctccgggg
ccgggccgag 240 gtgcggctgg aggaggtggc gcccctcttg gagtggtgct
ccagccaccc ccgggagcgg 300 gtgaaggtgg ccatcctgga ctcggcccac
ctcctcaccg aggccgccgc caacgccctc 360 ctcaagctcc tggaggagcc
cccttcctac gcccgcatcg tcctcatcgc cccaagccgc 420 gccaccctcc
tccccaccct ggcctcccgg gccacggagg tggcattcgc ccccgtgccc 480
gaggaggccc tgcgcgccct cacccaggac ccggagctcc tccgctacgc cgccggggcc
540 ccgggccgcc tccttagggc cctccaggac ccggaggggt accgggcccg
catggccagg 600 gcgcaaaggg tcctgaaagc cccgcccctg gagcgcctcg
ctttgcttcg ggagcttttg 660 gccgaggagg agggggtcca cgccctccac
gccgtcctaa agcgcccgga gcacctcctt 720 gccctggagc gggcgcggga
ggccctggag gggtacgtga gccccgagct ggtcctcgcc 780 cggctggcct
tagacttaga gaca 804 156 268 PRT Thermus thermophilus 156 Met Ala
Leu His Pro Ala His Pro Gly Ala Ile Ile Gly His Glu Ala 1 5 10 15
Val Leu Ala Leu Leu Pro Arg Leu Thr Ala Gln Thr Leu Leu Phe Ser 20
25 30 Gly Pro Glu Gly Val Gly Arg Arg Thr Val Ala Arg Trp Tyr Ala
Trp 35 40 45 Gly Leu Asn Arg Gly Phe Pro Pro Pro Ser Leu Gly Glu
His Pro Asp 50 55 60 Val Leu Glu Val Gly Pro Lys Ala Arg Asp Leu
Arg Gly Arg Ala Glu 65 70 75 80 Val Arg Leu Glu Glu Val Ala Pro Leu
Leu Glu Trp Cys Ser Ser His 85 90 95 Pro Arg Glu Arg Val Lys Val
Ala Ile Leu Asp Ser Ala His Leu Leu 100 105 110 Thr Glu Ala Ala Ala
Asn Ala Leu Leu Lys Leu Leu Glu Glu Pro Pro 115 120 125 Ser Tyr Ala
Arg Ile Val Leu Ile Ala Pro Ser Arg Ala Thr Leu Leu 130 135 140 Pro
Thr Leu Ala Ser Arg Ala Thr Glu Val Ala Phe Ala Pro Val Pro 145 150
155 160 Glu Glu Ala Leu Arg Ala Leu Thr Gln Asp Pro Glu Leu Leu Arg
Tyr 165 170 175 Ala Ala Gly Ala Pro Gly Arg Leu Leu Arg Ala Leu Gln
Asp Pro Glu 180 185 190 Gly Tyr Arg Ala Arg Met Ala Arg Ala Gln Arg
Val Leu Lys Ala Pro 195 200 205 Pro Leu Glu Arg Leu Ala Leu Leu Arg
Glu Leu Leu Ala Glu Glu Glu 210 215 220 Gly Val His Ala Leu His Ala
Val Leu Lys Arg Pro Glu His Leu Leu 225 230 235 240 Ala Leu Glu Arg
Ala Arg Glu Ala Leu Glu Gly Tyr Val Ser Pro Glu 245 250 255 Leu Val
Leu Ala Arg Leu Ala Leu Asp Leu Glu Thr 260 265 157 729 DNA Thermus
thermophilus 157 atgctggacc tgagggaggt gggggaggcg gagtggaagg
ccctaaagcc ccttttggaa 60 agcgtgcccg agggcgtccc cgtcctcctc
ctggacccta agccaagccc ctcccgggcg 120 gccttctacc ggaaccggga
aaggcgggac ttccccaccc ccaaggggaa ggacctggtg 180 cggcacctgg
aaaaccgggc caagcgcctg gggctcaggc tcccgggcgg ggtggcccag 240
tacctggcct ccctggaggg ggacctcgag gccctggagc gggagctgga gaagcttgcc
300 ctcctctccc cacccctcac cctggagaag gtggagaagg tggtggccct
gaggcccccc 360 ctcacgggct ttgacctggt gcgctccgtc ctggagaagg
accccaagga ggccctcctg 420 cgcctaggcg gcctcaagga ggagggggag
gagcccctca ggctcctcgg ggccctctcc 480 tggcagttcg ccctcctcgc
ccgggccttc ttcctcctcc gggaaaaccc caggcccaag 540 gaggaggacc
tcgcccgcct cgaggcccac ccctacgccg cccgccgcgc cctggaggcg 600
gcgaagcgcc tcacggaaga ggccctcaag gaggccctgg acgccctcat ggaggcggaa
660 aagagggcca agggggggaa agacccgtgg ctcgccctgg aggcggcggt
cctccgcctc 720 gcccgttga 729 158 292 PRT Thermus thermophilus 158
Met Val Ile Ala Phe Thr Gly Asp Pro Phe Leu Ala Arg Glu Ala Leu 1 5
10 15 Leu Glu Glu Ala Arg Leu Arg Gly Leu Ser Arg Phe Thr Glu Pro
Thr 20 25 30 Pro Glu Ala Leu Ala Gln Ala Leu Ala Pro Gly Leu Phe
Gly Gly Gly 35 40 45 Gly Ala Met Leu Asp Leu Arg Glu Val Gly Glu
Ala Glu Trp Lys Ala 50 55 60 Leu Lys Pro Leu Leu Glu Ser Val Pro
Glu Gly Val Pro Val Leu Leu 65 70 75 80 Leu Asp Pro Lys Pro Ser Pro
Ser Arg Ala Ala Phe Tyr Arg Asn Arg 85 90 95 Glu Arg Arg Asp Phe
Pro Thr Pro Lys Gly Lys Asp Leu Val Arg His 100 105 110 Leu Glu Asn
Arg Ala Lys Arg Leu Gly Leu Arg Leu Pro Gly Gly Val 115 120 125 Ala
Gln Tyr Leu Ala Ser Leu Glu Gly Asp Leu Glu Ala Leu Glu Arg 130 135
140 Glu Leu Glu Lys Leu Ala Leu Leu Ser Pro Pro Leu Thr Leu Glu Lys
145 150 155 160 Val Glu Lys Val Val Ala Leu Arg Pro Pro Leu Thr Gly
Phe Asp Leu 165 170 175 Val Arg Ser Val Leu Glu Lys Asp Pro Lys Glu
Ala Leu Leu Arg Leu 180 185 190 Gly Gly Leu Lys Glu Glu Gly Glu Glu
Pro Leu Arg Leu Leu Gly Ala 195 200 205 Leu Ser Trp Gln Phe Ala Leu
Leu Ala Arg Ala Phe Phe Leu Leu Arg 210 215 220 Glu Asn Pro Arg Pro
Lys Glu Glu Asp Leu Ala Arg Leu Glu Ala His 225 230 235 240 Pro Tyr
Ala Ala Arg Arg Ala Leu Glu Ala Ala Lys Arg Leu Thr Glu 245 250 255
Glu Ala Leu Lys Glu Ala Leu Asp Ala Leu Met Glu Ala Glu Lys Arg 260
265 270 Ala Lys Gly Gly Lys Asp Pro Trp Leu Ala Leu Glu Ala Ala Val
Leu 275 280 285 Arg Leu Ala Arg 290 159 37 DNA Artificial Sequence
Description of Artificial Sequence primer 159 gtgtgtcata tgagtaagga
tttcgtccac cttcacc 37 160 34 DNA Artificial Sequence Description of
Artificial Sequence primer 160 gtgtgtggat ccggggacta ctcggaagta
aggg 34 161 36 DNA Artificial Sequence Description of Artificial
Sequence primer 161 gtgtgtcata tggaaaccac aatattccag ttccag 36 162
39 DNA Artificial Sequence Description of Artificial Sequence
primer 162 gtgtgtggat ccttatccac catgagaagt atttttcac 39 163 41 DNA
Artificial Sequence Description of Artificial Sequence primer 163
gtgtgtcata tggaaaaagt tttttttgga aaaaactcca g 41 164 35 DNA
Artificial Sequence Description of Artificial Sequence primer 164
gtgtgtggat ccttaatccg cctgaacggc taacg 35 165 41 DNA Artificial
Sequence Description of Artificial Sequence primer 165 gtgtgtcata
tgaactacgt tcccttcgcg agaaagtaca g 41 166 36 DNA Artificial
Sequence Description of Artificial Sequence primer 166 gtgtgtggat
ccttaaaaca gcctcgtccc gctgga 36 167 33 DNA Artificial Sequence
Description of Artificial Sequence primer 167 gtgtgtcata tgcgcgttaa
ggtggacagg gag 33 168 35 DNA Artificial Sequence Description of
Artificial Sequence primer 168 tgtgtctcga gtcatggcta caccctcatc
ggcat 35 169 47 DNA Artificial Sequence Description of Artificial
Sequence primer 169 gtgtgtcata tgctcaataa ggtttttata ataggaagac
ttacggg 47 170 39 DNA Artificial Sequence Description of Artificial
Sequence primer 170 gtgtggatcc ttaaaaaggt atttcgtcct cttcatcgg 39
171 807 DNA Thermus thermophilus 171 atggctcgag gcctgaaccg
cgttttcctc atcggcgccc tcgccacccg gccggacatg 60 cgctacaccc
cggcggggct cgccattttg gacctgaccc tcgccggtca ggacctgctt 120
ctttccgata acggggggga accggaggtg tcctggtacc accgggtgag gctcttaggc
180 cgccaggcgg agatgtgggg cgacctcttg gaccaagggc agctcgtctt
cgtggagggc 240 cgcctggagt accgccagtg ggaaagggag ggggagaagc
ggagcgagct ccagatccgg 300 gccgacttcc ggaccccctg gacgaccggg
ggaagaagcg ggcggaggac agccggggcc 360 agcccaggct ccgcgccgcc
ctgaaccagg tcttcctcat gggcaacctg acccgggacc 420 cggaactccg
ctacaccccc cagggcaccg cggtggcccg gctgggcctg gcggtgaacg 480
agcgccgcca gggggcggag gagcgcaccc acttcgtgga ggttcaggcc tggcgcgacc
540 tggcggagtg ggccgccgag ctgaggaagg gcgacggcct tttcgtgatc
ggcaggttgg 600 tgaacgactc ctggaccagc tccagcggcg agcggcgctt
ccagacccgt gtggaggccc 660 tcaggctgga gcgccccacc cgtggacctg
cccaggcctg cccaggccgg cggaacaggt 720 cccgcgaagt ccagacgggt
ggggtggaca ttgacgaagg cttggaagac tttccgccgg 780 aggaggattt
gccgttttga gcacgaa 807 172 266 PRT Thermus thermophilus 172 Met Ala
Arg Gly Leu Asn Arg Val Phe Leu Ile Gly Ala Leu Ala Thr 1 5 10 15
Arg Pro Asp Met Arg Tyr Thr Pro Ala Gly Leu Ala Ile Leu Asp Leu 20
25 30 Thr Leu Ala Gly Gln Asp Leu Leu Leu Ser Asp Asn Gly Gly Glu
Pro 35 40 45 Glu Val Ser Trp Tyr His Arg Val Arg Leu Leu Gly Arg
Gln Ala Glu 50 55 60 Met Trp Gly Asp Leu Leu Asp Gln Gly Gln Leu
Val Phe Val Glu Gly 65 70 75 80 Arg Leu Glu Tyr Arg Gln Trp Glu Arg
Glu Gly Glu Lys Arg Ser Glu 85 90 95 Leu Gln Ile Arg Ala Asp Phe
Leu Asp Pro Leu Asp Asp Arg Gly Lys 100 105 110 Lys Arg Ala Glu Asp
Ser Arg Gly Gln Pro Arg Leu Arg Ala Ala Leu 115 120 125 Asn Gln Val
Phe Leu Met Gly Asn Leu Thr Arg Asp Pro Glu Leu Arg 130 135 140 Tyr
Thr Pro Gln Gly Thr Ala Val Ala Arg Leu Gly Leu Ala Val Asn 145 150
155 160 Glu Arg Arg Gln Gly Ala Glu Glu Arg Thr His Phe Val Glu Val
Gln 165 170 175 Ala Trp Arg Asp Leu Ala Glu Trp Ala Ala Glu Leu Arg
Lys Gly Asp 180 185 190 Gly Leu Phe Val Ile Gly Arg Leu Val Asn Asp
Ser Trp Thr Ser Ser 195 200 205 Ser Gly Glu Arg Arg Phe Gln Thr Arg
Val Glu Ala Leu Arg Leu Glu 210 215 220 Arg Pro Thr Arg Gly Pro Ala
Gln Ala Cys Pro Gly Arg Arg Asn Arg 225 230 235 240 Ser Arg Glu Val
Gln Thr Gly Gly Val Asp Ile Asp Glu Gly Leu Glu 245 250 255 Asp Phe
Pro Pro Glu Glu Asp Leu Pro Phe 260 265 173 992 DNA Bacillus
stearothermophilus 173 aattccgaca tttcaattga atcgtttatt ccgcttgaaa
aagaaggcaa gttgctcgtt 60 gatgtgaaaa gaccggggag catcgtactg
caggcgcgct ttttctctga aatcgtgaaa 120 aaactgccgc aacaaacggt
ggaaatcgaa acggaagaca actttttgac gatcatccgc 180 tcggggcact
cagaattccg cctcaatggg ctaaacgccg acgaatatcc gcgcctgccg 240
caaattgaag aagaaaacgt gtttcaaatc ccggctgatt tattgaaaac cgtgattcgg
300 caaacggtgt tcgccgtttc tacatcggaa acgcgcccaa tcttgacagg
tgtcaactgg 360 aaagttgaac atggcgagct tgtctgcaca gcgaccgaca
gtcatcgctt agccatgcgc 420 aaagtgaaaa ttgagtcgga aaatgaagta
tcatacaacg tcgtcatccc tggaaaaagt 480 cttaatgagc tcagcaaaat
tttggatgac ggcaaccacc cggtggacat cgtcatgaca 540 gccaatcaag
tgctatttaa ggccgagcac cttctcttct tttcccggct gcttgacggc 600
aactatccgg agacggcccg cttgattcca acagaaagca aaacgaccat gatcgtcaat
660 gcaaaagagt ttctgcaggc aatcgaccga gcgtccttgc ttgctcgaga
aggaaggaac 720 aacgttgtga aactgacgac gcttcctgga ggaatgctcg
aaatttcttc gatttctccg 780 agatcgggaa agtgacggag cagctgcaaa
cggagtctct tgaaggggaa gagttgaaca 840 tttcgttcag cgcgaaatat
atgatggacg cgttgcgggc gcttgatgga acagacattt 900 caaatcagct
tcactggggc catgcggccg ttcctgttgc gcccgcttca accgattcga 960
tgcttcagct cattttgccg gtgagaacat at 992 174 334 PRT Bacillus
stearothermophilus 174 Asn Ser Asp Ile Ser Ile Ile Glu Ser Phe Ile
Pro Leu Glu Lys Glu 1 5 10 15 Gly Lys Leu Leu Val Asp Val Lys Arg
Pro Gly Ser Ile Val Leu Gln 20 25 30 Ala Arg Phe Phe Ser Glu Ile
Val Lys Lys Leu Pro Gln Gln Thr Val 35 40 45 Glu Ile Glu Thr Glu
Asp Asn Phe Leu Thr Ile Ile Arg Ser Gly His 50 55 60 Ser Glu Phe
Arg Leu Asn Gly Leu Asn Ala Asp Glu Tyr Pro Arg Leu 65 70 75 80 Pro
Gln Ile Glu Glu Glu Asn Val Phe Gln Ile Pro Ala Asp Leu Leu 85 90
95 Lys Thr Val Ile Arg Gln Thr Val Phe Ala Val Ser Thr Ser Glu Thr
100 105 110 Arg Pro Ile Leu Thr Gly Val Asn Trp Lys Val Glu His Gly
Glu Leu 115 120 125 Val Cys Thr Ala Thr Asp Ser His Arg Leu Ala Met
Arg Lys Val Lys 130 135 140 Ile Ile Glu Ser Glu Asn Glu Val Ser Tyr
Asn Val Val Ile Pro Gly 145 150 155 160 Lys Ser Leu Asn Glu Leu Ser
Lys Ile Ile Leu Asp Asp Gly Asn His 165 170 175 Pro Val Asp Ile Val
Met Thr Ala Asn Gln Val Leu Phe Lys Ala Glu 180 185 190 His Leu Leu
Phe Phe Ser Arg Leu Leu Asp Gly Asn Tyr Pro Glu Thr 195 200 205 Ala
Arg Leu Ile Pro Thr Glu Ser Lys Thr Thr Met Ile Val Asn Ala 210 215
220 Lys Glu Phe Leu Gln Ala Ile Asp Arg Ala Ser Leu Leu Ala Arg Glu
225 230 235 240 Gly Arg Asn Asn Val Val Lys Leu Thr Thr Leu Pro Gly
Gly Met Leu 245 250 255 Glu Ile Ser Ser Ile Ser Pro Glu Ile Gly Lys
Val Thr Glu Gln Leu 260 265 270 Gln Thr Glu Ser Leu Glu Gly Glu Glu
Leu Asn Ile Ser Phe Ser Ala 275 280 285 Lys Tyr Met Met Asp Ala Leu
Arg Ala Leu Asp Gly Thr Asp Ile Gln 290 295 300 Ile Ser Phe Thr Gly
Ala Met Arg Pro Phe Leu Leu Arg Pro Leu His 305 310 315 320 Thr Asp
Ser Met Leu Gln Leu Ile Leu Pro Val Arg Thr Tyr 325 330 175 492 DNA
Bacillus stearothermophilus 175 atgattaacc gcgtcatttt ggtcggcagg
ttaacgagag atccggagtt gcgttacact 60 ccaagcggag tggctgttgc
cacgtttacg ctcgcggtca accgtccgtt tacaaatcag 120 cagggcgagc
gggaaacgga ttttattcaa tgtgtcgttt ggcgccgcca ggcggaaaac 180
gtcgccaact ttttgaaaaa ggggagcttg gctggtgtcg atggccgact gcaaacccgc
240 agctatgaaa atcaagaagg tcggcgtgtg tacgtgacgg aagtggtggc
tgatagcgtc 300 caatttcttg agccgaaagg aacgagcgag cagcgagggg
cgacagcagg cggctactat 360 ggggatccat tcccattcgg gcaagatcag
aaccaccaat atccgaacga aaaagggttt 420 ggccgcatcg atgacgatcc
tttcgccaat gacggccagc cgatcgatat ttctgatgat 480 gatttgccgt tt 492
176 164 PRT Bacillus stearothermophilus 176 Met Ile Asn Arg Val Ile
Leu Val Gly Arg Leu Thr Arg Asp Pro Glu 1 5 10 15 Leu Arg Tyr Thr
Pro Ser Gly Val Ala Val Ala Thr Phe Thr Leu Ala 20 25 30 Val Asn
Arg Pro Phe Thr Asn Gln Ser Tyr Glu Asn Gln Glu Gly Arg 35 40 45
Arg Val Tyr Val Thr Glu Val Val Ala Asp Ser Val Gln Phe Leu Glu 50
55 60 Pro Lys Gly Thr Ser Glu Gln Arg Gly Ala Thr Ala Gly Gly Tyr
Tyr 65 70 75 80 Gln Gly Glu Arg Glu Thr Asp Phe Ile Gln Cys Val Val
Trp Arg Arg 85 90 95 Gln Ala Glu Asn Val Ala Asn Phe Leu Lys Lys
Gly Ser Leu Ala Gly 100 105 110 Val Asp Gly Arg Leu Gln Thr Arg Gly
Asp Pro Phe Pro Phe Gly Gln 115 120 125 Asp Gln Asn His Gln Tyr Pro
Asn Glu Lys Gly Phe Gly Arg Ile Asp 130 135 140 Asp Asp Pro Phe Ala
Asn Asp Gly Gln Pro Ile Asp Ile Ser Asp Asp 145 150
155 160 Asp Leu Pro Phe 177 1044 DNA Bacillus stearothermophilus
177 atgctggaac gcgtatgggg aaacattgaa aaacggcgtt tttctcccct
ttatttatta 60 tacggcaatg agccgttttt attaacggaa acgtatgagc
gattggtgaa cgcagcgctt 120 ggccccgagg agcgggagtg gaacttggct
gtgtacgact gcgaggaaac gccgatcgag 180 gcggcgcttg aggaggccga
gacggtgccg tttttcggcg agcggcgtgt cattctcatc 240 aagcatccat
atttttttac gtctgaaaaa gagaaggaga tcgaacatga tttggcgaag 300
ctggaggcgt acttgaaggc gccgtcgccg ttttcgatcg tcgtcttttt cgcgccgtac
360 gagaagcttg atgagcgaaa aaaaattacg aagctcgcca aagagcaaag
cgaagtcgtc 420 atcgccgccc cgctcgccga agcggagctg cgtgcctggg
tgcggcgccg catcgagagc 480 caaggggcgc aagcaagcga cgaggcgatt
gatgtcctgt tgcggcgggc cgggacgcag 540 ctttccgcct tggcgaatga
aatcgataaa ttggccctgt ttgccggatc gggcggaacc 600 atcgaggcgg
cggcggttga gcggcttgtc gcccgcacgc cggaagaaaa cgtatttgtg 660
cttgtcgagc aagtggcgaa gcgcgacatt ccagcagcgt tgcagacgtt ttatgatctg
720 cttgaaaaca atgaagagcc gatcaaaatt ttggcgttgc tcgccgccca
tttccgcttg 780 ctttcgcaag tgaaatggct tgcctcctta ggctacggac
aggcgcaaat tgctgcggcg 840 ctcaaggtgc acccgttccg cgtcaagctc
gctcttgctc aagcggcccg cttcgctgac 900 ggagagcttg ctgaggcgat
caacgagctc gctgacgccg attacgaagt gaaaagcggg 960 gcggtcgatc
gccggttggc cgttgagctg cttctgatgc gctggggcgc ccgcccggcg 1020
caagcggggc gccacggccg gcgg 1044 178 348 PRT Bacillus
stearothermophilus 178 Met Leu Glu Arg Val Trp Gly Asn Ile Glu Lys
Arg Arg Phe Ser Pro 1 5 10 15 Leu Tyr Leu Leu Tyr Gly Asn Glu Pro
Phe Leu Leu Thr Glu Thr Tyr 20 25 30 Glu Arg Leu Val Asn Ala Ala
Leu Gly Pro Glu Glu Arg Glu Trp Asn 35 40 45 Leu Ala Val Tyr Asp
Cys Glu Glu Thr Pro Ile Glu Ala Ala Leu Glu 50 55 60 Glu Ala Glu
Thr Val Pro Phe Phe Gly Glu Arg Arg Val Ile Leu Ile 65 70 75 80 Lys
His Pro Tyr Phe Phe Thr Ser Glu Lys Glu Lys Glu Ile Glu His 85 90
95 Asp Leu Ala Lys Leu Glu Ala Tyr Leu Lys Ala Pro Ser Pro Phe Ser
100 105 110 Ile Val Val Phe Phe Ala Pro Tyr Glu Lys Leu Asp Glu Arg
Lys Lys 115 120 125 Ile Thr Lys Leu Ala Lys Glu Gln Ser Glu Val Val
Ile Ala Ala Pro 130 135 140 Leu Ala Glu Ala Glu Leu Arg Ala Trp Val
Arg Arg Arg Ile Glu Ser 145 150 155 160 Gln Gly Ala Gln Ala Ser Asp
Glu Ala Ile Asp Val Leu Leu Arg Arg 165 170 175 Ala Gly Thr Gln Leu
Ser Ala Leu Ala Asn Glu Ile Asp Lys Leu Ala 180 185 190 Leu Phe Ala
Gly Ser Gly Gly Thr Ile Glu Ala Ala Ala Val Glu Arg 195 200 205 Leu
Val Ala Arg Thr Pro Glu Glu Asn Val Phe Val Leu Val Glu Gln 210 215
220 Val Ala Lys Arg Asp Ile Pro Ala Ala Leu Gln Thr Phe Tyr Asp Leu
225 230 235 240 Leu Glu Asn Asn Glu Glu Pro Ile Lys Ile Leu Ala Leu
Leu Ala Ala 245 250 255 His Phe Arg Leu Leu Ser Gln Val Lys Trp Leu
Ala Ser Leu Gly Tyr 260 265 270 Gly Gln Ala Gln Ile Ala Ala Ala Leu
Lys Val His Pro Phe Arg Val 275 280 285 Lys Leu Ala Leu Ala Gln Ala
Ala Arg Phe Ala Asp Gly Glu Leu Ala 290 295 300 Glu Ala Ile Asn Glu
Leu Ala Asp Ala Asp Tyr Glu Val Lys Ser Gly 305 310 315 320 Ala Val
Asp Arg Arg Leu Ala Val Glu Leu Leu Leu Met Arg Trp Gly 325 330 335
Ala Arg Pro Ala Gln Ala Gly Arg His Gly Arg Arg 340 345 179 757 DNA
Bacillus stearothermophilus 179 atgcgatggg aacagctagc gaaacgccag
ccggtggtgg cgaaaatgct gcaaagcggc 60 ttggaaaaag ggcggatttc
tcatgcgtac ttgtttgagg ggcagcgggg gacgggcaaa 120 aaagcggcca
gtttgttgtt ggcgaaacgt ttgttttgtc tgtccccaat cggagtttcc 180
ccgtgtctag agtgccgcaa ctgccggcgc atcgactccg gcaaccaccc tgacgtccgg
240 gtgatcggcc cagatggagg atcaatcaaa aaggaacaaa tcgaatggct
gcagcaagag 300 ttctcgaaaa cagcggtcga gtcggataaa aaaatgtaca
tcgttgagca cgccgatcaa 360 atgacgacaa gcgctgccaa cagccttctg
aaatttttgg aagagccgca tccggggacg 420 gtggcggtat tgctgactga
gcaataccac cgcctgctag ggacgatcgt ttcccgctgt 480 caagtgcttt
cgttccggcc gttgccgccg gcagagctcg cccagggact tgtcgaggag 540
cacgtgccgt tgccgttggc gctgttggct gcccatttga caaacagctt cgaggaagca
600 ctggcgcttg ccaaagatag ttggtttgcc gaggcgcgaa cattagtgct
acaatggtat 660 gagatgctgg gcaagccgga gctgcagctt ttgtttttca
tccacgaccg cttgtttccg 720 cattttttgg aaagccatca gcttgacctt ggacttg
757 180 252 PRT Bacillus stearothermophilus 180 Met Arg Trp Glu Gln
Leu Ala Lys Arg Gln Pro Val Val Ala Lys Met 1 5 10 15 Leu Gln Ser
Gly Leu Glu Lys Gly Arg Ile Ser His Ala Tyr Leu Phe 20 25 30 Glu
Gly Gln Arg Gly Thr Gly Lys Lys Ala Ala Ser Leu Leu Leu Ala 35 40
45 Lys Arg Leu Phe Cys Leu Ser Pro Ile Gly Val Ser Pro Cys Leu Glu
50 55 60 Cys Arg Asn Cys Arg Arg Ile Asp Ser Gly Asn His Pro Asp
Val Arg 65 70 75 80 Val Ile Gly Pro Asp Gly Gly Ser Ile Lys Lys Glu
Gln Ile Glu Trp 85 90 95 Leu Gln Gln Glu Phe Ser Lys Thr Ala Val
Glu Ser Asp Lys Lys Met 100 105 110 Tyr Ile Val Glu His Ala Asp Gln
Met Thr Thr Ser Ala Ala Asn Ser 115 120 125 Leu Leu Lys Phe Leu Glu
Glu Pro His Pro Gly Thr Val Ala Val Leu 130 135 140 Leu Thr Glu Gln
Tyr His Arg Leu Leu Gly Thr Ile Val Ser Arg Cys 145 150 155 160 Gln
Val Leu Ser Phe Arg Pro Leu Pro Pro Ala Glu Leu Ala Gln Gly 165 170
175 Leu Val Glu Glu His Val Pro Leu Pro Leu Ala Leu Leu Ala Ala His
180 185 190 Leu Thr Asn Ser Phe Glu Glu Ala Leu Ala Leu Ala Lys Asp
Ser Trp 195 200 205 Phe Ala Glu Ala Arg Thr Leu Val Leu Gln Trp Tyr
Glu Met Leu Gly 210 215 220 Lys Pro Glu Leu Gln Leu Leu Phe Phe Ile
His Asp Arg Leu Phe Pro 225 230 235 240 His Phe Leu Glu Ser His Gln
Leu Asp Leu Gly Leu 245 250 181 1677 DNA Bacillus
stearothermophilus 181 gtggcatacc aagcgttata tcgcgtgttt cggccgcagc
gctttgcgga catggtcggc 60 caagaacacg tgaccaagac gttgcaaagc
gccctgcttc aacataaaat atcgcacgct 120 tacttatttt ccggcccgcg
cggtacagga aaaacgagcg cagcgaaaat tttcgccaag 180 gcggtcaact
gtgaacaggc gccagcggcg gagccatgca atgagtgtcc agcttgcctc 240
ggcattacga atggaacggt tcccgatgtg ctggaaattg acgctgcttc caacaaccgc
300 gtcgatgaaa ttcgtgatat ccgtgagaag gtgaaatttg cgccaacgtc
ggcccgctac 360 aaagtgtata tcatcgacga ggtgcatatg ctgtcgatcg
gtgcgtttaa cgcgctgttg 420 aaaacgttgg aggagccgcc gaaacacgtc
attttcattt tggccacgac cgagccgcac 480 aaaattccgg cgacgatcat
ttcccgctgc caacggttcg attttcgccg catcccgctt 540 caggcgatcg
tttcacggct aaagtacgtc gcaagcgccc aaggtgtcga ggcgtcagat 600
gaggcattgt ccgccatcgc ccgtgctgca gacgggggga tgcgcgatgc gctcagcttg
660 cttgatcaag ccatttcgtt cagcgacggg aaacttcggc tcgacgacgt
gctggcgatg 720 accggggctg catcatttgc cgccttatcg agcttcatcg
aagccatcca ccgcaaagat 780 acagcggcgg ttcttcagca cttggaaacg
atgatggcgc aagggaaaga tccgcatcgt 840 ttggttgaag acttgatttt
gtactatcgc gatttattgc tgtacaaaac cgctccctat 900 gtggagggag
cgattcaaat tgctgtcgtt gacgaagcgt tcacttcact gtcggaaatg 960
attccggttt ccaatttata cgaggccatc gagttgctga acaaaagcca gcaagagatg
1020 aagtggacaa accacccgcg ccttctgttg gaagtggcgc ttgtgaaact
ttgccatcca 1080 tcagccgccg ccccgtcgct gtcggcttcc gagttggaac
cgttgataaa gcggattgaa 1140 acgctggagg cggaattgcg gcgcctgaag
gaacaaccgc ctgcccctcc gtcgaccgcc 1200 gcgccggtga aaaaactgtc
caaaccgatg aaaacggggg gatataaagc cccggttggc 1260 cgcatttacg
agctgttgaa acaggcgacg catgaagatt tagctttggt gaaaggatgc 1320
tgggcggatg tgctcgacac gttgaaacgg cagcataaag tgtcgcacgc tgccttgctg
1380 caagagagcg agccggttgc agcgagcgcc tcagcgtttg tattaaaatt
caaatacgaa 1440 atccactgca aaatggcgac cgatcccaca agttcggtca
aagaaaacgt cgaagcgatt 1500 ttgtttgagc tgacaaaccg ccgctttgaa
atggtagcca ttccggaggg agaatgggga 1560 aaaataagag aagagttcat
ccgcaataag gacgccatgg tggaaaaaag cgaagaagat 1620 ccgttaatcg
ccgaagcgaa gcggctgttt ggcgaagagc tgatcgaaat taaagaa 1677 182 559
PRT Bacillus stearothermophilus 182 Val Ala Tyr Gln Ala Leu Tyr Arg
Val Phe Arg Pro Gln Arg Phe Ala 1 5 10 15 Asp Met Val Gly Gln Glu
His Val Thr Lys Thr Leu Gln Ser Ala Leu 20 25 30 Leu Gln His Lys
Ile Ser His Ala Tyr Leu Phe Ser Gly Pro Arg Gly 35 40 45 Thr Gly
Lys Thr Ser Ala Ala Lys Ile Phe Ala Lys Ala Val Asn Cys 50 55 60
Glu Gln Ala Pro Ala Ala Glu Pro Cys Asn Glu Cys Pro Ala Cys Leu 65
70 75 80 Gly Ile Thr Asn Gly Thr Val Pro Asp Val Leu Glu Ile Asp
Ala Ala 85 90 95 Ser Asn Asn Arg Val Asp Glu Ile Arg Asp Ile Arg
Glu Lys Val Lys 100 105 110 Phe Ala Pro Thr Ser Ala Arg Tyr Lys Val
Tyr Ile Ile Asp Glu Val 115 120 125 His Met Leu Ser Ile Gly Ala Phe
Asn Ala Leu Leu Lys Thr Leu Glu 130 135 140 Glu Pro Pro Lys His Val
Ile Phe Ile Leu Ala Thr Thr Glu Pro His 145 150 155 160 Lys Ile Pro
Ala Thr Ile Ile Ser Arg Cys Gln Arg Phe Asp Phe Arg 165 170 175 Arg
Ile Pro Leu Gln Ala Ile Val Ser Arg Leu Lys Tyr Val Ala Ser 180 185
190 Ala Gln Gly Val Glu Ala Ser Asp Glu Ala Leu Ser Ala Ile Ala Arg
195 200 205 Ala Ala Asp Gly Gly Met Arg Asp Ala Leu Ser Leu Leu Asp
Gln Ala 210 215 220 Ile Ser Phe Ser Asp Gly Lys Leu Arg Leu Asp Asp
Val Leu Ala Met 225 230 235 240 Thr Gly Ala Ala Ser Phe Ala Ala Leu
Ser Ser Phe Ile Glu Ala Ile 245 250 255 His Arg Lys Asp Thr Ala Ala
Val Leu Gln His Leu Glu Thr Met Met 260 265 270 Ala Gln Gly Lys Asp
Pro His Arg Leu Val Glu Asp Leu Ile Leu Tyr 275 280 285 Tyr Arg Asp
Leu Leu Leu Tyr Lys Thr Ala Pro Tyr Val Glu Gly Ala 290 295 300 Ile
Gln Ile Ala Val Val Asp Glu Ala Phe Thr Ser Leu Ser Glu Met 305 310
315 320 Ile Pro Val Ser Asn Leu Tyr Glu Ala Ile Glu Leu Leu Asn Lys
Ser 325 330 335 Gln Gln Glu Met Lys Trp Thr Asn His Pro Arg Leu Leu
Leu Glu Val 340 345 350 Ala Leu Val Lys Leu Cys His Pro Ser Ala Ala
Ala Pro Ser Leu Ser 355 360 365 Ala Ser Glu Leu Glu Pro Leu Ile Lys
Arg Ile Glu Thr Leu Glu Ala 370 375 380 Glu Leu Arg Arg Leu Lys Glu
Gln Pro Pro Ala Pro Pro Ser Thr Ala 385 390 395 400 Ala Pro Val Lys
Lys Leu Ser Lys Pro Met Lys Thr Gly Gly Tyr Lys 405 410 415 Ala Pro
Val Gly Arg Ile Tyr Glu Leu Leu Lys Gln Ala Thr His Glu 420 425 430
Asp Leu Ala Leu Val Lys Gly Cys Trp Ala Asp Val Leu Asp Thr Leu 435
440 445 Lys Arg Gln His Lys Val Ser His Ala Ala Leu Leu Gln Glu Ser
Glu 450 455 460 Pro Val Ala Ala Ser Ala Ser Ala Phe Val Leu Lys Phe
Lys Tyr Glu 465 470 475 480 Ile His Cys Lys Met Ala Thr Asp Pro Thr
Ser Ser Val Lys Glu Asn 485 490 495 Val Glu Ala Ile Leu Phe Glu Leu
Thr Asn Arg Arg Phe Glu Met Val 500 505 510 Ala Ile Pro Glu Gly Glu
Trp Gly Lys Ile Arg Glu Glu Phe Ile Arg 515 520 525 Asn Lys Asp Ala
Met Val Glu Lys Ser Glu Glu Asp Pro Leu Ile Ala 530 535 540 Glu Ala
Lys Arg Leu Phe Gly Glu Glu Leu Ile Glu Ile Lys Glu 545 550 555 183
4301 DNA Bacillus stearothermophilus 183 atggtgacaa aagagcaaaa
agagcggttt ctcatcctgc ttgagcagct gaagatgacg 60 tcggacgaat
ggatgccgca ttttcgtgag gcagccattc gcaaagtcgt gatcgataaa 120
gaggagaaaa gctggcattt ttattttcag ttcgacaacg tgctgccggt tcatgtatac
180 aaaacgtttg ccgatcggct gcagacggcg ttccgccata tcgccgccgt
ccgccatacg 240 atggaggtcg aagcgccgcg cgtaactgag gcggatgtgc
aggcgtattg gccgctttgc 300 cttgccgagc tgcaagaagg catgtcgccg
cttgtcgatt ggctcagccg gcagacgcct 360 gagctgaaag gaaacaagct
gcttgtcgtt gcccgccatg aagcggaagc gctggcgatc 420 aaacggcggt
tcgccaaaaa aatcgctgat gtgtacgctt cgtttgggtt tccccccctt 480
cagcttgacg tcagcgtcga gccgtccaag caagaaatgg aacagttttt ggcgcaaaaa
540 cagcaagagg acgaagagcg agcgcttgct gtactgaccg atttagcgag
ggaagaagaa 600 aaggccgcgt ctgcgccgcc gtccggtccg cttgtcatcg
gctatccgat ccgcgacgag 660 gagccggtgc ggcggcttga aacgatcgtc
gaagaagagc ggcgcgtcgt tgtgcaaggc 720 tatgtatttg acgccgaagt
gagcgaatta aaaagcggcc gcacgctgtt gaccatgaaa 780 atcacagatt
acacgaactc gattttagtc aaaatgttct cgcgcgacaa agaggacgcc 840
gagcttatga gcggcgtcaa aaaaggcatg tgggtgaaag tgcgcggcag cgtgcaaaac
900 gatacgttcg tccgtgattt ggtcatcatc gccaacgatt tgaacgaaat
cgccgcaaac 960 gaacggcaag atacggcgcc ggaaggggaa aagagggtcg
agctccattt gcataccccg 1020 atgagccaaa tggacgcggt cacctcggtg
acaaaactca ttgagcaagc gaaaaaatgg 1080 gggcatccgg cgatcgccgt
caccgaccat gccgttgttc agtcgtttcc ggaggcctac 1140 agcgcggcga
aaaaacacgg catgaaggtc atttacggcc ttgaggcgaa catcgtcgac 1200
gatggcgtgc cgatcgccta caatgagacg caccgccgtc tttcggagga aacgtacgtc
1260 gtctttgacg tcgagacgac gggcctgtcg gctgtgtaca atacgatcat
tgagctggcg 1320 gcggtgaaag tgaaagacgg cgagatcatc gaccgattca
tgtcgtttgc caaccctgga 1380 catccgttgt cggtgacaac gatggagctg
actgggatca ccgatgagat ggtgaaagac 1440 gccccgaagc cggacgaggt
gctagcccgt tttgttgact gggccggcga tgcgacgctt 1500 gttgcccaca
acgccagctt tgacatcggt tttttaaacg cgggcctcgc tcgcatgggg 1560
cgcggcaaaa tcgcgaatcc agtcatcgat acgctcgagc tggcccgttt tttatacccg
1620 gatttgaaaa accatcggct caatacattg tgcaaaaaat ttgacattga
attgacgcag 1680 catcaccgcg ccatctacga cgcggaggcg accgggcatt
tgcttatgcg gctgttgaag 1740 gaagcggaag agcgcggcat actgtttcat
gacgaattaa acagccgcac gcacagcgaa 1800 gcgtcctatc ggcttgcgcg
cccgttccat gtgacgctgt tggcgcaaaa cgagactgga 1860 ttgaaaaatt
tgttcaagct tgtgtcattg tcgcacattc aatattttca ccgtgtgccg 1920
cgcatcccgc gctccgtgct cgtcaagcac cgcgacggcc tgcttgtcgg ctcgggctgc
1980 gacaaaggag agctgtttga caacttgatc caaaaggcgc cggaagaagt
cgaagacatc 2040 gcccgttttt acgattttct tgaagtgcat ccgccggacg
tgtacaagcc gctcatcgag 2100 atggattatg tgaaagacga agagatgatc
aaaaacatca tccgcagcat cgtcgccctt 2160 ggtgagaagc ttgacatccc
ggttgtcgcc actggcaacg tccattactt gaacccagaa 2220 gataaaattt
accggaaaat cttaatccat tcgcaaggcg gggcgaatcc gctcaaccgc 2280
catgaactgc cggatgtata tttccgtacg acgaatgaaa tgcttgactg cttctcgttt
2340 ttagggccgg aaaaagcgaa ggaaatcgtc gttgacaaca cgcaaaaaat
cgcttcgtta 2400 atcggcgatg tcaagccgat caaagatgag ctgtatacgc
cgcgcattga aggggcggac 2460 gaggaaatca gggaaatgag ctaccggcgg
gcgaaggaaa tttacggcga cccgttgccg 2520 aaacttgttg aagagcggct
tgagaaggag ctaaaaagca tcatcggcca tggctttgcc 2580 gtcatttatt
tgatctcgca caagcttgtg aaaaaatcgc tcgatgacgg ctaccttgtc 2640
gggtcgcgcg gatcggtcgg ctcgtcgttt gtcgcgacga tgacggaaat caccgaggtc
2700 aatccgctgc cgccgcatta cgtttgcccg aactgcaagc attcggagtt
ctttaacgac 2760 ggttcagtcg gctcagggtt tgatttgccg gataaaaact
gcccgcgatg tgggacgaaa 2820 tacaagaaag acgggcacga catcccgttt
gagacgtttc tcggctttaa aggcgacaaa 2880 gtgccggata tcgacttgaa
cttttccggc gaataccagc cgcgcgccca caactatacg 2940 aaagtgctgt
ttggcgaaga caacgtctac cgcgccggga cgattggcac ggtcgctgac 3000
aaaacggcgt acggatttgt caaagcgtat gcgagcgacc ataacttaga gctgcgcggc
3060 gcggaaatcg acggctcgcg gctggctgca ccggggtgaa gcggacgacc
gggcagcatc 3120 cgggcggcat catcgtcgtc ccggattata tggaaattta
cgattttacg ccgattcaat 3180 atccggccga tgacacgtcc tctgaatggc
ggacgaccca tttcgacttc cattcgatcc 3240 acgacaattt gttgaagctc
gatattctcg ggcacgacga tccgacggtc attcgcatgc 3300 tgcaagattt
aagcggcatc gatccgaaaa cgatcccgac cgacgacccg gatgtgatgg 3360
gcattttcag cagcaccgag ccgcttggcg ttacgccgga gcaaatcatg tgcaatgtcg
3420 gcacgatcgg cattccggag tttggcacgc gcttcgttcg gcaaatgttg
gaagagacaa 3480 ggccaaaaac gttttccgaa ctcgtgcaaa tttccggctt
gtcgcacggc accgatgtgt 3540 ggctcggcaa cgcgcaagag ctcattcaaa
acggcacgtg tacgttatcg gaagtcatcg 3600 gctgccgcga cgacattatg
gtctatttga tttaccgcgg gctcgagccg tcgctcgctt 3660 ttaaaatcat
ggaatccgtg cgcaaaggaa aaggcttaac gccggagttt gaagcagaaa 3720
tgcgcaaaca tgacgtgccg gagtggtaca tcgattcatg caaaaaaatc aagtacatgt
3780 tcccgaaagc gcacgccgcc gcctacgtgt taatggcggt gcgcatcgcc
tactttaagg 3840 tgcaccatcc gcttttgtat tacgcgtcgt actttacggt
gcgggcggag gactttgacc 3900 ttgacgccat gatcaaagga tcacccgcca
ttcgcaagcg gattgaggaa atcaacgcca 3960 aaggcattca ggcgacggcg
aaagaaaaaa gcttgctcac ggttcttgag gtggccttag 4020 agatgtgcga
gcgcggcttt tcctttaaaa atatcgattt gtaccgctcg caggcgacgg 4080
aattcgtcat tgacggcaat
tctctcattc cgccgttcaa cgccattccg gggcttggga 4140 cgaacgtggc
gcaggcgatc gtgcgcgccc gcgaggaagg cgagtttttg tcgaaggagg 4200
atttgcaaca gcgcggcaaa ttgtcgaaaa cgctgctcga gtatctagaa agccgcggct
4260 gccttgactc gcttccagac cataaccagc tgtcgctgtt t 4301 184 1433
PRT Bacillus stearothermophilus 184 Met Val Thr Lys Glu Gln Lys Glu
Arg Phe Leu Ile Leu Leu Glu Gln 1 5 10 15 Leu Lys Met Thr Ser Asp
Glu Trp Met Pro His Phe Arg Glu Ala Ala 20 25 30 Ile Arg Lys Val
Val Ile Asp Lys Glu Glu Lys Ser Trp His Phe Tyr 35 40 45 Phe Gln
Phe Asp Asn Val Leu Pro Val His Val Tyr Lys Thr Phe Ala 50 55 60
Asp Arg Leu Gln Thr Ala Phe Arg His Ile Ala Ala Val Arg His Thr 65
70 75 80 Met Glu Val Glu Ala Pro Arg Val Thr Glu Ala Asp Val Gln
Ala Tyr 85 90 95 Trp Pro Leu Cys Leu Ala Glu Leu Gln Glu Gly Met
Ser Pro Leu Val 100 105 110 Asp Trp Leu Ser Arg Gln Thr Pro Glu Leu
Lys Gly Asn Lys Leu Leu 115 120 125 Val Val Ala Arg His Glu Ala Glu
Ala Leu Ala Ile Lys Arg Arg Phe 130 135 140 Ala Lys Lys Ile Ala Asp
Val Tyr Ala Ser Phe Gly Phe Pro Pro Leu 145 150 155 160 Gln Leu Asp
Val Ser Val Glu Pro Ser Lys Gln Glu Met Glu Gln Phe 165 170 175 Leu
Ala Gln Lys Gln Gln Glu Asp Glu Glu Arg Ala Leu Ala Val Leu 180 185
190 Thr Asp Leu Ala Arg Glu Glu Glu Lys Ala Ala Ser Ala Pro Pro Ser
195 200 205 Gly Pro Leu Val Ile Gly Tyr Pro Ile Arg Asp Glu Glu Pro
Val Arg 210 215 220 Arg Leu Glu Thr Ile Val Glu Glu Glu Arg Arg Val
Val Val Gln Gly 225 230 235 240 Tyr Val Phe Asp Ala Glu Val Ser Glu
Leu Lys Ser Gly Arg Thr Leu 245 250 255 Leu Thr Met Lys Ile Thr Asp
Tyr Thr Asn Ser Ile Leu Val Lys Met 260 265 270 Phe Ser Arg Asp Lys
Glu Asp Ala Glu Leu Met Ser Gly Val Lys Lys 275 280 285 Gly Met Trp
Val Lys Val Arg Gly Ser Val Gln Asn Asp Thr Phe Val 290 295 300 Arg
Asp Leu Val Ile Ile Ala Asn Asp Leu Asn Glu Ile Ala Ala Asn 305 310
315 320 Glu Arg Gln Asp Thr Ala Pro Glu Gly Glu Lys Arg Val Glu Leu
His 325 330 335 Leu His Thr Pro Met Ser Gln Met Asp Ala Val Thr Ser
Val Thr Lys 340 345 350 Leu Ile Glu Gln Ala Lys Lys Trp Gly His Pro
Ala Ile Ala Val Thr 355 360 365 Asp His Ala Val Val Gln Ser Phe Pro
Glu Ala Tyr Ser Ala Ala Lys 370 375 380 Lys His Gly Met Lys Val Ile
Tyr Gly Leu Glu Ala Asn Ile Val Asp 385 390 395 400 Asp Gly Val Pro
Ile Ala Tyr Asn Glu Thr His Arg Arg Leu Ser Glu 405 410 415 Glu Thr
Tyr Val Val Phe Asp Val Glu Thr Thr Gly Leu Ser Ala Val 420 425 430
Tyr Asn Thr Ile Ile Glu Leu Ala Ala Val Lys Val Lys Asp Gly Glu 435
440 445 Ile Ile Asp Arg Phe Met Ser Phe Ala Asn Pro Gly His Pro Leu
Ser 450 455 460 Val Thr Thr Met Glu Leu Thr Gly Ile Thr Asp Glu Met
Val Lys Asp 465 470 475 480 Ala Pro Lys Pro Asp Glu Val Leu Ala Arg
Phe Val Asp Trp Ala Gly 485 490 495 Asp Ala Thr Leu Val Ala His Asn
Ala Ser Phe Asp Ile Gly Phe Leu 500 505 510 Asn Ala Gly Leu Ala Arg
Met Gly Arg Gly Lys Ile Ala Asn Pro Val 515 520 525 Ile Asp Thr Leu
Glu Leu Ala Arg Phe Leu Tyr Pro Asp Leu Lys Asn 530 535 540 His Arg
Leu Asn Thr Leu Cys Lys Lys Phe Asp Ile Glu Leu Thr Gln 545 550 555
560 His His Arg Ala Ile Tyr Asp Ala Glu Ala Thr Gly His Leu Leu Met
565 570 575 Arg Leu Leu Lys Glu Ala Glu Glu Arg Gly Ile Leu Phe His
Asp Glu 580 585 590 Leu Asn Ser Arg Thr His Ser Glu Ala Ser Tyr Arg
Leu Ala Arg Pro 595 600 605 Phe His Val Thr Leu Leu Ala Gln Asn Glu
Thr Gly Leu Lys Asn Leu 610 615 620 Phe Lys Leu Val Ser Leu Ser His
Ile Gln Tyr Phe His Arg Val Pro 625 630 635 640 Arg Ile Pro Arg Ser
Val Leu Val Lys His Arg Asp Gly Leu Leu Val 645 650 655 Gly Ser Gly
Cys Asp Lys Gly Glu Leu Phe Asp Asn Leu Ile Gln Lys 660 665 670 Ala
Pro Glu Glu Val Glu Asp Ile Ala Arg Phe Tyr Asp Phe Leu Glu 675 680
685 Val His Pro Pro Asp Val Tyr Lys Pro Leu Ile Glu Met Asp Tyr Val
690 695 700 Lys Asp Glu Glu Met Ile Lys Asn Ile Ile Arg Ser Ile Val
Ala Leu 705 710 715 720 Gly Glu Lys Leu Asp Ile Pro Val Val Ala Thr
Gly Asn Val His Tyr 725 730 735 Leu Asn Pro Glu Asp Lys Ile Tyr Arg
Lys Ile Leu Ile His Ser Gln 740 745 750 Gly Gly Ala Asn Pro Leu Asn
Arg His Glu Leu Pro Asp Val Tyr Phe 755 760 765 Arg Thr Thr Asn Glu
Met Leu Asp Cys Phe Ser Phe Leu Gly Pro Glu 770 775 780 Lys Ala Lys
Glu Ile Val Val Asp Asn Thr Gln Lys Ile Ala Ser Leu 785 790 795 800
Ile Gly Asp Val Lys Pro Ile Lys Asp Glu Leu Tyr Thr Pro Arg Ile 805
810 815 Glu Gly Ala Asp Glu Glu Ile Arg Glu Met Ser Tyr Arg Arg Ala
Lys 820 825 830 Glu Ile Tyr Gly Asp Pro Leu Pro Lys Leu Val Glu Glu
Arg Leu Glu 835 840 845 Lys Glu Leu Lys Ser Ile Ile Gly His Gly Phe
Ala Val Ile Tyr Leu 850 855 860 Ile Ser His Lys Leu Val Lys Lys Ser
Leu Asp Asp Gly Tyr Leu Val 865 870 875 880 Gly Ser Arg Gly Ser Val
Gly Ser Ser Phe Val Ala Thr Met Thr Glu 885 890 895 Ile Thr Glu Val
Asn Pro Leu Pro Pro His Tyr Val Cys Pro Asn Cys 900 905 910 Lys His
Ser Glu Phe Phe Asn Asp Gly Ser Val Gly Ser Gly Phe Asp 915 920 925
Leu Pro Asp Lys Asn Cys Pro Arg Cys Gly Thr Lys Tyr Lys Lys Asp 930
935 940 Gly His Asp Ile Pro Phe Glu Thr Phe Leu Gly Phe Lys Gly Asp
Lys 945 950 955 960 Val Pro Asp Ile Asp Leu Asn Phe Ser Gly Glu Tyr
Gln Pro Arg Ala 965 970 975 His Asn Tyr Thr Lys Val Leu Phe Gly Glu
Asp Asn Val Tyr Arg Ala 980 985 990 Gly Thr Ile Gly Thr Val Ala Asp
Lys Thr Ala Tyr Gly Phe Val Lys 995 1000 1005 Ala Tyr Ala Ser Asp
His Asn Leu Glu Leu Arg Gly Ala Glu Ile Asp 1010 1015 1020 Leu Ala
Ala Gly Cys Thr Gly Val Lys Arg Thr Thr Gly Gln His Pro 1025 1030
1035 1040 Gly Gly Ile Ile Val Val Pro Asp Tyr Met Glu Ile Tyr Asp
Phe Thr 1045 1050 1055 Pro Ile Gln Tyr Pro Ala Asp Asp Thr Ser Ser
Glu Trp Arg Thr Thr 1060 1065 1070 His Phe Asp Phe His Ser Ile His
Asp Asn Leu Leu Lys Leu Asp Ile 1075 1080 1085 Leu Gly His Asp Asp
Pro Thr Val Ile Arg Met Leu Gln Asp Leu Ser 1090 1095 1100 Gly Ile
Asp Pro Lys Thr Ile Pro Thr Asp Asp Pro Asp Val Met Gly 1105 1110
1115 1120 Ile Phe Ser Ser Thr Glu Pro Leu Gly Val Thr Pro Glu Gln
Ile Met 1125 1130 1135 Cys Asn Val Gly Thr Ile Gly Ile Pro Glu Phe
Gly Thr Arg Phe Val 1140 1145 1150 Arg Gln Met Leu Glu Glu Thr Arg
Pro Lys Thr Phe Ser Glu Leu Val 1155 1160 1165 Gln Ile Ser Gly Leu
Ser His Gly Thr Asp Val Trp Leu Gly Asn Ala 1170 1175 1180 Gln Glu
Leu Ile Gln Asn Gly Thr Cys Thr Leu Ser Glu Val Ile Gly 1185 1190
1195 1200 Cys Arg Asp Asp Ile Met Val Tyr Leu Ile Tyr Arg Gly Leu
Glu Pro 1205 1210 1215 Ser Leu Ala Phe Lys Ile Met Glu Ser Val Arg
Lys Gly Lys Gly Leu 1220 1225 1230 Thr Pro Glu Phe Glu Ala Glu Met
Arg Lys His Asp Val Pro Glu Trp 1235 1240 1245 Tyr Ile Asp Ser Cys
Lys Lys Ile Lys Tyr Met Phe Pro Lys Ala His 1250 1255 1260 Ala Ala
Ala Tyr Val Leu Met Ala Val Arg Ile Ala Tyr Phe Lys Val 1265 1270
1275 1280 His His Pro Leu Leu Tyr Tyr Ala Ser Tyr Phe Thr Val Arg
Ala Glu 1285 1290 1295 Asp Phe Asp Leu Asp Ala Met Ile Lys Gly Ser
Pro Ala Ile Arg Lys 1300 1305 1310 Arg Ile Glu Glu Ile Asn Ala Lys
Gly Ile Gln Ala Thr Ala Lys Glu 1315 1320 1325 Lys Ser Leu Leu Thr
Val Leu Glu Val Ala Leu Glu Met Cys Glu Arg 1330 1335 1340 Gly Phe
Ser Phe Lys Asn Ile Asp Leu Tyr Arg Ser Gln Ala Thr Glu 1345 1350
1355 1360 Phe Val Ile Asp Gly Asn Ser Leu Ile Pro Pro Phe Asn Ala
Ile Pro 1365 1370 1375 Gly Leu Gly Thr Asn Val Ala Gln Ala Ile Val
Arg Ala Arg Glu Glu 1380 1385 1390 Gly Glu Phe Leu Ser Lys Glu Asp
Leu Gln Gln Arg Gly Lys Leu Ser 1395 1400 1405 Lys Thr Leu Leu Glu
Tyr Leu Glu Ser Arg Gly Cys Leu Asp Ser Leu 1410 1415 1420 Pro Asp
His Asn Gln Leu Ser Leu Phe 1425 1430 185 199 PRT Thermus
thermophilus 185 Thr Pro Lys Gly Lys Asp Leu Val Arg His Leu Glu
Asn Arg Ala Lys 1 5 10 15 Arg Leu Gly Leu Arg Leu Pro Gly Gly Val
Ala Gln Tyr Leu Ala Ser 20 25 30 Leu Glu Gly Asp Leu Glu Ala Leu
Glu Arg Glu Leu Glu Lys Leu Ala 35 40 45 Leu Leu Ser Pro Pro Leu
Thr Leu Glu Lys Val Glu Lys Val Val Ala 50 55 60 Leu Arg Pro Pro
Leu Thr Gly Phe Asp Leu Val Arg Ser Val Leu Glu 65 70 75 80 Lys Asp
Pro Lys Glu Ala Leu Leu Arg Leu Gly Arg Leu Lys Glu Glu 85 90 95
Gly Glu Glu Pro Leu Arg Leu Leu Gly Ala Leu Ser Trp Gln Phe Ala 100
105 110 Leu Leu Ala Arg Ala Phe Phe Leu Leu Arg Glu Met Pro Arg Pro
Lys 115 120 125 Glu Glu Asp Leu Ala Arg Leu Glu Ala His Pro Tyr Ala
Ala Lys Lys 130 135 140 Ala Leu Leu Glu Ala Ala Arg Arg Leu Thr Glu
Glu Ala Leu Lys Glu 145 150 155 160 Ala Leu Asp Ala Leu Met Glu Ala
Glu Lys Arg Ala Lys Gly Gly Lys 165 170 175 Asp Pro Trp Leu Ala Leu
Glu Ala Ala Val Leu Arg Leu Ala Arg Pro 180 185 190 Ala Gly Gln Pro
Arg Val Asp 195 186 27 DNA Artificial Sequence Description of
Artificial Sequence PCR primer 186 gcccagtacc tcgcctccct cgagggg 27
187 27 DNA Artificial Sequence Description of Artificial Sequence
PCR primer 187 ggcccccttg gccttctcgg cctccat 27 188 331 DNA Thermus
thermophilus 188 agactcgagg ccctggagcg ggagctggag aagcttgccc
tcctctcccc acccctcacc 60 ctggagaagg tggagaaggt ggtggccctg
aggccccccc tcacgggctt tgacctggtg 120 cgctccgtcc tggagaagga
ccccaaggag gccctcctgc gcctcaggcg cctcagggag 180 gagggggagg
agcccctcag gctcctcggg gccctctcct ggcagttcgc cctcctcgcc 240
cgggccttct tcctcctccg ggaaaacccc aggcccaagg aggaggacct cgcccgcctc
300 gaggcccacc cctacgccgc caagaaggcc a 331 189 110 PRT Thermus
thermophilus 189 Arg Leu Glu Ala Leu Glu Arg Glu Leu Glu Lys Leu
Ala Leu Leu Ser 1 5 10 15 Pro Pro Leu Thr Leu Glu Lys Val Glu Lys
Val Val Ala Leu Arg Pro 20 25 30 Pro Leu Thr Gly Phe Asp Leu Val
Arg Ser Val Leu Glu Lys Asp Pro 35 40 45 Lys Glu Ala Leu Leu Arg
Leu Arg Arg Leu Arg Glu Glu Gly Glu Glu 50 55 60 Pro Leu Arg Leu
Leu Gly Ala Leu Ser Trp Gln Phe Ala Leu Leu Ala 65 70 75 80 Arg Ala
Phe Phe Leu Leu Arg Glu Asn Pro Arg Pro Lys Glu Glu Asp 85 90 95
Leu Ala Arg Leu Glu Ala His Pro Tyr Ala Ala Lys Lys Ala 100 105 110
190 31 DNA Artificial Sequence Description of Artificial Sequence
PCR primer 190 gtggtgtcta gacatcataa cggttctggc a 31 191 27 DNA
Artificial Sequence Description of Artificial Sequence PCR Primer
191 gagggccacc accttctcca ccttctc 27 192 25 DNA Artificial Sequence
Description of Artificial Sequence PCR Primer 192 ctccgtcctg
gagaaggacc ccaag 25 193 29 DNA Artificial Sequence Description of
Artificial Sequence PCR primer 193 cgcgaattca acgcsctcct caagacsct
29 194 31 DNA Artificial Sequence Description of Artificial
Sequence PCR primer 194 gacacttaac atatggtcat cgccttcacc g 31 195
38 DNA Artificial Sequence Description of Artificial Sequence PCR
primer 195 gtgtgtgaat tcgggtcaac gggcgaggcg gaggaccg 38 196 10 PRT
Deinococcus radiodurans 196 Val Ile Leu Asn Pro Gly Ser Val Gly Gln
1 5 10 197 10 PRT Methanococcus jannaschii 197 Tyr Leu Ile Asn Pro
Gly Ser Val Gly Gln 1 5 10 198 10 PRT Thermotoga maritima 198 Leu
Val Leu Asn Pro Gly Ser Ala Gly Arg 1 5 10 199 28 DNA Artificial
Sequence Description of Artificial Sequence PCR primer 199
ctggtgaacc cgggctccgt gggccagc 28 200 10 PRT Artificial Sequence
Description of Artificial Sequence polypeptide 200 Leu Leu Val Asn
Pro Gly Ser Val Gly Gln 1 5 10 201 27 DNA Artificial Sequence
Description of Artificial Sequence PCR primer 201 ctcgaggagc
ttgaggaggg tgttggc 27 202 9 PRT Artificial Sequence Description of
Artificial Sequence polypeptide 202 Ala Asn Thr Leu Leu Lys Leu Leu
Glu 1 5 203 32 PRT Deinococcus radiodurans 203 Gly Phe Gly Gly Val
Gln Leu His Ala Ala His Gly Tyr Leu Leu Ser 1 5 10 15 Gln Phe Leu
Ser Pro Arg His Asn Val Arg Glu Asp Glu Tyr Gly Gly 20 25 30 204 32
PRT Caenorhabditis elegans 204 Gly Phe Asp Gly Ile Gln Leu His Gly
Ala His Gly Tyr Leu Leu Ser 1 5 10 15 Gln Phe Thr Ser Pro Thr Thr
Asn Lys Arg Val Asp Lys Tyr Gly Gly 20 25 30 205 32 PRT Pseudomonas
aeruginosa 205 Gly Phe Ser Gly Val Glu Ile His Ala Ala His Gly Tyr
Leu Leu Ser 1 5 10 15 Gln Phe Leu Ser Pro Leu Ser Asn Arg Arg Ser
Asp Ala Trp Gly Gly 20 25 30 206 32 PRT Archaeoglobus fulgidus 206
Gly Phe Asp Ala Val Gln Leu His Ala Ala His Gly Tyr Leu Leu Ser 1 5
10 15 Glu Phe Ile Ser Pro His Val Asn Arg Arg Lys Asp Glu Tyr Gly
Gly 20 25 30 207 30 DNA Artificial Sequence Description of
Artificial Sequence PCR primer 207 catcctggac tcggcccacc tcctcaccga
30 208 9 PRT Artificial Sequence Description of Artificial Sequence
polypeptide 208 Ile Leu Asp Ser Ala His Leu Leu Thr 1 5 209 33 DNA
Artificial Sequence Description of Artificial Sequence PCR primer
209 gaggaggtag ccgtgggccg cgtggagctc cac 33 210 11 PRT Artificial
Sequence Description of Artificial Sequence polypeptide 210 Val Glu
Leu His Ala Ala His Gly Tyr Leu Leu 1 5 10 211 32 DNA Artificial
Sequence Description of Artificial Sequence PCR primer 211
ggctttccca tatggctcta cacccggctc ac 32 212 29 DNA Artificial
Sequence Description of Artificial Sequence PCR primer 212
gcgtggatcc acggtcatgt ctctaagtc 29
* * * * *
References