U.S. patent application number 10/772230 was filed with the patent office on 2005-03-17 for discordant helix stabilization for prevention of amyloid formation.
This patent application is currently assigned to AlphaBeta AB, a Swedish corporation. Invention is credited to Johansson, Jan.
Application Number | 20050059084 10/772230 |
Document ID | / |
Family ID | 26941745 |
Filed Date | 2005-03-17 |
United States Patent
Application |
20050059084 |
Kind Code |
A1 |
Johansson, Jan |
March 17, 2005 |
Discordant helix stabilization for prevention of amyloid
formation
Abstract
The invention is based on the discovery that the presence of a
discordant helix in a protein or peptide is predictive of that
protein or peptide's ability to form amyloid. The invention
includes methods for detecting discordant helices and methods of
screening for compounds that stabilize the .alpha.-helix of a
discordant helix-containing polypeptide. Compounds discovered using
these methods are useful for treating or preventing disorders in
which amyloid is produced. Such disorders include Alzheimer's
disease and prion-associated disorders.
Inventors: |
Johansson, Jan; (Stockholm,
SE) |
Correspondence
Address: |
WILMER CUTLER PICKERING HALE AND DORR LLP
60 STATE STREET
BOSTON
MA
02109
US
|
Assignee: |
AlphaBeta AB, a Swedish
corporation
|
Family ID: |
26941745 |
Appl. No.: |
10/772230 |
Filed: |
February 4, 2004 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
10772230 |
Feb 4, 2004 |
|
|
|
09988842 |
Nov 19, 2001 |
|
|
|
6716589 |
|
|
|
|
60253695 |
Nov 20, 2000 |
|
|
|
60251662 |
Dec 6, 2000 |
|
|
|
Current U.S.
Class: |
435/7.1 |
Current CPC
Class: |
G01N 2500/04 20130101;
G01N 33/6896 20130101; A61P 25/28 20180101; G01N 2800/2828
20130101; G01N 2800/2821 20130101; C07K 1/1136 20130101 |
Class at
Publication: |
435/007.1 |
International
Class: |
G01N 033/53 |
Claims
1-4. (Canceled).
5. A method of identifying whether a protein is susceptible to
forming amyloid, the method comprising analyzing the amino acid
sequence of the protein to determine whether the protein contains a
predicted discordant helix, wherein the presence of predicted
discordant helix is an indication that the protein is susceptible
to forming amyloid.
6. The method of claim 5, wherein the discordant helix is at least
six amino acids in length.
7. A method of decreasing the rate of formation of .beta.-strand
structures between at least two discordant helix-containing
polypeptides, the method comprising contacting the discordant
helix-containing polypeptides with a compound that stabilizes an
.alpha.-helical form of the discordant helix.
8. A method of treating an individual having or at risk for an
amyloidosis, the method comprising administering to the individual
a therapeutically effective amount of a compound that stabilizes an
.alpha.-helical form of a discordant helix-containing polypeptide
that forms amyloid.
9. The method of claim 8, wherein the amyloidosis is selected from
the group consisting of prion diseases and Alzheimer's disease.
Description
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application is claims priority from U.S. Provisional
Application Ser. No. 60/253,695, filed on Nov. 20, 2000, and U.S.
Provisional Application Ser. No. 60/251,662, filed on Dec. 6, 2000.
These applications are incorporated herein by reference in their
entirety.
TECHNICAL FIELD
[0002] This invention relates to protein structure, and more
particularly to proteins involved in amyloidogenic disorders.
BACKGROUND
[0003] Alzheimer's disease and spongiform encephalopathies are
examples of conditions in which specific proteins transform from
their native states into bundles of ordered fibrils termed amyloid.
Protein concentration, point mutations, and solvent composition
influence fibril formation, but a structural feature unique to
amyloid-forming protein has not been detected.
[0004] Amyloid fibrils can be formed from different proteins. They
are associated with neurodegenerative disorders such as Alzheimer's
disease and the prion diseases (e.g., Creutzfeld-Jakob disease in
humans, scrapie in sheep, and bovine spongiform encephelopathy), as
well as other organ-specific and systemic amyloidoses (The Merck
Manual, 16th ed., Merck Research Laboratories, Rahway, N.J., 1992,
pp. 1052-1053; Kelly, 1996, Curr. Op. Struct. Biol. 6:11-17). The
proteins involved in forming amyloid are constitutively present in
a soluble state, but form insoluble aggregates under certain
conditions (Chiti et al., 1999, Proc. Natl. Acad. Sci. USA
96:3590-3594). There are no obvious common properties in amino acid
sequence, three dimensional structure, or function among the
approximately 20 proteins that are known to be specifically
associated with amyloid diseases (Sipe, 1992, Annu. Rev. Biochem.
61:947-975). In spite of the differences in native structures, the
amyloid fibrils are similar, irrespective of the protein from which
they originate (Dobson, 1999, TIBS 24:329-332). Amyloid fibrils are
built up from a cross-.beta.-scaffold, with .beta.-strands
perpendicular and .beta.-sheets parallel to the fiber axis.
[0005] Amyloid diseases mostly occur without known precipitating
factors (Lansbury, 1999, Proc. Natl. Acad. Sci. USA 96:3342-3344).
Destabilizing point mutations can cause fibril formation of an
otherwise stable protein, e.g., in lysozyme (Booth et al., 1997,
Nature 385:787-793), but point mutations related to inherited forms
of human prion diseases do not induce PrPSc (the disease-associated
form of a prion) in vitro and are not generally destabilizing
(Liemann et al., 1999, Biochemistry 38:3258-3267). The so-called
A.beta. (e.g., 1-42 residue) peptide associated with Alzheimer's
disease is highly fibrillogenic, while peptides lacking residues
14-23 are not (Tjernberg et al., 1999, J. Biol. Chem.
274:12619-12625).
SUMMARY
[0006] The invention relates to the discovery that a polypeptide
containing an amino acid sequence that is predicted to be able to
undergo a conversion from .alpha.-helix to .beta.-strand can form
fibrils. An amino acid sequence that is present as a helix in a
polypeptide but is predicted to form a .beta.-strand structure is
herein termed a discordant helix. Compounds that stabilize the
.alpha.-helical form of a discordant helix are useful for treating
disorders in which .beta.-strand structures form fibrils. Such
disorders include amyloidoses such as prion diseases and
Alzheimer's disease. The invention includes methods of identifying
discordant helixes, methods of identifying compounds that can
stabilize the .alpha.-helical form of a discordant helix, and
compounds identified by these methods. The invention also includes
methods of treating disorders in which .beta.-strand structures are
a part of the pathology of the disorder, e.g., amyloidoses. Such
disorders include Alzheimer's disease and prion-associated diseases
(e.g., scrapie, bovine spongioform encephalopathy, and
Creutzfield-Jacob disease).
[0007] The invention features a method of identifying a compound
that stabilizes an .alpha.-helical conformation of a discordant
helix in a polypeptide. The method includes the steps of providing
a test sample containing a polypeptide that contains a discordant
helix in the form of an .alpha.-helix, contacting the test sample
with a test compound, and determining the rate of decrease in the
amount of .alpha.-helix in the test sample, such that a lower rate
of decrease in the presence of the test compound than in the
absence of the test compound is an indication that the test
compound stabilizes the .alpha.-helical conformation of the
discordant helix in the polypeptide. The invention also includes
compounds identified using this method. Test compounds that can be
used according to the method include peptides, e.g., tripeptides
such as dipolar tripeptides. In those embodiments where the
polypeptide containing a discordant helix includes all or part of
an A.beta. peptide, the polypeptide can include at least residues
14-23 or 16-23 of the A.beta. peptide.
[0008] The invention also feature a method of identifying a
compound that can stabilize an .alpha.-helical conformation of a
discordant helix-containing polypeptide in which the method
includes providing a test sample comprising a polypeptide that
contains a discordant helix in the form of an .alpha.-helix,
contacting the test sample with a test compound for a specified
amount of time, and determining the amount of .alpha.-helix present
in the test sample such that a larger amount of .alpha.-helix in
the presence of the test compound than in the absence of the
compound indicates that the test compound stabilizes the
.alpha.-helical conformation of the discordant helix in the
polypeptide. The invention also includes compounds identified using
this method. Test compounds that can be used according to the
method include peptides, e.g., tripeptides such as dipolar
tripeptides. In those embodiments where the polypeptide containing
a discordant helix includes all or part of an A.beta. peptide, the
polypeptide can include residues 14-23 or 16-23 of the A.beta.
peptide.
[0009] The invention also features a method of identifying whether
a protein is susceptible to forming amyloid which includes
analyzing the amino acid sequence of the protein to determine
whether the protein contains a predicted discordant helix, such
that the presence of predicted discordant helix is an indication
that the protein is susceptible to forming amyloid. The discordant
helix can be at least six amino acids in length.
[0010] The invention includes a method of decreasing the rate of
formation of .beta.-strand structures between at least two
discordant helix-containing polypeptides, in which the method
includes contacting the discordant helix-containing polypeptides
with a compound that stabilizes an .alpha.-helical form of the
discordant helix. Tripeptides such as the dipolar tripeptides
described herein can be used to stabilize the discordant helix.
[0011] The invention also features a method of treating an
individual having or at risk for an amyloidosis. The method
includes administering to the individual a therapeutically
effective amount of a compound that stabilizes an .alpha.-helical
form of a discordant helix-containing polypeptide that forms
amyloid. The amyloidosis can be, for example, a prion disease or
Alzheimer's disease. Tripeptides, e.g., dipolar tripeptides
including those described herein. can be used to stabilize the
discordant helix.
[0012] A "discordant helix" is an amino acid sequence that is
predicted to be able to form an .alpha.-helix and is also predicted
to be able to form a .beta.-strand. A discordant helix can be
identified using structure analysis programs that predict secondary
structure of polypeptides, specifically by analyzing an amino acid
sequence for predicted .alpha.-helix and also analyzing the amino
acid sequence for predicted .beta.-strand. A sequence that is
predicted to form .alpha.-helix and .beta.-strand is a discordant
helix. A discordant helix amino acid sequence can be an isolated
peptide, or form part of a polypeptide. A discordant helix can be
naturally occurring in a wild type or mutant polypeptide. A
discordant helix can also be in a synthetic amino acid sequence. In
general, the discordant helix amino acid sequence is at least about
6 amino acids in length. Such sequences can be longer, e.g., 7, 8,
9, 10, 11, 12, 14, 16, 18, 22, 24, or 26 amino acids in length.
[0013] A "polypeptide" means a chain of amino acids regardless of
length or post-translational modifications.
[0014] A "non-amyloidogenic form" of a polypeptide containing a
predicted discordant helix is the form of the protein in which
.alpha.-helix is the predominant conformation of the discordant
amino acid sequence. Compounds that promote the .alpha.-helix
conformation of a discordant helix are useful for preventing the
formation of amyloid.
[0015] Unless otherwise defined, all technical and scientific terms
used herein have the same meaning as commonly understood by one of
ordinary skill in the art to which this invention belongs. Although
methods and materials suitable for practicing the invention are
described below, method and materials similar or equivalent to
those described herein can be used in the practice or testing of
the present invention. All publications, patent applications,
patents, and other references mentioned herein are incorporated by
reference. The materials, methods, and examples are illustrative
only and not intended to be limiting.
[0016] Other features and advantages of the invention will be
apparent from the detailed description, and from the claims.
DESCRIPTION OF DRAWINGS
[0017] FIG. 1 is a bar graph that depicts the occurrence of
.alpha.-helical segments with high .beta.-strand propensities. The
number of protein segments are plotted versus the lengths of the
segments for which experimentally determined .alpha.-helices
coincide with .beta.-strands predicted with a PHD reliability index
.gtoreq.5 for all residues. The PBD codes are given for the
proteins from which the helices with .gtoreq.7 residues emanate.
Codes in bold identify proteins that form amyloid fibrils in vivo,
and italics denote proteins shown to form fibrils. The outcome of
predictions for prion proteins from human (hPrP) and mouse (mPrP)
are indicated. The PDB codes represent, in alphabetical order:
1aa0=fibritin deletion mutant (Bacteriophage T4),
laura=carboxylesterase (Pseudomonas fluorescens), 1b10(sPrP)=prion
protein (Syrian hamster), 1b2va 32 heme-binding protein A (Serratia
marcescens), 1b5ea=dCMP hydroxymethylase (Bacteriophage T4),
1b8oa=purine nucleoside phosphorylase (Bos taurus), 1ba6=beta
amyloid protein (Homo sapiens), 1bct=bacteriorhodopsin
(Halobacterium halobium), 1bl1=parathyroid hormone receptor (Homo
sapiens), 1cpo=chloroperoxidase (Leptoxyphium fumago),
1cv8=staphopain (Staphylococcus aureus), 1ecra=replication
terminator protein (Escherichia coli), 1ggtb=coagulation factor
XIII (Homo sapiens), 1h2as-hydrogenase (Desulfovibrio vulgaris),
1iab=astacin (Astacus astacus), 1jkmb=brefeldin A esterase
(Bacillus subtilis), 1kpta=killer toxin (Ustilago maydis),
1lml=leishmanolysin (Leishmania major), 1mhdb=smad MH1 doman (Homo
sapiens), 1mnma=transcription factor MVM1 (Saccharomyces
cerevisiae), 1mtyd=methane monooxygenase (Methylococcus
capsulatus), 1nom=DNA polymerase beta (Rattus norvegicus),
1noza=DNA polymerase (Bacteriophage T4), 1pbv-sec7 domain of
exchange factor ARNO (Homo sapiens), 1quta=lytic transglycosylase
Slt35 (Escherichia coli), 1smd=salivary amylase (Homo sapiens),
1spf (SP-C)=surfactant-associated protein C (Sus scrofa),
1sra=osteonectin (Homo sapiens), 1taha=lipase (Burkholdia glumae),
1tca=lipase B (Candida antarctica), 1vns=chloroperoxidase
(Curvularia inaequalis), 1wer=Ras-GTPase-activating domain of
p120GAP (Homo sapiens), 2erl=pheromone Er-1 (Eurplotes raikovi),
2ifo=inovirus (Xanthomonas oryzae), 2occk=cytochrome C oxidase (Bos
taurus), 2sqca=squalene-hopene cyclase (Alicyclobacillus
acidocaldarius), 3aig=adamalysin II (Crotalus adamanteus),
3pte=transpeptidase (Xstreptomyces R61).
[0018] FIG. 2 is a set of diagrams that depict the characteristics
of long discordant helix segments. Amino acid sequences, together
with determined and predicted secondary structure elements for
sequences having .gtoreq.9=residue discordant segments are shown.
Also shown are those discordant segments of A.beta., mouse PrP, and
human PrP. The proteins are grouped by the length of their
discordant stretch. The experimentally determined helical segments
are drawn as blue cylinders in the bottom row of each case in which
the amino acid sequences and residue positions in the PDB entries
of the corresponding proteins are given. The locations of the
.beta.-strands predicted by PHD are visualized by yellow strands in
the middle row of each case, wherein the reliability index for each
residue is shown. The Chou-Fasman-based predictions averaged for
6-residue segments are plotted above residue 3 in each segment and
given in the top row of each case. E and e denote extended
structures (i.e., .beta.-strands) predicted with high and low
probability, respectively, as in Chou and Fasman (1978, Adv.
Enzymol. 47:45-148), and H and h represent predicted helical
structures in an analogous manner.
[0019] FIG. 3 is a diagram that depicts the amino acid sequence
(bottom row) and predicted secondary structure by PHD and according
to Chou-Fasman analysis for a polyleucine analogue of SP-C (lung
surfactant protein C). The PHD predictions including reliability
indices are given in the middle row and the Chou-Fasman data in the
top row, but in this case an .alpha.-helix is predicted by both
methods, symbolized by a blue cylinder for the PHD prediction.
[0020] FIG. 4 is a graph that depicts data from an experiment in
which the relative amounts of SP-C(squares) and SP-C(Leu)
(triangles) remaining in solution after centrifugation at
20,000.times.g for 20 minutes at different time points after
solubilization were measured.
[0021] FIG. 5 is a set of diagrams that depict the experimentally
determined and predicted secondary structures of positions 1-28 of
A.beta. and a variant of A.beta. (1-28) in which three residues
have been changed to alanine (K16A, L17A, F20A). Symbols are as
described for FIGS. 2 and 4.
[0022] FIGS. 6A-6C are graphs depicting the effects various
tripeptides on fibril formation by A.beta.(14-23) (FIG. 6A),
A.beta.(12-24) (FIG. 6B), and A.beta.(1-40) (FIG. 6C). Unless
otherwise indicated, the tripeptides have free N- and C-termini.
The results are representative for two to three independent
experiments.
[0023] FIG. 7 is a graph depicting the effects of various
tripeptides and tetrapeptides on fibril formation by
A.beta.(14-23).
[0024] FIG. 8 is a graph depicting the effects of the peptides KAD,
AAA, and KFFE (SEQ ID NO:1) on A.beta.(1-40) aggregation. Samples
were analyzed in duplicate.
[0025] FIGS. 9A-9E depict the fibrillar structures of A.beta.(1-40)
formed in the absence of tripeptide (9A), in the presence of KAD
(9B), acetyl-KAD-amide (9C), AAA (9D), or acetyl-AAA-amide
(9E).
[0026] FIG. 10 depicts the KAD peptide in an energy-minimized
conformation (top structure), the KAD peptide in an extended
conformation (middle structure), and the KFFE (SEQ ID NO: 1)
peptide in an extended conformation (bottom structure). The amino
and carboxyl groups of the charged side-chains are on the same side
of the polypeptide backbone in KAD and the distances between them
are then shown. In KFFE, the charged side-chains are on opposite
sides of the polypeptide backbone.
[0027] FIG. 11 depicts the charge separation of A.beta.(15-23) in
.alpha.-helical and .beta.-strand conformations. The upper panel
shows the A.beta.(15-23) region in helical conformation, symbolized
by the cylinder. The charged side-chains Lys16, Glu22 and Asp23 are
shown. In the lower panel, the A.beta.(15-23) region is modeled in
.beta.-strand/extended conformation, indicated by the wavy strand.
The charged side-chains are shown. For the helical conformation,
the distances between the .epsilon.-amino group of Lys16 and the
.gamma.-carboxyl group of Glu22 and the .beta.-carboxyl group of
Asp23 are shown, and for the extended conformation the Lys16-Glu22
distance is indicated.
[0028] FIG. 12 is a model of A.beta. fibril formation and the
associated effects of helix-stabilizing agents. The upper row
depicts the transformations that helical A.beta. peptides are
thought to undergo to form .beta.-sheet fibrils. Monomeric A.beta.
in aqueous solution is structurally disordered (i.e. it
interconverts between different structures including
.alpha.-helical and .beta.-strand conformations) and A.beta. in
extended conformation will be able to polymerize via the formation
of intermolecular contacts in .beta.-sheets. Compounds that can
interact preferentially with helical A.beta. (here represented by
the doubly charged ligand) will shift the equilibrium from the
extended conformation and thereby reduce formation of fibrils. The
cylinder represents the helix centered around residues 16-23 of
A.beta. and the + and - signs represent Lys16 and Glu22/Asp23,
respectively.
DETAILED DESCRIPTION
[0029] It has been discovered that protein databanks can be
screened for amyloid-forming proteins by analyzing the amino acid
sequences in the databanks for proteins that harbor an
.alpha.-helix in a polypeptide segment that is also predicted to
form a .beta.-strand (.alpha.-helix/.beta.-strand discordance). In
an experiment, a protein databank of 1324 non-redundant entries was
searched for conflicts between experimentally determined
.alpha.-helices and predicted extended structure (i.e., predicted
discordant helix). This revealed a correlation between
.alpha./.beta. discordance and ability of the corresponding protein
to form amyloid fibrils under physiological conditions (Example 3).
Thus, analysis of a protein's structure for
.alpha.-helix/.beta.-stra- nd discordance can be used to predict
those proteins that will form amyloid. Amyloid is believed to be
associated with or responsible for the pathological changes
observed during the course of amyloidoses. It follows that,
inhibition or prevention of amyloid formation may prevent the
occurrence or progression of these diseases. Thus, proteins
containing discordant helices are useful targets for developing
treatments that will prevent or ameliorate amyloidoses.
[0030] The invention includes methods of targeting discordant
helix-containing segments of fibril-forming proteins (i.e.,
proteins that form amyloid) with ligands (termed "helix-lock
molecules") that can stabilize the discordant helix region in an
.alpha.-helical conformation, thereby inhibiting conversion to the
.beta.-strand conformation. Prevention of .beta.-strand formation
inhibits amyloid formation. The specific regions containing the
predicted .alpha.-helix/.beta.-strand discordance provide specific
targets for drugs that can serve as such helix-lock molecules. For
example, these regions can be used to screen for compounds that can
be used as drugs that will prevent or inhibit conversion of the
.alpha.-helix to .beta.-strand conformation.
[0031] In experiments designed to investigate whether
.alpha.-helix/.beta.-strand discordance was likely to account for
amyloid formation, a database of protein structures was screened
for helical sequences predicted to form extended structures
(.beta.-structures) (Example 1). Novel proteins and polypeptide
structures can be screened for the presence of predicted discordant
helices. For polypeptides where experimentally derived structural
data are not available, contradictory data from different secondary
structure prediction programs can indicate the presence of a
discordant helix (e.g., PHD analysis and Chou-Fasman analyses,
Example 1).
[0032] Identification of Compounds that Stabilize .alpha.-Helical
Conformation
[0033] The invention includes methods of screening for compounds
that can stabilize an .alpha.-helical form of a discordant helix.
The ability of a test compound to stabilize an .alpha.-helical
conformation of a discordant helix is determined by measuring the
amount of .alpha.-helix in a sample containing a discordant
helix-containing polypeptide in the presence and absence of the
particular compound. Any suitable method that detects the presence
of .alpha.-helix or alternatively .beta.-structure can be used to
screen test compounds for their ability to stabilize an
.alpha.-helix of a discordant helix. Such methods include NMR
(e.g., Johansson et al., 1994, Biochemistry 33:6015-6023), circular
dichroism (CD) (Johansson et al., 1995, FEBS Lett. 362:261-265;
Wang, 1996, Biochim Biophys Actal 301:174-184), and Fourier
transform infrared spectroscopy (FTIR; Vandenbussche, 1992,
Biochemistry 31:9169-9176). .alpha.-Helix stability can be assessed
from the rate of decrease in the amount of the .alpha.-helical form
of the peptide/protein (e.g. the half-life of the .alpha.-helical
form) in the presence and absence of a test compound, e.g., using
electrospray (ES)-mass spectroscopy. ES or matrix-assisted laser
desorption/ionisation (MALDI) mass spectrometry in combination with
H/D exchange mass spectroscopy can also be used to assay for the
presence of an .alpha.-helix conformation of a discordant helix. In
this approach, the kinetics of disappearance of .alpha.-helix and
hydrogen to deuterium (H/D) exchange of the soluble forms of a
discordant helix-containing polypeptide are studied.
[0034] For relatively small proteins such as SP-C (4.2 kDa), H/D
exchange rates at specific residues can be determined by NMR.
However, such NMR analysis requires pure samples at high
concentration, and long time periods for measurements, which make
analysis of some polypeptides difficult. These problems can be
partially solved by the application of mass spectrometry. Using
either ES or MALDI mass spectrometry, H/D exchange levels can be
monitored at low concentrations. The analysis times are short and
mixtures of peptides can be analyzed. Thus, mass spectrometry is a
particularly useful technique for studying the relative H/D
exchange rates of protein mixtures.
[0035] Mass spectrometry is a technique that can be used to
investigate non-covalent interactions involving proteins such as
those involved in the formation of .alpha.-helices. To study
non-covalent interactions directly using mass spectrometry, it is
important that the protein be, to the extent possible, in its
non-denatured state. This can be accomplished using ES as the
method of ionization for the mass spectroscopy analysis. ES
involves spraying the protein that is in an aqueous solution at
physiological pH in the absence of an organic co-solvent (Pramanik
et al., 1998, J. Mass Spectrom. 33:911-920). Highly hydrophobic
proteins, such as SP-C (lung surfactant protein C), are exceptions
in that their native conformations are maintained in organic
solvents, and they can be sprayed when they are in methanol or
chloroform/methanol/water solutions. An additional requirement for
the use of ES in analysis of proteins in their native states is the
careful control of the de-clustering voltage (cone voltage) within
the ES interface. An excessive potential difference can lead to
collision-induced dissociation or the destruction of non-covalent
associations.
[0036] ES-Mass Spectrometry
[0037] Mass spectrometry can be used in combination with H/D
(hydrogen/deuterium) exchange to obtain information concerning
non-covalent interaction and tertiary structure and stability
(Smith et al., 1997, J. Mass Spectrom. 32:135-146; Mandel et al.,
1998, Proc. Natl. Acad. Sci. USA 95:14705-14710). In ES-mass
spectroscopy, spectra can be recorded using a
quadrupole-time-of-flight (TOF) instrument (Micromass, Manchester,
England). The instrument can be fitted with an orthogonal sampling
nano-ES interface (Z-Spray) consisting of a quadrupole mass filter,
a hexapole collision cell and an orthogonally arranged TOF analyzer
complete with reflectron (Morris, 1996, Rapid Commun. Mass
Spectrom. 10:889-896). Samples can be sprayed from gold-coated
borosilicate capillaries (Protana A/S, Denmark). A suitable
collision gas such as argon (AGA, Sweden) is used for
collision-induced dissociation (CID). To determine the relative
rate of disappearance from solution of various forms of a
discordant helix-containing polypeptide (e.g., the disappearance of
the .alpha.-helical form), an appropriate acquisition range is
selected, for example, m/z 135-4000. Three hundred scans of five
seconds duration are recorded for each time point and combined into
one spectrum. The ion currents corresponding to the summed
abundance of singly and multiply, e.g., doubly and triply
protonated molecules, can be determined using maximum entropy
software (Micromass). CID spectra can be recorded to confirm the
structure of the polypeptide. In H/D exchange, the rates of H/D
exchange reactions are monitored by continually recording ES mass
spectra. At specific time points, the ions corresponding to the H/D
exchanged forms of the protein of interest are subjected to CID.
The location of the exchanged protons is indicated by the resultant
fragmentation spectrum.
[0038] MALDI Mass Spectra
[0039] MALDI mass spectra can be recorded on a Voyager-DE.TM. PRO
Biospectrometry Workstation (PerSeptive Biosystems Inc.) operated
in the positive ion mode. Deuterated or non-deuterated polypeptide
is dried on a surface (e.g., a 100 well plate) containing pre-dried
.alpha.-cyano-4-hydroxycinnamic acid (20 .mu.g), which for the
recording of H/D exchange spectra was applied from a solution in
CH.sub.3CN/D.sub.2O. The instrument is equipped with a 335 nm laser
and operated in the linear mode employing delayed extraction. An
appropriate acquisition range is used (e.g., m/z 3500-4000) and
external calibration is employed (e.g., between m/z 3660.19 and
5734.58). A spectrum is calculated as an average of a number of
acquisitions (e.g., 400 acquisitions), and triplicate samples are
generally recorded for each time point. The number of protons
exchanged with deuterons at each time point is calculated by
subtracting the masses of the peptides in the protonated solvent
from the masses of the peptides in the deuterated solvent. This is
done, e.g., to correct for ongoing intramolecular disulfide
formation. Such intramolecular disulfide formation may be observed
by ES CID. In experiments to compare the rate of H/D exchange as
measured by MALDI combined with ES, identical solutions are spotted
on the MALDI plate and sprayed from the ES capillary.
[0040] Determination of Rate Constants from Decay Curves
[0041] Estimation of rate constant from mass spectrometric data can
be done using non-linear least squares regression in Matlab.RTM.
version 5.3 (Mathworks, Natick, Mass., USA) using the routines in
the Mathworks Optimization Toolbox. Absolute concentrations are not
available from the data, but this is not required as the helix
unfolding is a first-order reaction (e.g., for SP-C, see Szyperski,
1998, Protein Sci, 7:2533-2540). Instead ion counts can be used as
the concentration unit in the non-linear regression, assuming that
this measure is proportional to concentration for each peptide.
Marginal standard deviations for the rate constants can be
calculated by the standard procedure of linearization of the
objective function (Seber et al., 1988, Non-linear Regression, John
Wiley & Sons, New York)
[0042] Assay of Test Compounds
[0043] In one aspect of the invention, test compounds are assayed
for their ability to stabilize an .alpha.-helical form of a
discordant helix-containing polypeptide. The methods described
above can be used for such assays. Typically, the test compound is
added to a solution containing the polypeptide, and the content of
helical structure or rate at which the .alpha.-helix form of the
polypeptide disappears from the solution is determined, e.g., using
CD, FTIR, NMR spectroscopy, ES-mass spectroscopy or MALDI mass
spectrometry. The effects of test compounds on fibril formation can
also be determined as described infra. The helical content and/or
the rate of disappearance of .alpha.-helix in the presence and
absence of the test compound is determined. An increased helical
content and/or a decreased rate of .alpha.-helix disappearance from
the solution in the presence of the test compound indicates that
the test compound stabilizes the .alpha.-helix conformation of the
polypeptide. (i.e., is a candidate compound).
[0044] Alternatively, after incubation of a solution containing
discordant helix-containing polypeptide in the presence of a test
compound for a fixed time, the amount of .alpha.-helix can be
determined and compared to the amount of .alpha.-helix present in
the polypeptide incubated for the same amount of time in the
absence of the test compound. A larger amount of .alpha.-helical
form of the polypeptide in the solution containing the test
compound compared to the solution that did not contain the test
compound indicates that the test compound stabilizes the
.alpha.-helical form of the polypeptide (i.e., is a candidate
compound).
[0045] Appropriate incubation times can be determined empirically
for each protein. The incubation times can be minutes, hours, days,
or, in the case of discordant helix-containing proteins that form
.beta.-structures very slowly, weeks or months. Various parameters
can be manipulated to modulate the rate of .beta.-structure
formation, e.g., by increasing concentration of the polypeptide or
increasing the salt concentration in the solution.
[0046] Test Compounds and Candidate Compounds
[0047] Test compounds are compounds that are screened for their
ability to increase the helical content of a solution containing
discordant helix-containing polypeptides and/or slow the rate of
conversion of the .alpha.-helix form of a discordant
helix-containing polypeptide to .beta.-strand structure. Candidate
compounds are compounds found to stabilize the .alpha.-helical form
of a discordant helix-containing polypeptide. Candidate compounds
can be useful for preventing the formation of .beta.-strand
structures and amyloid.
[0048] The invention provides a method for identifying compounds
(e.g., polypeptides, peptidomimetics, or small molecules) that
increase the stability or formation of the .alpha.-helix
conformation of a discordant helix (helix-lock molecules). In
general, candidate compound is a molecule that has a surface that
is complementary to a surface of a discordant helix (e.g., the two
surfaces are capable of an electrostatic interaction), will bind to
that surface, and stabilize the helix. This will reduce the number
of events in which the discordant helix converts to .beta.-strand
conformation, thereby reducing the amount of fibril formation.
Interactions between such compounds and a discordant helix can be
non-covalent, in which case it is likely that complementary
surfaces are required between the .alpha.-helix and the compound.
The interaction between a discordant helix and a compound can also
be covalent, in which case, the compound binds through a
complementary interaction and then binds covalently to residue(s)
of the discordant helix. A covalent interaction between the
compound a discordant helix-containing protein is generally not
reversible. Candidate compounds include tripeptides and
tetrapeptides such as those described in the Examples. The peptides
used in the screening assays can be dipolar, neutral, or
mono-charged.
[0049] It is also possible to identify compounds that modify
specific residues of a discordant helix so that the residues change
from having a high propensity for .beta.-strand conformation to
prefer helical or random structures, thus reducing or eliminating
the discordant nature of the helix. Such modifications can be
introduced by modifying certain residues chemically, or by
introducing mutations in the gene coding for the protein containing
the discordant helix. Another method of stabilizing the
.alpha.-helical form of a discordant helix is to covalently link
different specific residues in a discordant helix to each other
such that the helical conformation is stabilized.
[0050] Antibodies that specifically bind a discordant helix can be
used to stabilize the .alpha.-helical conformation of a discordant
helix. Such antibodies can be particularly useful for stabilizing
the discordant helix-containing proteins that are found
extracellularly or on the cell surface, although single chain
recombinant antibodies can be expressed inside a cell to stabilize
intracellular discordant helices. Antibodies that specifically bind
to a protein containing a discordant helix can be generated using
standard techniques. In general, the antibodies are recognize the
.alpha.-helical form of a discordant helix or interact with a
polypeptide containing a discordant helix such that the
.alpha.-helix conformation is favored. Such antibodies can be made
using the discordant helix-containing polypeptide or a fragment
thereof, e.g., a fragment containing the discordant helix, as an
antigen. Antibodies can be screened for their ability to stabilize
the .alpha.-helical form of the polypeptide using the methods
described herein. In general, a F.sub.ab fragment of an antibody is
used. Antibodies useful in the invention can be polyclonal
antibodies or monoclonal antibodies.
[0051] The nature of compounds that are able to stabilize the
.alpha.-helical forms of peptide/proteins will depend on the amino
acid sequence of the discordant peptide segment in question. One
method of identifying compounds is to first use molecular modeling
in silico, e.g., as implemented in the Insight/Discover program
suite (Biosym/MSI, San Diego, Calif.), to identify substances that
optimally fit to a specific region of a discordant helix.
Identified substances are then tested for their ability to inhibit
fibril formation and stabilize .alpha.-helical conformation, as
described above. Another approach to identifying compounds that
inhibit fibril formation and/or stabilize the .alpha.-helical form
is to screen chemical libraries for molecules that inhibit fibril
formation and stabilize an .alpha.-helical conformation using
methods such as those described herein.
[0052] The compounds of the invention can be obtained using any of
the other numerous approaches in combinatorial library methods
known in the art, including biological libraries; spatially
addressable parallel solid phase or solution phase libraries;
synthetic library methods requiring deconvolution; the "one-bead
one-compound" library method; and synthetic library methods using
affinity chromatography selection. The biological library approach
is limited to peptide libraries, while the other four approaches
are applicable to peptide, non-peptide oligomer or small molecule
libraries of compounds (Lam, 1997, Anticancer Drug Des.
12:145).
[0053] Examples of methods for the synthesis of molecular libraries
are known in the art, for example in DeWitt et al. (1993, Proc.
Natl. Acad. Sci. USA 90:6909), Erb et al. (1994, Proc. Natl. Acad.
Sci. USA 91:11422), Zuckermann et al. (1994, J. Med. Chem.
37:2678), Cho et al. (1993, Science 261:1303) Carrell et al. (1994,
Angew. Chem. Int. Ed. Engl. 33:2059), Carell et al. (1994, Angew.
Chem. Int. Ed. Engl. 33:2061), and Gallop et al. (1994, J. Med.
Chem. 37:1233).
[0054] Libraries of compounds can be presented in solution (e.g.,
Houghten, 1992, Bio/Techniques 13:412-421), or on beads (Lam, 1991,
Nature 354:82-84), chips (Fodor, 1993, Nature 364:555-556),
bacteria (U.S. Pat. No. 5,223,409), spores (U.S. Pat. Nos.
5,571,698; 5,403,484; and 5,223,409), plasmids (Cull et al., 1992,
Proc. Natl. Acad. Sci. USA 89:1865-1869) or phage (Scott and Smith,
1990, Science 249:386-390; Devlin, 1990, Science 249:404-406;
Cwirla et al., 1990, Proc. Natl. Acad. Sci. USA 87:6378-6382; and
Felici, 1991, J. Mol. Biol. 222:301-310).
[0055] Additional Methods of Assaying Test Compounds
[0056] Direct Detection of Fibril Formation
[0057] In some cases methods other than those that assay
stabilization of .alpha.-helix conformation can be useful for the
invention. For example, direct detection of fibril formation can
complement the assays that measure .alpha.-helix conformation. The
extent and rate of fibril formation can be measured directly by
electron microscopy (EM) of fibrils formed. For example, pellets
containing fibrils are suspended in a small volume of water using
low energy sonication for five seconds. Aliquots of the fibril
suspension are then placed on grids covered by a carbon-stabilized
Formvar.RTM. film. Excess fluid is withdrawn from the grids after
30 seconds. The grids are then air-dried and negatively stained
with 3% uranyl acetate in water. The stained grids are then
examined and photographed in an electron microscope such as a
Phillips CM120TWIN operated at 80 kV.
[0058] Fibril formation can also be assessed by staining the
fibrils with dyes, e.g., Congo red or Thioflavin T, and detecting
emitted light from the stained sample. For example, pellets
containing fibrils are resuspended in phosphate buffered saline by
sonication before addition of Congo Red (2% w/v). The samples are
incubated for one hour at ambient temperature and aggregated
proteins collected by centrifugation at 13,000.times.g for five
minutes. The aggregates are then washed in water and resuspended in
water. An aliquot is placed on a microscope slide, dried, and
observed by polarization microscopy (e.g., using a Zeiss Axialfold
microscope). Alternatively, detection of light absorption or
emission at different wavelengths after staining with Congo red or
Thioflavin T can be used to quantify amyloid formation (see LeVine,
1993, Prot. Science 2:404-410; Klunk et al., 1999, Anal. Biochem.
266: 266:66-76).
[0059] An assay for detection of fibril formation in the presence
and absence of a test compound can be used, e.g., to prescreen test
compounds for those that are to be used in subsequent assays of
.alpha.-helix stabilization. Similarly, the ability of a candidate
compound to inhibit fibril formation can be used to confirm the
predicted efficacy of a candidate compound in preventing fibril
formation.
[0060] Indirect Detection of Fibril Formation
[0061] Fibril formation can also be indirectly assayed by measuring
the disappearance of the .alpha.-helical forms that, after
.alpha.-helix to .beta.-strand conversion and aggregation, give
rise to fibrils. For this purpose, ES mass spectrometry is a
preferred method as it distinguishes between monomeric and
aggregated forms of the polypeptide that contains a discordant
helix (described supra). Alternatively, aggregates can be removed,
e.g., by centrifugation, and peptides remaining in solution (which
are predominantly .alpha.-helical in their discordant helix region)
are then quantified by techniques such as gel electrophoresis,
amino acid analysis, or reversed-phase HPLC.
[0062] As with direct methods of assaying fibril formation, the
indirect methods are useful for identifying compounds that
interfere with .alpha.-helix to .beta.-strand conversion and
therefore will inhibit amyloid fibril formation, e.g., for
screening test compounds to be used in assays for stabilization of
an .alpha.-helix conformation of a discordant helix-containing
polypeptide or to confirm that a candidate compound has a
stabilizing effect.
[0063] The effect of different compounds on fibril formation can be
observed using the above methods, preferably in combination as they
have complementary profiles. Thus, staining techniques are fairly
rapid, allowing screening of many compounds. Electron microscopy
(EM) is more specific than dye detection since with EM the nature
of the fibrils can be judged and fibrils can be quantitatively
analyzed. Mass spectrometry is highly sensitive, while gel
electrophoresis, amino acid analysis and reversed-phase HPLC can be
used with a large number of samples but are less sensitive.
[0064] Thus, in designing screens for compounds that are useful for
inhibiting fibril formation several stages of assay may be used.
For example, a large number of compounds are tested using staining
methods. Once an initial screen is done and a subset of the initial
group of compounds are selected as candidates, ES mass spectroscopy
can be used to confirm the ability of a given compound to interfere
with the conversion of .alpha.-helix to .beta.-structure in a
discordant helix.
[0065] When characterizing the effects of different compounds, both
the amount of fibril formed and the rates of fibril formation are
of interest, since comparatively minor changes in the rates of
fibril formation in vitro may reflect the tendency of a
peptide/protein to form amyloid fibrils over a long time span in
vivo.
[0066] Identification of Compounds that Reduce A.beta. Aggregation
and Fibril Formation
[0067] Discordant helices composed of residues with a high
.beta.-strand propensity are found in A.beta., PrP, and other
amyloid-forming proteins. As described in Examples 4-7, dipolar
tripeptides such as the KAD tripeptide reduce A.beta. aggregation
and fibril formation and induce the formation of short fibril
fragments. The charges of the tripeptides are separated by a
distance that almost perfectly matches the distance between charged
residues in the discordant A.beta.(16-23) .alpha.-helix. A
"helix-lock" mechanism is proposed as follows in which
stabilization of discordant helices by external factors can reduce
fibril formation.
[0068] Experimental data and theoretical models indicate that
.alpha.-helix to .beta.-strand conversion of the 16-23 region of
A.beta. is critical for amyloid fibril formation. Since A.beta.
positions 16-23 show helical structures in the presence of
membrane-mimicking solvents or detergents, it is likely that this
region is also helical in membrane-associated APP. However, in
liberated A.beta. in an aqueous solution, a helical conformation
will be only transiently stable, in line with the unordered A.beta.
conformation in water detected by spectroscopic methods (Serpell,
2000, Biochim. Biophys. Acta 1502:16-30). Conversion of the 16-23
region into extended/.beta.-strand conformation is required for
formation of fibrils built up from .beta.-sheets (FIG. 12).
[0069] The "helix-lock" mechanism for KAD-induced stabilization of
A.beta. presented in FIG. 12 is suggested by the following: the
match between the KAD tripeptide charged groups and the charges in
helical A.beta.(15-23); the lack thereof in the other tripeptides
and tetrapeptides described in the Examples; the lack of apparent
possibilities for KAD to interact with extended A.beta. in a more
favorable way than the other tripeptides and tetrapeptides; and the
observation that the effects of KAD were detected against
A.beta.(1-40) and A.beta.(14-23). In this model, KAD interacts with
the charged Lys16 and Glu22/Asp23 in helical A.beta., and thereby
stabilizes this conformation relative to extended A.beta.. The
concomitant shift of the equilibrium towards .alpha.-helical
A.beta. relative to extended A.beta. will lower the concentration
of an A.beta. form that can form .beta.-sheet fibrils. This is
expected to result in reduced fibril formation and aggregation of
A.beta., as observed experimentally in Examples 4-6. The effects of
KAD and acetyl-KAD-amide on fibril morphology (FIG. 9) may also be
related to the reduction of fibrillogenic forms of A.beta. with
concomitant reduced capacity to polymerize.
[0070] Stabilization of Discordant Helices as a Means to Prevent
Fibril Formation
[0071] The results presented in the Examples and the model proposed
herein further characterize the relationship between A.beta. helix
forming potential and the capacity to form fibrils. According to
the model, peptide inhibitors (FIG. 12) work at an early step in
the fibrilization process by stabilizing helical A.beta. and
thereby reducing the amount of extended/non-helical peptide that
can take part in the polymerization process. The results presented
in the Examples suggest that stabilization of helical A.beta. can
prevent fibril formation and, furthermore, limit the possible
interacting residues to the 14-23 region. The latter is intriguing
in light of the findings that A.beta.(16-23) exhibits
.alpha.-helix/.beta.-sheet discordance, in common with helix 2 of
the PrP and specific helices of at least four additional proteins
that can form amyloid fibrils under physiological-like conditions.
Mutating Lys16, Leu17 and Phe20 to Ala changes the secondary
structure propensity of A.beta.(1-28) and stabilizes the
A.beta.(16-23) helix (i.e. the discordant nature is abolished and
instead a helical structure is predicted) and prevents fibril
formation. According to the model proposed here (see FIG. 12), KAD
can reduce fibril formation by externally stabilizing the
discordant A.beta.(16-23) helix. It is possible that the discordant
helices are stabilized by external factors in their native
molecules, e.g., surrounding residues in the three-dimensional
structures of globular proteins like PrP, and surrounding lipids in
the case of membrane-spanning helices like in A.beta./APP and
surfactant protein C.
[0072] Pharmaceutical Compositions
[0073] The candidate compounds of the invention, i.e., compounds
that stabilize the .alpha.-helical conformation of a polypeptide
containing a discordant helix, can be incorporated into
pharmaceutical compositions. Such compositions typically include
the candidate compound and a pharmaceutically acceptable carrier.
As used herein the language "pharmaceutically acceptable carrier"
includes solvents, dispersion media, coatings, antibacterial and
antifungal agents, isotonic and absorption delaying agents, and the
like, compatible with pharmaceutical administration. Supplementary
active compounds can also be incorporated into the
compositions.
[0074] A pharmaceutical composition is formulated to be compatible
with its intended route of administration. Examples of routes of
administration include parenteral (e.g., intravenous, intradermal,
subcutaneous), oral, intranasal (e.g., inhalation), transdermal,
transmucosal, intrathecal, intracerebral ventricular (e.g., using
an Omaya reservoir-shunt with in-line filter that is surgically
placed into the cisternal space), and rectal administration.
Potentially useful parenteral delivery systems for a composition
include slow-dissolving polymer particles, implantable infusion
systems, and liposomes. Solutions or suspensions used for
parenteral application can include the following components: a
sterile diluent such as water for injection, saline solution, fixed
oils, polyethylene glycols, glycerine, propylene glycol or other
synthetic solvents; antibacterial agents such as benzyl alcohol or
methyl parabens; antioxidants such as ascorbic acid or sodium
bisulfite; chelating agents such as ethylenediaminetetraacetic
acid; buffers such as acetates, citrates or phosphates and agents
for the adjustment of tonicity such as sodium chloride or dextrose.
pH can be adjusted with acids or bases, such as hydrochloric acid
or sodium hydroxide. The parenteral preparation can be enclosed in
ampoules, disposable syringes or multiple dose vials made of glass
or plastic.
[0075] Treatment of an amylodosis may also be effected by direct
delivery of a helix-lock compound to the central nervous system,
preferentially to the brain.
[0076] Pharmaceutical compositions suitable for injectable use
include sterile aqueous solutions (where water soluble) or
dispersions and sterile powders for the extemporaneous preparation
of sterile injectable solutions or dispersion. For intravenous
administration, suitable carriers include physiological saline,
bacteriostatic water, Cremophor EL.TM. (BASF, Parsippany, N.J.) or
phosphate buffered saline (PBS). In all cases, the composition must
be sterile and should be fluid to the extent that easy
syringability exists. It should be stable under the conditions of
manufacture and storage and must be preserved against the
contaminating action of microorganisms such as bacteria and fungi.
The carrier can be a solvent or dispersion medium containing, for
example, water, ethanol, polyol (for example, glycerol, propylene
glycol, and liquid polyetheylene glycol, and the like), and
suitable mixtures thereof. The proper fluidity can be maintained,
for example, by the use of a coating on particles of the active
substance (e.g., lecithin), by the maintenance of the required
particle size in the case of dispersion and by the use of
surfactants. Prevention of the action of microorganisms can be
achieved by various antibacterial and antifungal agents, for
example, parabens, chlorobutanol, phenol, ascorbic acid,
thimerosal, and the like. In many cases, it is preferable to
include isotonic agents in the composition. Example of such agents
include sugars, polyalcohols such as mannitol and sorbitol, and
sodium chloride. Prolonged absorption of the injectable
compositions can be brought about by including in the composition
an agent which delays absorption, for example, aluminum
monostearate or gelatin.
[0077] Sterile injectable solutions can be prepared by
incorporating the active compound in the required amount in an
appropriate solvent with one or a combination of ingredients
enumerated above, as required, followed by filtered sterilization.
Generally, dispersions are prepared by incorporating the active
compound into a sterile vehicle which contains a basic dispersion
medium and the required other ingredients from those enumerated
above. In the case of sterile powders for the preparation of
sterile injectable solutions, the preferred methods of preparation
are vacuum drying and freeze-drying, which yield a powder of the
active ingredient plus any additional desired ingredient from a
previously sterile-filtered solution thereof.
[0078] Oral compositions generally include an inert diluent or an
edible carrier. For the purpose of oral therapeutic administration,
the active compound can be incorporated with excipients and used in
the form of tablets, troches, or capsules, e.g., gelatin capsules.
Pharmaceutically compatible binding agents, and/or adjuvant
materials can be included as part of the composition. The tablets,
pills, capsules, troches and the like can contain any of the
following ingredients, or compounds of a similar nature: a binder
such as microcrystalline cellulose, gum tragacanth or gelatin; an
excipient such as starch or lactose; a disintegrating agent such as
alginic acid, Primogel, or corn starch; a lubricant such as
magnesium stearate or Sterotes; a glidant such as colloidal silicon
dioxide; a sweetening agent such as sucrose or saccharin; or a
flavoring agent such as peppermint, methyl salicylate, or orange
flavoring.
[0079] For administration by inhalation, the compounds are
delivered in the form of an aerosol spray from pressured container
or dispenser that contains a suitable propellant, e.g., a gas such
as carbon dioxide, or a nebulizer.
[0080] Systemic administration can also be by transmucosal or
transdermal means. For transmucosal or transdermal administration,
penetrants appropriate to the barrier to be permeated are used in
the formulation. Such penetrants are generally known in the art,
and include, for example, for transmucosal administration,
detergents, bile salts, and fusidic acid derivatives. Transmucosal
administration can be accomplished through the use of nasal sprays
or suppositories. For transdermal administration, the active
compounds are formulated into ointments, salves, gels, or creams as
generally known in the art.
[0081] The compounds can also be prepared in the form of
suppositories (e.g., with conventional suppository bases such as
cocoa butter and other glycerides) or retention enemas for rectal
delivery.
[0082] In one embodiment, the compounds are prepared with carriers
that will protect the compound against rapid elimination from the
body, such as a controlled release formulation, including implants
and microencapsulated delivery systems. Biodegradable,
biocompatible polymers can be used, such as ethylene vinyl acetate,
polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and
polylactic acid. Methods for preparation of such formulations will
be apparent to those skilled in the art. The materials can also be
obtained commercially from Alza Corporation and Nova
Pharmaceuticals, Inc. Liposomal suspensions (including liposomes
targeted to cells specifically affected by an amyloidosis with
monoclonal antibodies) can also be used as pharmaceutically
acceptable carriers. These can be prepared according to methods
known to those skilled in the art, for example, as described in
U.S. Pat. No. 4,522,811.
[0083] It is advantageous to formulate oral or parenteral
compositions in dosage unit form for ease of administration and
uniformity of dosage. Dosage unit form as used herein refers to
physically discrete units suited as unitary dosages for the subject
to be treated, each unit containing a predetermined quantity of
active compound calculated to produce the desired therapeutic
effect in association with the required pharmaceutical carrier.
[0084] Toxicity and therapeutic efficacy of compounds that
stabilize the .alpha.-helical form of a discordant helix-containing
polypeptide can be determined by standard pharmaceutical procedures
in cell cultures or experimental animals, e.g., for determining the
LD50 (the dose lethal to 50% of the population) and the ED50 (the
dose therapeutically effective in 50% of the population). Suitable
animal models can be used such as those described for amyloidoses
in Sturchler-Pierrat et al. (1999, Rev. Neurosci., 10:15-24),
Seabrook et al.(1999, Neuropharmacol. 38:1-17), DeArmond et al.
(1995, Brain Pathology 5:77-89), Telling (2000. Neuropathol. Appl.
Neurobiol. 26:209-220), and Price et al. (1998, Science
282:1079-1083). The dose ratio between toxic and therapeutic
effects is the therapeutic index and it can be expressed as the
ratio LD50/ED50. Compounds that exhibit high therapeutic indices
are preferred. While compounds that exhibit toxic side effects may
be used, care should be taken to design a delivery system that
targets such compounds to the site of affected tissue in order to
minimize potential damage to unaffected cells and thereby reduce
side effects.
[0085] Data obtained from the cell culture assays and animal
studies can be used in formulating a range of dosage for use in
humans. The dosage of a compound lies preferably within a range of
circulating concentrations that include the ED50 with little or no
toxicity. The dosage may vary within this range depending upon the
dosage form employed and the route of administration utilized. For
any compound used in the method of the invention, the
therapeutically effective dose can be estimated initially from cell
culture assays in which, e.g., the rate of fibril formation or the
rate of cell death is observed. A dose may be formulated in animal
models to achieve a circulating plasma concentration range that
includes the IC50 (i.e., the concentration of the test compound
which achieves a half-maximal inhibition of symptoms) as determined
in cell culture. Such information can be used to more accurately
determine useful doses in humans. Levels in plasma may be measured,
for example, by high performance liquid chromatography.
[0086] As defined herein, a therapeutically effective amount of a
compound of the invention (i.e., an effective dosage) ranges from
about 0.001 to 30 mg/kg body weight, preferably about 0.01 to 25
mg/kg body weight, more preferably about 0.05 to 20 mg/kg body
weight, and even more preferably about 0.1 to 10 mg/kg body weight.
The compound can be administered over an extended period of time to
the subject, e.g., over the subject's lifetime. In some cases the
compound can be administered one time per week for between about 1
to 10 weeks, preferably between 2 to 8 weeks, more preferably
between about 3 to 7 weeks, and even more preferably for about 4,
5, or 6 weeks. The compound can also be administered chronically.
The skilled artisan will appreciate that certain factors may
influence the dosage and timing required to effectively treat a
subject, including but not limited to the severity of the disease
or disorder, previous treatments, the general health and/or age of
the subject, and other diseases present. Moreover, treatment of a
subject with a therapeutically effective amount of a compound can
include a single treatment or, preferably, can include a series of
treatments.
[0087] For compounds that are antibodies, the effective dosage may
range from about 0.0001 to at least 100 mg/kg body weight. An
antibody dosage can be 0.1 mg/kg of body weight (generally 10 mg/kg
to 20 mg/kg). If the antibody is to act in the brain, a dosage of
50 mg/kg to 100 mg/kg is usually appropriate. Generally, partially
human antibodies and fully human antibodies have a longer half-life
within the human body than other antibodies. Accordingly, lower
dosages and less frequent administration may be possible with a
humanized antibody. Modifications such as lipidation can be used to
stabilize antibodies and to enhance uptake and tissue penetration
(e.g., into the brain). A method for lipidation of antibodies is
described by Cruikshank et al. (1997, J. Acquired Immune Deficiency
Syndromes Hum. Retrovirol. 14:193).
[0088] A compound for example, may be a small molecule. Such small
molecules include, but are not limited to, peptides,
peptidomimetics (e.g., peptoids), amino acids, amino acid analogs,
polynucleotides, polynucleotide analogs, nucleotides, nucleotide
analogs, organic or inorganic compounds (i.e., including
heteroorganic and organometallic compounds) having a molecular
weight less than about 10,000 grams per mole. Such compounds can
also be organic or inorganic compounds having a molecular weight
less than about 5,000 grams per mole, organic or inorganic
compounds having a molecular weight less than about 1,000 grams per
mole, or organic or inorganic compounds having a molecular weight
less than about 500 grams per mole. The compounds can be in any
pharmaceutically acceptable form such as a salt or ester. Exemplary
doses include milligram or microgram amounts of the small molecule
per kilogram of subject or sample weight (e.g., about 1 microgram
per kilogram to about 500 milligrams per kilogram, about 100
micrograms per kilogram to about 5 milligrams per kilogram, or
about 1 microgram per kilogram to about 50 micrograms per kilogram.
It is furthermore understood that appropriate doses of a small
molecule depend upon the potency of the small molecule with respect
to the expression or activity to be modulated. When one or more of
these small molecules is to be administered to an animal (e.g., a
human) to treat a disease in which a discordant helix-containing
protein is involved (e.g., an amyloidosis), a physician,
veterinarian, or researcher may, for example, prescribe a
relatively low dose at first, subsequently increasing the dose
until an appropriate response is obtained. In addition, it is
understood that the specific dose level for any particular animal
subject will depend upon a variety of factors including the
activity of the specific compound employed, the age, body weight,
general health, gender, and diet of the subject, the time of
administration, the route of administration, the rate of excretion,
any drug combination, and the degree of expression or activity to
be modulated.
[0089] Compounds that can be used in pharmaceutical compositions
include tripeptides and tetrapeptides such as those described in
the Examples, e.g., peptides having the sequence KAD or KFD. The
peptides of the pharmaceutical compositions can be dipolar,
neutral, or mono-charged. By "dipolar peptide" is meant a peptide
having a positively charged amino acid (e.g., K, R, or H) at one
terminus and a negatively charged amino acid (e.g., D or E) at the
other terminus. The charge of an amino acid residue refers to its
charge as imparted by its side chain, not to the charge resulting
from a free amino or carboxy terminus. In addition to the peptides
KAD and KFD, other examples of dipolar tripeptides include DAK,
DFK, RAD, RFD, DAR, DFR, KAE, KFE, EAK, EFK, RAE, RFE, EAR, EFR, or
any of the above with the middle residue substituted by another
uncharged residue such as G, I, L, S, T, W, Y, or V. The peptides
can have protected termini. Also useful are peptide mimetics that
mimic the structure of such peptides, but lack peptide bonds.
[0090] The pharmaceutical compositions of the invention can be
included in a container, pack, or dispenser together with
instructions for administration. For example, the instructions can
include directions to use the composition to treat an individual
having or at risk for an amyloidosis.
[0091] Methods of Treatment
[0092] The present invention provides for both prophylactic and
therapeutic methods of treating a subject at risk of (or
susceptible to) a disorder or having a disorder associated with
fibril formation such as an amyloidosis. As used herein, the term
"treatment" is defined as the application or administration of a
therapeutic agent to a patient, or application or administration of
a therapeutic agent to an isolated tissue or cell line from a
patient, who has a disease, a symptom of disease or a
predisposition toward a disease, with the purpose to cure, heal,
alleviate, relieve, alter, remedy, ameliorate, improve or affect
the disease, the symptoms of disease or the predisposition toward
disease. A therapeutic agent includes, but is not limited to, small
molecules, peptides, and antibodies.
[0093] In one aspect, the invention provides a method for
preventing a disease or condition (i.e., decreasing the risk of
contracting, or decreasing the rate at which symptoms appear that
are associated with a disease or condition)associated with fibril
formation caused by a polypeptide containing a discordant helix, by
administering to the subject a compound that stabilizes the
.alpha.-helical form of the polypeptide. Subjects at risk for a
disease (e.g., an amyloidosis) that is caused or exacerbated by
such polypeptides can be identified by, for example, any or a
combination of appropriate diagnostic or prognostic assays known in
the art. Administration of a prophylactic agent can occur prior to
the manifestation of symptoms characteristic of the disease, such
that the disease is prevented or, alternatively, delayed in its
progression.
[0094] In instances where a target antigen (e.g., discordant helix)
is intracellular and whole antibodies are used to treat the
subject, internalizing antibodies may be preferred. Lipofectin or
liposomes can be used to deliver the antibody or a fragment of the
Fab region that binds to the target antigen into cells. Where
fragments of the antibody are used, the smallest inhibitory
fragment that binds to the target antigen is preferred. For
example, peptides having an amino acid sequence corresponding to
the Fv region of the antibody can be used. Alternatively, single
chain neutralizing antibodies that bind to intracellular target
antigens can also be administered. Such single chain antibodies can
be administered, for example, by expressing nucleotide sequences
encoding single-chain antibodies within the target cell population
(see e.g., Marasco et al., 1993, Proc. Natl. Acad. Sci. USA
90:7889-7893).
[0095] The compounds that stabilize the .alpha.-helical form of a
discordant helix-containing polypeptide can be administered to a
patient at therapeutically effective doses to prevent, treat or
ameliorate disorders involving fibril formation (e.g.,
amyloidoses). A therapeutically effective dose refers to that
amount of the compound sufficient to result in amelioration of
symptoms of the disorders. Toxicity and therapeutic efficacy of
such compounds can be determined by standard pharmaceutical
procedures as described above.
[0096] The invention will be further described in the following
examples, which do not limit the scope of the invention described
in the claims.
EXAMPLES
[0097] To test the hypothesis that .alpha.-helices for which
.beta.-strand structures are predicted are prone to undergo a
transition from .alpha.-helix conformation to .beta.-strand
conformation and amyloid formation, we searched for conflicts
between .alpha.-helices that were previously determined and
predicted extended structures in 1324 non-redundant entries in a
protein data bank. The data demonstrate a correlation between the
presence of a discordant helix in a polypeptide and the ability of
the polypeptide to form amyloid fibrils under physiological
conditions.
Example 1
Identification of .alpha.-Helical Protein Segments that are
Predicted to Form .beta.-Strands
[0098] The occurrence of .alpha.-helices that have a high
statistical likelihood of being in .beta.-strand conformation was
analyzed by submitting a non-redundant set of protein sequences
with known three-dimensional structures (1324 proteins; a total of
269,058 amino acid residues) to the neural network program PHD for
secondary structure prediction.
[0099] Protein Data Set
[0100] A non-homologous set of proteins used for this study was
generated using the May 1999 list of PBD_SELECT (Hobohm et al.,
1992, Protein Sc., 1:409-417; Hobohm et al., 1994, Protein Sci.,
3:522-524) from the Brookhaven database (Berman et al., 2000,
Nucleic Acids Res. 28:235-242). This list consisted of 1106 chain
identifiers, where all proteins have less than 25% residue identity
in pairwise comparisons. A new version of PBD_SELECT was released
in November of 1999 (November set). Proteins from the November set
that were non-overlapping with the May set were added to the data
set used in the studies described herein. The comparisons between
the two releases to determine which proteins were non-overlapping
were made using FASTA (Pearson et al., 1998, Proc. Natl. Acad. Sci.
USA, 85:2444-2448). Proteins in the November set that had an
expected value higher than 0.1 compared to any of the proteins in
the May set were added to the May set to produce the complete set
of proteins studied as described herein. A total of 218
non-overlapping proteins from the November set were added to the to
the May data set. The resulting data set of protein structures
investigated thus consisted of 1324 non-homologous proteins.
[0101] Experimentally Determined Secondary Structures
[0102] Secondary structure elements of selected proteins were
extracted from the PBD files by DSSP (Define Secondary Structure of
Proteins; Kabsch et al., 1983, Biopolymers, 22:2577-2637), as
implemented in ICM (Abagyan et al., 1994, J. Mol. Biol.
235:983-1002). This method defines secondary structure elements
from hydrogen bond patterns. The method distinguishes eight
different classes of structure: .alpha.-helix (H); 3.sub.10-helix
(G); .pi.-helix (I); extended strand (E); isolated .beta. bridge
(B); turn (T); bend (S), and coil (--). Herein three classes of
secondary structures are being considered: helix (H, G and I);
strand (E); and loop (B, T, S and --), since these three classes
are employed by the method used for secondary structure prediction.
These experimentally determined structures were compared with the
predicted secondary structures generated by PHD, described
below.
[0103] Predicted Secondary Structures
[0104] The sequence-specific secondary structures for the proteins
in the data set were predicted using PHD (Profile network from
HeiDelberg; Rost et al., 1993, J. Mol. Biol. 232:584-599; Rost et
al., 1994, Proteins 19:55-77). PHD employs a system of neural
networks and has an overall accuracy of about 72%.
[0105] Chou and Fasman (1978, Adv. Enzymol. 47:45-148) used the
sequences of 29 proteins to calculate the amino acid distributions
in helices, P.alpha., and beta strands, P.beta.. The P values are
calculated as the frequency of each amino acid residue in
.alpha.-helix (or .beta.-strand) regions divided by the average
frequency of all residues in .alpha.-helix (or .beta.-strand)
regions. For the study herein, the Chou and Fasman values were
recalculated using the PDB May data set described above. Chains
that correspond to transmembrane proteins were removed from the
data set, resulting in a set of 1091 proteins. Stretches of a least
five consecutive residues of helix (H) or beta strand (E), were
included in the calculations. The resulting P.alpha. and P.beta.
values are provided in Table 1. Table 1 shows the calculated
propensities of each of the twenty amino acids to occur in an
.alpha.-helix or in a .beta.-strand. These calculations were based
on available protein three-dimensional structures in the protein
databank (PDB), derived as described herein. The values in Table 1
were used to predict the secondary structures of different protein
segments (see FIGS. 2, 4, and 5) as described below. The Chou and
Fasman values confirm the results of the database search done using
PHD (see FIG. 1, infra).
1TABLE 1 Propensity values for .alpha.-helices (P.alpha.) and
.beta.-strands (P.beta.) calculated according to the method of Chou
and Fasman (Chou et al., 1978, Adv. Enzymol., 47:45-148) from a set
of 1091 non-redundant proteins. The P.alpha. and P.beta. values
derived originally from a set of 29 proteins are given in
parentheses. P values that differ >0.15 between the two data
sets are in boldface type. Amino Acid P.alpha. P.beta. A 1.46
(1.42) 0.78 (0.83) C 0.75 (0.70) 1.26 (1.19) D 0.83 (1.01) 0.51
(0.54) E 1.37 (1.51) 0.69 (0.31) F 0.97 (1.13) 1.49 (1.38) G 0.43
(0.57) 0 69 (0.75) H 0.90 (1.00) 1.05 (0.87) I 1.07 (1.08) 1.65
(1.60) K 1.14 (1.16) 0.78 (0.74) L 1.36 (1.21) 1.13 (1.30) M 1.25
(1.45) 1.10 (1.05) N 0.72 (0.67) 0.64 (0.89) P 0.40 (0.57) 0.32
(0.55) Q 1.34 (1.11) 0.82 (1.10) R 1.24 (0.98) 0.88 (0.93) S 0.76
(0.77) 0.88 (0.75) T 0.76 (0.83) 1.21 (1.19) V 0.94 (1.06) 1.89
(1.70) W 1.05 (1.08) 1.39 (1.37) Y 0.95 (0.69) 1.47 (1.47)
[0106] Comparison of Experimentally Determined and Predicted Data
Sets
[0107] The occurrence of .alpha.-helices that have high statistical
likelihood of being in .beta.-strand conformation was analyzed by
submitting the experimentally determined data set whose proteins
have known three-dimensional structures to the neural network
program PHD for secondary structure prediction, generating a
predicted data set.
[0108] Comparison of the experimentally determined and predicted
data sets revealed 37 proteins containing 7-residue or longer
.alpha.-helices that were predicted (PHD reliability index >5)
to be in .beta.-strand conformation (FIG. 1). This condition is
referred to as .alpha.-helix/.beta.-strand discordance and such
helices are discordant helices. The number of discordant stretches
increases steeply for segments containing at 6-residues or less
(FIG. 1).
[0109] Secondary structure predictions based on .alpha.-helix and
.beta.-strand propensity values that were calculated according to
the Chou-Fasman methods (Chou et al., 1978, Adv. Enzymol.
47:45-148; Table 1) produced results in agreement with the PHD
results, confirming the .alpha.-helix/.beta.-strand discordant
nature of the identified segments (FIG. 2). Only proteins with
>7-residue discordant helices were subjected to additional
analysis. FIG. 2 illustrates the amino acid sequences as well as
experimentally determined and predicted secondary structures for
the 17 proteins with >9-residue discordant segments. The
8-residue discordant segment of the A.beta. peptide and the
discordant segments of all three prion proteins for which NMR
structures were determined (Zahn et al., Proc. Natl. Acad. Sci.
USA, 97:145-150, 2000; Riek et al., Nature, 382: 180-182, 1996;
James et al., Proc. Natl. Acad. Sci. USA, 94:10086-10091, 1997) are
also included in FIG. 2, because of their importance in
amyloidoses.
[0110] The proteins identified as containing .alpha./.beta.
discordant segments represent a wide variety of structures (ranging
from single helical peptides to large globular proteins with
complex .alpha./.beta. architectures), localizations (nuclear,
cytosolic, integral and peripheral membrane proteins, as well as
extracellular proteins), and species of origin (ranging from virus
to human). The proteins encompass three proteins known to be
amyloidogenic in vivo, i.e., the prion protein (PrP, 12- or
15-residue discordant segment, depending on species, in helix 2),
the A.beta. peptide (8-residue segment), and SP-C (16-residue
segment) (FIGS. 1 and 2). No consensus pattern in the primary
structures of the .alpha.-helix/.beta.-strand discordant segments
could be detected. A proposed consensus sequence for
amyloid-forming proteins was not found (Kurochkin, 1998, FEBS
Letters 427:153-156), nor was a binary pattern of hydrophobic and
hydrophilic residues found in the fibrillating peptides (West et
al., 1999, Proc. Natl. Sci. USA 96:11211-11216).
[0111] Among the proteins with >7-residue discordant segments,
four are integral membrane proteins or parts thereof
(bacteriorhodopsin, cytochrome c oxidase, SP-C, A.beta.). The
driving forces for .alpha.-helix formation in a membrane
environment differ from those in aqueous solution (Li et al., 1994,
Nat. Struct. Biol. 1:368-373) and the secondary structure
prediction methods used herein were based mainly on structural data
from soluble proteins. However, both A.beta. and SP-C form amyloid
in vivo. Although the proteins identified as containing discordant
helices encompass a broad range of functions, many are enzymes
(23/37 proteins) or other proteins that bind ligands (FIGS. 1 and
2).
[0112] A discordant helix of the invention can harbor an active
site residue or ligand-interacting residue. For example, the
metalloproteases astacin (1iab) and adarnalysin II (3aig), and
methane monoxygenase (1mty) harbor zinc- or iron-binding residues
in their respective discordant helix (Bode et al., 1992, Nature
358:164-167; Gomis-Ruth et al., 1998, Protein Sci. 7:283-289;
Rosenzweig et al., 1995, Chem. Biol. 2:409-418). The discordant
helix of heme-binding protein A (1B2v) contains several residues
important for heme binding (Amoux et al., 1999, Nat. Struct. Biol.
6:516-520). In the Arf exchange factor ARNO (1pbv), the discordant
helix is involved in Arf binding (Cherfils et al., 1998, Nature
392:101-105); the discordant helix of the light-driven ion pump
bacteriorhodopsin (1bcr) binds the photo-sensitive retinal
(Barsukov et al., 1992, Eur. J. Biochem. 206:665-672, 1992). The
active-site serine of Streptomyces R61 transpeptidase is located in
the discordant helix (Kelly et al., 1985, J. Biol. Chem.
260:6449-6458).
Example 2
Protein Analysis and Electron Microscopy of Proteins with Long
Discordant Helices
[0113] Formation of fibrils was investigated in three different
proteins having long discordant helices by incubating proteins,
centrifuging, and examining the pellets for fibrils using electron
microscopy. In addition, the effect on fibril formation of a valine
to leucine substitution in a discordant helix of a fourth protein
(SP-C) was investigated.
[0114] The proteins used in these experiments included SP-C (lung
SP-C forms amyloid in pulmonary alveolar proteiriosis) purified
from porcine lungs (Curstedt et al, 1987, Eur. J. Biochem.
168:255-262). PolyVal.fwdarw.polyLeu substituted SP-C (SP-C(Leu))
analogue was synthesized as described by Nilsson et al. (1998, Eur.
J. Biochem. 255:116-124) was used in the experiments as was
D-analyl-D-alanine transpeptidase from Streptomyces R61 was
obtained from Drs. Frere and Joris, University of Liege, Belgium
(Frere et al, 1973, Biochem. J. 135:463-468). Triacylglycerol
lipase from Candida antarctica and human coagulation factor XIII
were purchased from Sigma. For these fibrillation studies the
latter three proteins were dissolved in phosphate buffered saline,
pH 7.4, in concentrations ranging from 10 .mu.M to 100 .mu.M. SP-C
and SP-C (Leu) were dissolved at 100 .mu.M or 250 .mu.M in
chloroform/methanol/0.1 M HCl, 32:64:5 (by volume).
[0115] To assay for the formation of fibrils, the protein solutions
were incubated at 37.degree. C. for three days, then centrifuged at
20,000.times.g for 20 minutes. The concentrations of SP-C and
SP-C(Leu) in the supernatants were determined by amino acid
analysis of triplicate samples. Peptide concentration at start of
the incubations was 250 .mu.M for SP-C(Leu) and 100 .mu.M for
SP-C.
[0116] For analysis of fibrils by electron microscopy, the
20,000.times.g pellets were resuspended in a small volume of water
using low-energy sonication for 5 seconds. Aliquots of 8 .mu.l were
placed on grids covered by a carbon-stabilized Formvar.RTM. film.
Excess fluid was withdrawn after 30 seconds. The grids were
air-dried and negatively stained with 2% uranyl acetate in water.
The strained grids were examined and photographed in a Philips
CM120-TWIN electron microscope operated at 80 kV.
[0117] D-analyl-D-alanine transpeptidase, triacylglycerol lipase,
and coagulation factor XIII were all found to form fibrils under
the experimental conditions. In the case of SP-C, fibrils were
readily detected in the 20,000.times.g pellets within a few hours
of incubation (Gustafson et al., 1999, FEBS Lett. 464:138-142),
while for SP-C(Leu) no or very few fibrils were found after three
days of incubation.
[0118] These data demonstrate that the presence of a discordant
helix can predict formation of fibrils, reflecting the ability of
these proteins to form .beta.-strand structures that can contribute
to amyloid formation. Furthermore, the dramatic reduction in the
number of fibrils formed by SP-C(Leu) shows that alteration of the
discordant helix can prevent or slow fibril formation.
Example 3
.alpha./.beta. Discordant Segments Predispose to Amyloid Fibril
Formation
[0119] Three proteins known to be amyloidogenic and associated with
disease were found among the .alpha./.beta. discordant proteins.
The fibril formation properties of additional proteins containing
predicted discordant helices were investigated.
[0120] As described above, transpeptidase from Streptomyces R61
(15-residue discordant stretch), triacylglycerol lipase from
Candida antarctica (11-residue stretch), and human coagulation
factor XIII (9-residue segment) were found to form amyloid fibrils
upon incubation for 3 days in phosphate buffered saline at pH 7.4
at 37.degree. C. Thus, 6/37 proteins with .gtoreq.7-residue long
.alpha./.beta. discordant segments, and 4/10 with segments of
.gtoreq.11 residues, were analyzed for fibril formation. All form
amyloid fibrils.
[0121] The correlation between .alpha./.beta. discordance and
fibril formation suggests a causal connection between these two
phenomena. We thus predicted that changes in amino acid sequences
that abolish .alpha./.beta. discordance would reduce amyloid
formation. Two approaches were used to test this. First, all of the
valine residues in the .alpha.-helix/.beta.-strand discordant
segment of SP-C were replaced with leucine, yielding a peptide,
SP-C(Leu), with helical conformation as judged by circular
dichroism and infrared spectroscopy (Nilsson et al, 1998, Eur. J.
Biochem. 255:116-124). Val to Leu substitutions in SP-C abolish
.alpha./.beta. discordance and reduce amyloid formation (FIG. 4).
FIG. 2 depicts the sequence of native SP-C and its predicted
secondary structure. The localization of the .alpha.-helix of
SP-C(Leu) is inferred from the NMR data of the native peptide
(Johansson et al., 1994, Biochemistry 33:6015-6023) and CD and FTIR
spectroscopic analyses of the analogue (Nilsson et al, 1998, Eur.
J. Biochem. 25 255:116-124).
[0122] The time-dependent aggregation of SP-C and SP-C(Leu) showed
striking differences (FIG. 4). SP-C started to precipitate during
the first hours of incubation and showed extensive aggregation
after 5 and 15 days. SP-C(Leu) showed no signs of precipitation
during the same time period. The leucine-substituted analogue
formed few fibrils after incubation for three days at 250 .mu.M
concentration, while SP-C formed abundant fibrils at a
concentration of 100 .mu.M. Thus, fibril formation and peptide
aggregation is greatly reduced by converting the discordant helix
of SP-C to a helix composed of residues that favor the helical
conformation.
[0123] In a second approach, a synthetic analogue of the A.beta.
peptide that lacks residues 14-23, and thus is devoid of the
.alpha./.beta. discordant stretch between residues 16 and 23 (FIG.
2) but otherwise identical to human A.beta.(1-42) was incubated
under conditions where A.beta.(1-42) readily forms fibrils
(Tjernberg et al., 1999, J. Biol. Chem. 274:12619-12625). The
synthetic analogue did not form fibrils. Moreover, A.beta.(1-28)
with alanine substitutions at positions 16, 17, and 20 does not
form fibrils, while unsubstituted A.beta.(1-28) forms fibrils which
are similar to those formed by A.beta.(1-42) (Tjemberg et al.,
1996, J. Biol. Chem., 271:8545-8548). We discovered that
substitution of alanine into positions 16, 17, and 20 reverts
.alpha./.beta. discordance and a helix is predicted between
residues 15 and 21 (FIG. 5). Thus, when discordant helix is removed
from an A.beta. peptide, or rendered non-discordant by replacement
of three residues, the peptide no longer forms fibrils.
[0124] These data support a causal link between the presence of a
discordant helix in a protein and fibril formation that is expected
to lead to the formation of amyloid.
Example 4
Effects of Peptides on A.beta.(1-40), A.beta.(12-24), and
A.beta.(14-23) Fibril Formation
[0125] The 39-43 amino acid residue amyloid .beta.-peptide
(A.beta.) is present in amyloid plaques found in association with
Alzheimer's disease (Selkoe, 2000, J. American Medical Association
283:1615-1617). In addition, the amount of A.beta.(1-42) in
Alzheimer's disease plaques correlates with disease progression,
implying that A.beta. is a rational therapeutic target (Nslund et
al., 2000, J. American Medical Association 283:1571-1577). A.beta.
is generated by proteolytic cleavage of a large transmembrane
protein, the amyloid precursor protein (APP). The present studies
evaluate various peptides for their ability to inhibit the fibril
formation by A.beta. peptides.
[0126] Synthetic peptides corresponding to human A.beta. fragments
1-40 (amino acid sequence DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV;
SEQ ID NO:3), 12-24, and 14-23 were purchased from Research
Genetics, Huntsville, Ala., USA. A.beta.(1-40) was purified by
reverse-phase HPLC over a C18 column, using a linear gradient of
acetonitrile running into 0.1% trifluoroacetic acid for elution.
The purified peptide was lyophilized, stored at -20.degree. C. and
dissolved shortly before experiments. The tripeptides and
tetrapeptides were synthesized and purified by reverse-phase HPLC
(>70% purity) by Interactiva, Darmstadt, Germany.
[0127] The relative abundance and morphology of fibrils was
determined by electron microscopy after incubating each of the
three A.beta. peptides (100 .mu.M) for three days at 37.degree. C.
in phosphate buffered saline (50 mM sodium phosphate/150 mM NaCl,
pH 7.4) in the presence of 1 mM of a specific tripeptide or
tetrapeptide ligand. Aggregates were collected by centrifugation at
20,000.times.g for 20 minutes. The pellets were suspended in a
small volume of water by low-energy sonication for 5 seconds.
Aliquots of 8 .mu.l were placed on electron microscopy grids
covered by a carbon-stabilized formvar film. Excess fluid was
withdrawn after 30 seconds, and after air-drying the grids were
negatively stained with 2% uranyl acetate in water. The stained
grids were examined and photographed in a Philips CM120TWIN
electron microscope operated at 80 kV. For a semi quantitative
evaluation of the amount of material in the different specimens,
the grids (50 mesh) were first scanned at low magnification and the
number of larger fibril bundles per grid square estimated. The
specimens were subsequently examined at high magnification to judge
the size of the fibril bundles, the presence of smaller fibril
aggregates, and the morphology of the individual fibrils.
[0128] In these experiments, the density of fibrils with a
morphology similar to that of fibrils formed from the A.beta.
peptides in the absence of tripeptides or tetrapeptides was
estimated. For all three A.beta. peptides, a significant reduction
of fibril density was observed in the presence of the KAD
tripeptide, but not in the presence of FRF, AAA, KKK, or DDD
tripeptides (FIG. 6A-6C). A KAD peptide with blocked N- and
C-termini (acetyl-KAD-amide) was found to be equally efficient in
reducing A.beta.(1-40) fibril formation as the KAD peptide with
free termini (FIG. 6C). Likewise, both AAA and acetyl-AAA-amide
showed no significant effect on A.beta.(1-40) fibrillation (FIG.
6C). These experiments indicate that a tripeptide with a dipolar
character can reduce A.beta. fibril formation, and that the region
between A.beta. residues 14 and 23 is involved in
tripeptide/A.beta. interactions.
[0129] The importance of the identity of the central amino acid
residue of the ligand peptide and of ligand peptide length was also
investigated. Replacing the central A1a with Phe resulted in a
tripeptide (KFD) that reduced A.beta.(14-23) fibril formation, but
to a lesser extent than KAD (FIG. 7). Extending the length of the
dipolar peptides by one residue resulted in peptides that caused no
detectable reduction of A.beta.(14-23) fibrillation (FIG. 7). The
tetrapeptide KFFE (SEQ ID NO: 1) appeared to slightly promote
fibril formation (FIG. 7).
Example 5
Effects of Peptides on Aggregation of A.beta.(1-40)
[0130] The effects of the peptides KAD, AAA, and KFFE (SEQ ID NO:
1) on the time-dependent aggregation of A.beta.(1-40), determined
as the amount of A.beta.(1-40) left in solution after
20,000.times.g centrifugation, were studied. In the presence of
AAA, A.beta.(1-40) completely aggregated in 10-15 days. In the
presence of KAD, A.beta.(1-40) completely aggregated in 30-40 days.
In the presence of KFFE (SEQ ID NO: 1), A.beta.(1-40) completely
aggregated in about 3 days (FIG. 8). These results are in agreement
with the results obtained from the fibrillation studies presented
in Example 4 regarding the relative efficiency of KAD, AAA and KFFE
(SEQ ID NO:1) in reducing A.beta. fibrillation (FIGS. 6 and 7).
Example 6
Effects of Peptides on Fibril Morphology
[0131] The presence of the KAD peptide resulted in the formation of
fibrils with different morphology than those formed in its absence
or in the presence of other tripeptides or tetrapeptides. The
presence of the KAD, or acetyl-KAD-amide, peptide resulted in
fibrillar structures that were much shorter and more dispersed than
those formed in the presence of AAA or acetyl-AAA-amide (FIGS.
9A-9E). The presence of other tripeptides or tetrapeptides
investigated resulted in very similar fibril morphology as seen
with AAA.
Example 7
Structures of Tripeptides and Tetrapeptides and Separation of
Charges in A.beta.(16-23)
[0132] The different effects observed in Example 4-7 for
KAD/acetyl-KAD-amide, as compared to AAA/acetyl-AAA-amide, FRF,
KKK, and DDD may be the result of the peptides' different charge
distributions. These Examples show that the dipolar KAD, but not
the neutral or mono-charged tripeptides, interfere with A.beta.
aggregation and fibril formation. In addition, a reduction of
fibril formation is also seen with the dipolar KFD peptide,
although to a lesser extent than that observed with KAD.
[0133] The dipolar KAAE (SEQ ID NO:2) and KFFE (SEQ ID NO: 1) did
not reduce A.beta. fibrillation or aggregation. This was somewhat
unexpected considering the similarities to the KAD peptide (the
separation of the side-chain charges in KAD in an energy-minimized
conformation is 10 .ANG. and the corresponding distance in KFFE is
11 .ANG.). However, the KFFE (SEQ ID NO: 1) peptide has a
propensity to form a significant portion of .beta.-stranded
structure, as detected by a minimum at 215 nm by circular dichroism
(CD) spectroscopy, while KAD shows a typical random coil CD
spectrum with a minimum only at about 200 nm. The structure of KFFE
(SEQ ID NO:1) in extended conformation is shown in FIG. 10,
together with the energy-minimized and extended structures of KAD
for comparison. The charged side-chains of KAD are separated by
10-11 .ANG.. In contrast, the Lys and Glu side-chains are on
opposite sides of the polypeptide backbone in KFFE (SEQ ID NO:1)
and no meaningful distance between them can be measured. The
relevance of these different charge separations was judged in
relation to the charge separations in A.beta.. The shortest A.beta.
peptide investigated herein encompassed residues 14-23 and the
smallest helical region detected in this part of A.beta. covers
residues 15-23. A.beta.(15-23) has been found to be helical in the
presence of membrane-mimicking solvents or detergents, and forms a
.beta.-strand structure in the fibrils. We therefore modeled
A.beta.(15-23) in .alpha.-helical and .beta.-strand conformation
(FIG. 11). The separation of side-chain charges of Lys16 and
Glu22/Asp23 is 12-13 .ANG. in helical conformation and Lys16 and
Glu22 are separated by 21 .ANG. in .beta.-strand conformation,
while Lys16 and Asp23 are on opposite sides of the polypeptide
backbone. Consequently, the separation of the charged side-chains
of KAD, independent of its conformation, is close to the separation
of the charges of the side-chains of Lys 16 and Glu22/Asp23 in
A.beta.(15-23) in helical conformation, while the charge separation
of KFFE (SEQ ID NO: 1) in a conformation that it adopts in solution
according to CD measurements does not match the charge separation
of A.beta.(15-23) in either helical or extended conformation.
Sequence CWU 1
1
26 1 4 PRT Artificial Sequence Synthetically generated peptide 1
Lys Phe Phe Glu 1 2 4 PRT Artificial Sequence Synthetically
generated peptide 2 Lys Ala Ala Glu 1 3 40 PRT Artificial Sequence
Synthetically generated peptide 3 Asp Ala Glu Phe Arg His Asp Ser
Gly Tyr Glu Val His His Gln Lys 1 5 10 15 Leu Val Phe Phe Ala Glu
Asp Val Gly Ser Asn Lys Gly Ala Ile Ile 20 25 30 Gly Leu Met Val
Gly Gly Val Val 35 40 4 35 PRT Artificial Sequence Synthetically
generated peptide 4 Ala Gly Ile Val Pro Leu Asn Ile Glu Thr Leu Leu
Phe Met Val Leu 1 5 10 15 Asp Val Ser Ala Lys Val Gly Phe Gly Leu
Ile Leu Leu Arg Ser Arg 20 25 30 Ala Ile Phe 35 5 25 PRT Artificial
Sequence Synthetically generated peptide 5 Asn Leu Lys Arg Leu Leu
Val Val Val Val Val Val Val Leu Val Val 1 5 10 15 Val Val Ile Val
Gly Ala Leu Leu Met 20 25 6 43 PRT Artificial Sequence
Synthetically generated peptide 6 Gly Gly Gly Gly Val Asp Val Gly
Asp Val Val Ser Ala Ile Gln Gly 1 5 10 15 Ala Ala Gly Pro Ile Ala
Ala Ile Gly Gly Ala Val Leu Thr Val Met 20 25 30 Val Gly Ile Lys
Val Tyr Lys Trp Val Arg Arg 35 40 7 17 PRT Artificial Sequence
Synthetically generated peptide 7 Gly Ser Val Thr Lys Ser Phe Ser
Ala Val Val Leu Leu Gln Leu Val 1 5 10 15 Asp 8 22 PRT Artificial
Sequence Synthetically generated peptide 8 Asn Asn Phe Val His Asp
Cys Val Asn Ile Thr Ile Lys Gln His Thr 1 5 10 15 Val Thr Thr Thr
Thr Lys 20 9 11 PRT Artificial Sequence Synthetically generated
peptide 9 Gln Lys Leu Val Phe Phe Ala Glu Asp Val Gly 1 5 10 10 23
PRT Artificial Sequence Synthetically generated peptide 10 Gln Asn
Asn Phe Val His Asp Cys Val Asn Ile Thr Ile Lys Gln His 1 5 10 15
Thr Val Thr Thr Thr Thr Lys 20 11 23 PRT Artificial Sequence
Synthetically generated peptide 11 Gln Asn Asn Phe Val His Asp Cys
Val Asn Ile Thr Ile Lys Gln His 1 5 10 15 Thr Val Thr Thr Thr Thr
Lys 20 12 19 PRT Artificial Sequence Synthetically generated
peptide 12 Thr Asp Thr Cys Tyr Val Leu Ser Phe Ala Val Ile Met Leu
Asn Thr 1 5 10 15 Ser Leu His 13 27 PRT Artificial Sequence
Synthetically generated peptide 13 Ile Thr Pro Thr Val Phe Leu Ser
Ile Glu Thr Asp Glu Leu Arg His 1 5 10 15 Met Ala Asn Gly Tyr Gln
Thr Val Val Ser Ile 20 25 14 13 PRT Artificial Sequence
Synthetically generated peptide 14 Gln Gly Gly Ala Val Val Phe His
Thr Ala Phe Ile Asn 1 5 10 15 19 PRT Artificial Sequence
Synthetically generated peptide 15 Tyr Ile Leu Phe Trp Asn His Val
Gly Leu Glu Leu Asn Arg Val Thr 1 5 10 15 His Thr Val 16 17 PRT
Artificial Sequence Synthetically generated peptide 16 Gly Ser Leu
Thr Ser Gln Phe Ser Tyr Val Val Gly Arg Ser Ala Leu 1 5 10 15 Arg
17 27 PRT Artificial Sequence Synthetically generated peptide 17
Phe His Asp Lys Tyr Gly Asn Ala Val Leu Ala Ser Gly Ala Thr Phe 1 5
10 15 Cys Val Ala Val Trp Val Tyr Met Ala Thr Gln 20 25 18 17 PRT
Artificial Sequence Synthetically generated peptide 18 Ser Trp Ala
Arg Ala Thr Val Val Ala Leu Ser Ile Val Met Ser Arg 1 5 10 15 Gln
19 25 PRT Artificial Sequence Synthetically generated peptide 19
Pro Tyr Met Glu Gly Val Asn Pro Phe Ile Lys Ser Asn Lys His Arg 1 5
10 15 Met Ile Met Phe Leu Asp Glu Leu Gly 20 25 20 13 PRT
Artificial Sequence Synthetically generated peptide 20 Phe Trp Lys
Val Phe Pro Val Arg Val Phe Arg Leu Leu 1 5 10 21 11 PRT Artificial
Sequence Synthetically generated peptide 21 Val Val His Gln Val Val
Tyr Gly Leu Met Ser 1 5 10 22 12 PRT Artificial Sequence
Synthetically generated peptide 22 Pro Glu Ile Ile Val Gly Ile Ile
Gly Val Glu Thr 1 5 10 23 11 PRT Artificial Sequence Synthetically
generated peptide 23 Pro Ile Lys Val Ser Arg Val Gly Ser Ala Met 1
5 10 24 25 PRT Artificial Sequence Synthetically generated peptide
24 Asn Leu Lys Arg Leu Leu Leu Leu Leu Leu Leu Leu Leu Leu Leu Leu
1 5 10 15 Leu Leu Ile Leu Gly Ala Leu Leu Met 20 25 25 11 PRT
Artificial Sequence Synthetically generated peptide 25 Gln Lys Leu
Val Phe Phe Ala Glu Asp Val Gly 1 5 10 26 11 PRT Artificial
Sequence Synthetically generated peptide 26 Gln Ala Ala Val Phe Ala
Ala Glu Asp Val Gly 1 5 10
* * * * *