U.S. patent application number 10/967189 was filed with the patent office on 2005-03-10 for staphylococcus aureus genes and polypeptides.
This patent application is currently assigned to Human Genome Sciences, Inc.. Invention is credited to Choi, Gil H., Simpson, Andrew J.G..
Application Number | 20050053995 10/967189 |
Document ID | / |
Family ID | 27373335 |
Filed Date | 2005-03-10 |
United States Patent
Application |
20050053995 |
Kind Code |
A1 |
Simpson, Andrew J.G. ; et
al. |
March 10, 2005 |
Staphylococcus aureus genes and polypeptides
Abstract
The present invention relates to 11 novel genes from S. aureus
and the polypeptides they encode. Also provided as are vectors,
host cells, antibodies and recombinant methods for producing the
same. The invention further relates to screening methods for
identifying agonists and antagonists of S. aureus polypeptide
activity. The invention additionally relates to diagnostic methods
for detecting Staphylococcus nucleic acids, polypeptides and
antibodies in a biological sample. The present invention further
relates to novel vaccines for the prevention or attenuation of
infection by Staphylococcus.
Inventors: |
Simpson, Andrew J.G.; (Sao
Paulo, BR) ; Choi, Gil H.; (Rockville, MD) |
Correspondence
Address: |
HUMAN GENOME SCIENCES INC
INTELLECTUAL PROPERTY DEPT.
14200 SHADY GROVE ROAD
ROCKVILLE
MD
20850
US
|
Assignee: |
Human Genome Sciences, Inc.
Rockville
MD
Ludwig Institute for Cancer Research
Sao Paulo
|
Family ID: |
27373335 |
Appl. No.: |
10/967189 |
Filed: |
October 19, 2004 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
10967189 |
Oct 19, 2004 |
|
|
|
10278946 |
Oct 24, 2002 |
|
|
|
6821754 |
|
|
|
|
10278946 |
Oct 24, 2002 |
|
|
|
09830217 |
Jan 15, 2002 |
|
|
|
6521441 |
|
|
|
|
09830217 |
Jan 15, 2002 |
|
|
|
PCT/US99/06199 |
Mar 18, 1999 |
|
|
|
60080296 |
Apr 1, 1998 |
|
|
|
60084674 |
May 7, 1998 |
|
|
|
60078682 |
Mar 20, 1998 |
|
|
|
Current U.S.
Class: |
435/6.16 ;
424/190.1; 435/252.3; 435/320.1; 435/69.3; 530/350; 536/23.7 |
Current CPC
Class: |
A61K 38/00 20130101;
A61P 31/04 20180101; C07K 14/31 20130101; A61K 39/00 20130101 |
Class at
Publication: |
435/006 ;
435/069.3; 435/252.3; 435/320.1; 530/350; 536/023.7; 424/190.1 |
International
Class: |
C12Q 001/68; C07H
021/04; A61K 039/02 |
Claims
What is claimed is:
1. An isolated nucleic acid molecule comprising a polynucleotide
having a nucleotide sequence selected from the group consisting of:
(a) a nucleotide sequence encoding any one of the amino acid
sequences of the polypeptides shown in Table 1; (b) a nucleotide
sequence complementary to any one of the nucleotide sequences in
(a); (c) a nucleotide sequence at least 95% identical to any one of
the nucleotide sequences shown in Table 1; and (d) a nucleotide
sequence at least 95% identical to a nucleotide sequence
complementary to any one of the nucleotide sequences shown in Table
1.
2. An isolated nucleic acid molecule comprising a polynucleotide
which hybridizes under stringent hybridization conditions to a
polynucleotide having a nucleotide sequence identical to a
nucleotide sequence in (a) or (b) of claim 1.
3. An isolated nucleic acid molecule comprising a polynucleotide
which encodes an epitope-bearing portion of a polypeptide in (a) of
claim 1.
4. The isolated nucleic acid molecule of claim 3, wherein said
epitope-bearing portion of a polypeptide comprises an amino acid
sequence listed in Table 2.
5. A method for making a recombinant vector comprising inserting an
isolated nucleic acid molecule of claim 1 into a vector.
6. A recombinant vector produced by the method of claim 5.
7. A host cell comprising a vector of claim 6.
8. A method of producing a polypeptide comprising: (a) growing the
host cell of claim 7 such that the protein is expressed by the
cell; and (b) recovering the expressed polypeptide.
9. A polypeptide produced according to the method of claim 8.
10. An isolated polypeptide comprising a polypeptide selected from
the group consisting of: (a) a polypeptide consisting of any one of
the complete amino acids sequences of Table 1; (b) a polypeptide
consisting of any one of the complete amino acids sequences of
Table 1 except the N-terminal residue; (c) a fragment of the
polypeptide of (a) having biological activity; (d) a fragment of
the polypeptide of (a) which binds to an antibody specific for the
polypeptide of (a); (e) a polypeptide comprising an amino acid
sequence at least 95% identical to a sequence selected from the
group consisting of an amino acid sequence of any one of the
polypeptides in Table 1; and (f) a polypeptide antigen comprising
an amino acid sequence of an S. aureus epitope shown in Table
2.
11. An isolated nucleic acid molecule comprising a polynucleotide
with a nucleotide sequence encoding a polypeptide of claim 10.
12. An isolated antibody which specifically binds to the
polypeptide of claim 10.
13. A hybridoma which produces the antibody of claim 12.
14. A vaccine, comprising: (a) at least one polypeptide of claim
10; and (b) a pharmaceutically acceptable diluent, carrier, or
excipient; wherein said polypeptide is present in an amount
effective to elicit protective antibodies in an animal to a member
of the Staphylococcus genus.
15. A method of preventing or attenuating an infection caused by a
member of the Staphylococcus genus in an animal, comprising
administering to said animal a polypeptide of claim 10, wherein
said polypeptide is administered in an amount effective to prevent
or attenuate said infection.
16. A method of detecting Staphylococcus nucleic acids in a
biological sample obtained from an animal involving assaying for
one or more nucleic acid sequences encoding Staphylococcus
polypeptides in a sample comprising: (a) contacting the sample with
at least one polynucleotide of claim 2 under conditions such that
hybridization occurs, and (b) detecting hybridization of said
polynucleotide to the one or more Staphylococcus nucleic acid
sequences present in the biological sample.
17. A method of detecting Staphylococcus nucleic acids in a
biological sample obtained from an animal, comprising: (a)
amplifying at least one polynucleotide of claim 2 in a biological
sample obtained from an animal using polymerase chain reaction, and
(b) detecting said amplified polynucleotide.
18. A kit for detecting Staphylococcus antibodies in a biological
sample obtained from an animal, comprising (a) a polypeptide of
claim 10 attached to a solid support; and (b) detecting means.
19. A method of detecting Staphylococcus antibodies in a biological
sample obtained from an animal, comprising (a) contacting the
sample with a polypeptide of claim 10; and (b) detecting
antibody-antigen complexes.
Description
CROSS REFERENCE TO RELATED APPLICATIONS
[0001] This application is a divisional of U.S. application Ser.
No. 10/278,946, filed Oct. 24, 2002, which is a divisional of U.S.
application Ser. No. 09/830,217, filed Jan. 15, 2002, which is the
National Stage of International Application No. PCT/US99/06199,
filed Mar. 18, 1999, which claims priority to U.S. Provisional
Application Nos. 60/084,674, filed May 7, 1998, 60/080,296, filed
Apr. 1, 1998, and 60/078,682, filed Mar. 20, 1998. All of the
foregoing applications are hereby incorporated by reference
herein.
FIELD OF THE INVENTION
[0002] The present invention relates to novel Staphylococcus aureus
genes (S. aureus) nucleic acids and polypeptides. Also provided are
vectors, host cells and recombinant methods for producing the same.
Further provided are diagnostic methods for detecting
Staphylococcus aureus using probes, primers, and antibodies to the
S. aureus nucleic acids and polypeptides of the present invention.
The invention further relates to screening methods for identifying
agonists and antagonists of S. aureus polypeptide activity and to
vaccines using S. aureus nucleic acids and polypeptides.
BACKGROUND OF THE INVENTION
[0003] The genus Staphylococcus includes at least 20 distinct
species. (For a review see Novick, R. P., The Staphylococcus as a
Molecular Genetic System in MOLECULAR BIOLOGY OF THE STAPHYLOCOCCI,
1-37 (R. Novick, Ed., VCH Publishers, New York (1990)). Species
differ from one another by 80% or more, by hybridization kinetics,
whereas strains within a species are at least 90% identical by the
same measure.
[0004] The species S. aureus, a gram-positive, facultatively
aerobic, clump-forming cocci, is among the most important
etiological agents of bacterial infection in humans, as discussed
briefly below.
[0005] Human Health and S. aureus
[0006] Staphylococcus aureus is a ubiquitous pathogen. See, e.g.,
Mims et al., MEDICAL MICROBIOLOGY (Mosby-Year Book Europe Limited,
London, UK 1993). It is an etiological agent of a variety of
conditions, ranging in severity from mild to fatal. A few of the
more common conditions caused by S. aureus infection are burns,
cellulitis, eyelid infections, food poisoning, joint infections,
neonatal conjunctivitis, osteomyelitis, skin infections, surgical
wound infection, scalded skin syndrome and toxic shock syndrome,
some of which are described further below.
[0007] Burns: Burn wounds generally are sterile initially. However,
they generally compromise physical and immune barriers to
infection, cause loss of fluid and electrolytes and result in local
or general physiological dysfunction. After cooling, contact with
viable bacteria results in mixed colonization at the injury site.
Infection may be restricted to the non-viable debris on the burn
surface ("eschar"), it may progress into full skin infection and
invade viable tissue below the eschar and it may reach below the
skin, enter the lymphatic and blood circulation and develop into
septicemia. S. aureus is among the most important pathogens
typically found in burn wound infections. It can destroy
granulation tissue and produce severe septicemia.
[0008] Cellulitis: Cellulitis, an acute infection of the skin that
expands from a typically superficial origin to spread below the
cutaneous layer, most commonly is caused by S. aureus in
conjunction with S. pyrogenes. Cellulitis can lead to systemic
infection. In fact, cellulitis can be one aspect of synergistic
bacterial gangrene. This condition typically is caused by a mixture
of S. aureus and microaerophilic streptococci. It causes necrosis
and treatment is limited to excision of the necrotic tissue. The
condition often is fatal.
[0009] Eyelid infections: S. aureus is the cause of styes and of
sticky eye" in neonates, among other eye infections. Typically such
infections are limited to the surface of the eye, and may
occasionally penetrate the surface with more severe
consequences.
[0010] Food poisoning: Some strains of S. aureus produce one or
more of five serologically distinct, heat and acid stable
enterotoxins that are not destroyed by digestive process of the
stomach and small intestine (enterotoxins A-E). Ingestion of the
toxin, in sufficient quantities, typically results in severe
vomiting, but not diarrhea. The effect does not require viable
bacteria. Although the toxins are known, their mechanism of action
is not understood.
[0011] Joint infections: S. aureus infects bone joints causing
diseases such osteomyelitis. See, e.g., R. Cunningham et al.,
(1996) J. Med. Microbiol. 44:157-164.
[0012] Osteomyelitis: S. aureus is the most common causative agent
of haematogenous osteomyelitis. The disease tends to occur in
children and adolescents more than adults and it is associated with
non-penetrating injuries to bones. Infection typically occurs in
the long end of growing bone, hence its occurrence in physically
immature populations. Most often, infection is localized in the
vicinity of sprouting capillary loops adjacent to epiphysis growth
plates in the end of long, growing bones.
[0013] Skin infections: S. aureus is the most common pathogen of
such minor skin infections as abscesses and boils. Such infections
often are resolved by normal host response mechanisms, but they
also can develop into severe internal infections. Recurrent
infections of the nasal passages plague nasal carriers of S.
aureus.
[0014] Surgical Wound Infections: Surgical wounds often penetrate
far into the body. Infection of such wound thus poses a grave risk
to the patient. S. aureus is the most important causative agent of
infections in surgical wounds. S. aureus is unusually adept at
invading surgical wounds; sutured wounds can be infected by far
fewer S. aureus cells then are necessary to cause infection in
normal skin. Invasion of surgical wound can lead to severe S.
aureus septicemia. Invasion of the blood stream by S. aureus can
lead to seeding and infection of internal organs, particularly
heart valves and bone, causing systemic diseases, such as
endocarditis and osteomyelitis.
[0015] Scalded Skin Syndrome: S. aureus is responsible for "scalded
skin syndrome" (also called toxic epidermal necrosis, Ritter's
disease and Lyell's disease). This diseases occurs in older
children, typically in outbreaks caused by flowering of S. aureus
strains produce exfoliation(also called scalded skin syndrome
toxin). Although the bacteria initially may infect only a minor
lesion, the toxin destroys intercellular connections, spreads
epidermal layers and allows the infection to penetrate the outer
layer of the skin, producing the desquamation that typifies the
diseases. Shedding of the outer layer of skin generally reveals
normal skin below, but fluid lost in the process can produce severe
injury in young children if it is not treated properly.
[0016] Toxic Shock Syndrome: Toxic shock syndrome is caused by
strains of S. aureus that produce the so-called toxic shock
syndrome toxin. The disease can be caused by S. aureus infection at
any site, but it is too often erroneously viewed exclusively as a
disease solely of women who use tampons. The disease involves
toxemia and septicemia, and can be fatal.
[0017] Nocosomial Infections: In the 1984 National Nocosomial
Infection Surveillance Study ("NNIS") S. aureus was the most
prevalent agent of surgical wound infections in many hospital
services, including medicine, surgery, obstetrics, pediatrics and
newborns.
[0018] Other Infections: Other types of infections, risk factors,
etc. involving S. aureus are discussed in: A. Trilla (1995) J.
Chemotherapy 3:37-43; F. Espersen (1995) J. Chemotherapy 3:11-17;
D. E. Craven (1995) J. Chemotherapy 3:19-28; J. D. Breen et al.
(1995) Infect. Dis. Clin. North Am. 9(1):11-24 (each incorporated
herein in their entireties).
[0019] Resistance to Drugs of S. aureus Strains
[0020] Prior to the introduction of penicillin the prognosis for
patients seriously infected with S. aureus was unfavorable.
Following the introduction of penicillin in the early 1940s even
the worst S. aureus infections generally could be treated
successfully. The emergence of penicillin-resistant strains of S.
aureus did not take long, however. Most strains of S. aureus
encountered in hospital infections today do not respond to
penicillin; although, fortunately, this is not the case for S.
aureus encountered in community infections.
[0021] It is well known now that penicillin-resistant strains of S.
aureus produce a lactamase which converts penicillin to
pencillinoic acid, and thereby destroys antibiotic activity.
Furthermore, the lactamase gene often is propagated episomally,
typically on a plasmid, and often is only one of several genes on
an episomal element that, together, confer multidrug
resistance.
[0022] Methicillins, introduced in the 1960s, largely overcame the
problem of penicillin resistance in S. aureus. These compounds
conserve the portions of penicillin responsible for antibiotic
activity and modify or alter other portions that make penicillin a
good substrate for inactivating lactamases. However, methicillin
resistance has emerged in S. aureus, along with resistance to many
other antibiotics effective against this organism, including
aminoglycosides, tetracycline, chloramphenicol, macrolides and
lincosamides. In fact, methicillin-resistant strains of S. aureus
generally are multiply drug resistant.
[0023] Methicillian-resistant S. aureus (MRSA) has become one of
the most important nosocomial pathogens worldwide and poses serious
infection control problems. Today, many strains are multiresistant
against virtually all antibiotics with the exception of
vancomycin-type glycopeptide antibiotics.
[0024] Recent reports that transfer of vancomycin resistance genes
from enterococci to S. aureus has been observed in the laboratory
sustain that fear that MRSA might become resistant against
vancomycin, too, a situation generally considered to result in a
public health disaster. MRSA owe their resistance against virtually
all .beta.-lactam antibiotics to the expression of an extra
penicillin binding protein (PBP) 2a, encoded by the mecA gene. This
additional very low affinity pbp, which is found exclusively in
resistant strains, appears to be the only pbp still functioning in
cell wall peptidoglycan synthesis at .beta.-lactam concentrations
high enough to saturate the normal set of S. aureus pbp 1-4. In
1983 it was shown by insertion mutagenesis using transposon Tn551
that several additional genes independent of mecA are needed to
sustain the high level of methicillin resistance of MRSA.
Interruption of these genes did not influence the resistance level
by interfering with PBP2a expression, and were therefore called
fern (factor essential for expression of methicillin resistance) or
aux (auxiliary genes).
[0025] In the meantime six fern genes (femA-through F) have been
described and the minimal number of additional aux genes has been
estimated to be more than 10. Interference with femA and femB
results in a strong reduction of methicillin resistance, back to
sensitivity of strains without PBP2a. The fem genes are involved in
specific steps of cell wall synthesis. Consequently, inactivation
of fern factors induce .beta.-lactam hypersensitivity in already
sensitive strains. Both femA and femB have been shown to be
involved in peptidoglycan pentaglycine interpeptide bridge
formation. FemA is responsible for the formation of glycines 2 and
3, and femB is responsible for formation of glycines 4 and 5. S.
aureus may be involved in the formation of a monoglycine
muropeptide precursors. FemC-F influence amidation of the
iso-D-glutamic acid residue of the peptidoglycan stem peptide,
formation of a minor muropeptide with L-alanine instead of glycine
at position 1 of the interpeptide bridge, perform a yet unknown
function, or are involved in an early step of peptidoglycan
precursors biosynthesis (addition of L-lysine), respectively.
[0026] Thus far each new antibiotic gives rise to resistance
strains, emerge that are resistance to multiple drugs and
increasingly persistent forms of resistance begin to emerge. Drug
resistance of S. aureus infections already poses significant
treatment difficulties, which are likely to get much worse unless
new therapeutic agents are developed. Since S. aureus is likely
involved in the synthesis of the peptidoglycan cross bridges in S.
aureus, the gene provides an important tool in studying the
mechanisms of antibiotic resistance. The S. aureus gene and its
polypeptides are also potential target for antagonists or agonists,
which may be useful as antibiotics, or useful to block resistance
to other antibiotics. That is, antagonists or agonists, such as
small molecules, may be useful as antibiotics themselves, act
additively with other antibiotics, or act synergistically with
other antibiotics.
BRIEF SUMMARY OF THE INVENTION
[0027] The present invention provides isolated S. aureus
polynucleotides and polypeptides shown in Table 1 and SEQ ID NO:1
through SEQ ID NO:22 (polynucleotide sequences having odd SEQ ID
NOs and polypeptide sequences having even SEQ ID NOs). One aspect
of the invention provides isolated nucleic acid molecules
comprising polynucleotides having a nucleotide sequence selected
from the group consisting of: (a) a nucleotide sequence shown in
Table 1; (b) a nucleotide sequence encoding any of the amino acid
sequences of the polypeptides shown in Table 1; and (c) a
nucleotide sequence complementary to any of the nucleotide
sequences in (a) or (b). The invention further provides for
fragments of the nucleic acid molecules of (a), (b) & (c)
above.
[0028] Further embodiments of the invention include isolated
nucleic acid molecules that comprise a polynucleotide having a
nucleotide sequence at least 90% identical, and more preferably at
least 95%, 96%, 97%, 98% or 99% identical, to any of the nucleotide
sequences in (a), (b) or (c) above, or a polynucleotide which
hybridizes under stringent hybridization conditions to a
polynucleotide in (a), (b) or (c) above. Additional nucleic acid
embodiments of the invention relate to isolated nucleic acid
molecules comprising polynucleotides which encode the amino acid
sequences of epitope-bearing portions of a S. aureus polypeptide
having an amino acid sequence in (a) above.
[0029] The present invention also relates to recombinant vectors,
which include the isolated nucleic acid molecules of the present
invention, and to host cells containing the recombinant vectors, as
well as to methods of making such vectors and host cells. The
present invention further relates to the use of these vectors in
the production of S. aureus polypeptides or peptides by recombinant
techniques.
[0030] The invention further provides isolated S. aureus
polypeptides having an amino acid sequence selected from the group
consisting of an amino acid sequence of any of the polypeptides
described in Table 1 or fragments thereof.
[0031] The polypeptides of the present invention also include
polypeptides having an amino acid sequence with at least 70%
similarity, and more preferably at least 75%, 80%, 85%, 90%, 95%,
96%, 97%, 98%, or 99% similarity to those described in Table 1, as
well as polypeptides having an amino acid sequence at least 70%
identical, more preferably at least 75% identical, and still more
preferably 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to
those above; as well as isolated nucleic acid molecules encoding
such polypeptides.
[0032] The present invention further provides a vaccine, preferably
a multi-component vaccine comprising one or more of the S. aureus
polynucleotides or polypeptides described in Table 1, or fragments
thereof, together with a pharmaceutically acceptable diluent,
carrier, or excipient, wherein the S. aureus polypeptide(s) are
present in an amount effective to elicit an immune response to
members of the Staphylococcus genus, or at least S. aureus, in an
animal. The S. aureus polypeptides of the present invention may
further be combined with one or more immunogens of one or more
other staphylococcal or non-staphylococcal organisms to produce a
multi-component vaccine intended to elicit an immunological
response against members of the Staphylococcus genus and,
optionally, one or more non-staphylococcal organisms.
[0033] The vaccines of the present invention can be administered in
a DNA form, e.g., "naked" DNA, wherein the DNA encodes one or more
staphylococcal polypeptides and, optionally, one or more
polypeptides of a non-staphylococcal organism. The DNA encoding one
or more polypeptides may be constructed such that these
polypeptides are expressed as fusion proteins.
[0034] The vaccines of the present invention may also be
administered as a component of a genetically engineered organism or
host cell. Thus, a genetically engineered organism or host cell
which expresses one or more S. aureus polypeptides may be
administered to an animal. For example, such a genetically
engineered organism or host cell may contain one or more S. aureus
polypeptides of the present invention intracellularly, on its cell
surface, or in its periplasmic space. Further, such a genetically
engineered organism or host cell may secrete one or more S. aureus
polypeptides. The vaccines of the present invention may also be
co-administered to an animal with an immune system modulator (e.g.,
CD86 and GM-CSF).
[0035] The invention also provides a method of inducing an
immunological response in an animal to one or more members of the
Staphylococcus genus, preferably one or more isolates of the S.
aureus species, comprising administering to the animal a vaccine as
described above.
[0036] The invention further provides a method of inducing a
protective immune response in an animal, sufficient to prevent,
attenuate, or control an infection by members of the Staphylococcus
genus, preferably at least S. aureus species, comprising
administering to the animal a composition comprising one or more of
the polynucleotides or polypeptides described in Table 1, or
fragments thereof. Further, these polypeptides, or fragments
thereof, may be conjugated to another immunogen and/or administered
in admixture with an adjuvant.
[0037] The invention further relates to antibodies elicited in an
animal by the administration of one or more S. aureus polypeptides
of the present invention and to methods for producing such
antibodies and fragments thereof. The invention further relates to
recombinant antibodies and fragments thereof and to methods for
producing such antibodies and fragments thereof.
[0038] The invention also provides diagnostic methods for detecting
the expression of the polynucleotides of Table 1 by members of the
Staphylococcus genus in an animal. One such method involves
assaying for the expression of a polynucleotide encoding S. aureus
polypeptides in a sample from an animal. This expression may be
assayed either directly (e.g., by assaying polypeptide levels using
antibodies elicited in response to amino acid sequences described
in Table 1) or indirectly (e.g., by assaying for antibodies having
specificity for amino acid sequences described in Table 1). The
expression of polynucleotides can also be assayed by detecting the
nucleic acids of Table 1. An example of such a method involves the
use of the polymerase chain reaction (PCR) to amplify and detect
Staphylococcus nucleic acid sequences.
[0039] The present invention also relates to nucleic acid probes
having all or part of a nucleotide sequence described in Table 1
(odd SEQ ID NOs) which are capable of hybridizing under stringent
conditions to Staphylococcus nucleic acids. The invention further
relates to a method of detecting one or more Staphylococcus nucleic
acids in a biological sample obtained from an animal, said one or
more nucleic acids encoding Staphylococcus polypeptides,
comprising: (a) contacting the sample with one or more of the
above-described nucleic acid probes, under conditions such that
hybridization occurs, and (b) detecting hybridization of said one
or more probes to the Staphylococcus nucleic acid present in the
biological sample.
[0040] Polynucleotides and Polypeptides of the Invention
[0041] Features of FemX Polynucleotides and Polypeptides.
[0042] The nucleotide sequence shown in SEQ ID NO: 1 was determined
by sequencing the S. aureus overlapping clones BTEFS71 and BTEJE39.
The nucleotide sequence contains an open reading frame encoding the
femX polypeptide comprising 414 amino acid residues (SEQ ID NO:2),
including an initiation codon encoding an N-terminal methionine at
nucleotide positions 164-166, and a predicted molecular weight of
about 49.1 kDa.
[0043] The femX polypeptides of the present invention have amino
acid sequence homology to known genes involved in formation of
peptidoglycan cross bridges, including the conserved cysteine
pattern characteristic of the epr and fem family of genes. The S.
aureus femX polypeptide of SEQ ID NO:2 was found to share a high
degree of local sequence identity with amino acid sequences of the
epr (M. Sugai, et al. (1997) J. Bacteriol. 179(13):4311-4318) and
fem A and fem B proteins from Staphlococcus species (A. M. Stranden
et al., (1997) J. Bacteriol. 179(1):9-16; G. Thumm et al. (1997)
Mol. Microbiol. 23(6):1251-1265; W. E. Alborn et al., (1996) Gene
180(1-2):177-181) using the computer program BLAST (Altschul et
al., (1990) J. Mol. Biol. 215:403-410).
[0044] The strong homology between species and identity among fem
proteins of S. aureus indicates that femX is involved in
peptidoglycan interpeptide bridge biosynthesis. Thus, the
polypeptides of the present invention are useful in screening
methods to make antagonists which block their function. Antagonists
can be used, for instance, as antibiotics to treat antibiotic
resistant S. aureus or other Staphylococcus species. Antagonists of
the polypeptides of the present invention can be identified by
measuring the formation of peptidoglycan cross bridges. More
specifically, the synthesis of glycines 1-5 of peptidoglycan cross
bridges can be measured as exemplified by A. M. Stranden et al.
(1997) J. Bacteriol 179(1):9-16 (incorporated herein in its
entirety). Antagonists of femX would act to inhibit peptidoglycan
cross bridge formation.
[0045] Other uses of the femX polypeptides of the present invention
include: inter alia, to detect S. aureus in immunoassays, as
epitope tags, as molecular weight markers on SDS-PAGE gels, as
molecular weight markers for molecular sieve gel filtration
columns, to generate antibodies that specifically bind S. aureus
femX for the detection S. aureus in immunoassays, to generate an
immune response against S. aureus and other Staphylococcus species,
and as vaccines against S. aureus and other Staphylococcus
species.
[0046] Isolated nucleic acid molecules of the present invention,
particularly DNA molecules, are useful as probes for gene mapping
and for identifying S. aureus in a biological samples, for
instance, by Southern and Northern blot analysis. femX
polynucleotides of the present invention are also useful in
detecting S. aureus by PCR using primers for femX polynucleotides.
Isolated polynucleotides of the present invention are also useful
in making the polypeptides of the present invention.
[0047] Features of FurA, FurB, and FurC Polynucleotides and
Polypeptides.
[0048] The nucleotide sequences for furA, furB, and furC were
determined by sequencing the S. aureus clones BTEJQ50 (SEQ ID
NO:3), BTALE70 (SEQ ID NO:5), and BTEBP80 and BTEFD68 (collectively
SEQ ID NO:7). The nucleotide sequence of SEQ ID NO:3 contains an
open reading frame encoding the furA polypeptide comprising 136
amino acid residues (SEQ ID NO:4), including an initiation codon
encoding an N-terminal methionine at nucleotide positions 101-103,
and a predicted molecular weight of about 15.9 kDa.
[0049] The nucleotide sequence of SEQ ID NO:5 contains an open
reading frame encoding the furB polypeptide comprising 148 amino
acid residues (SEQ ID NO:6), including an initiation codon encoding
an N-terminal methionine at nucleotide positions 101 -103, and a
predicted molecular weight of about 17.2 kDa.
[0050] The nucleotide sequence of SEQ ID NO:7 contains an open
reading frame encoding the furC polypeptide comprising 149 amino
acid residues (SEQ ID NO:8), including an initiation codon encoding
an N-terminal leucine at nucleotide positions 101-103, and a
predicted molecular weight of about 17.2 kDa.
[0051] The fur (ferric uptake regulator) polypeptides (furA, furB,
and furC) of the present invention have amino acid sequence
homology to known genes involved in iron regulation. The S. aureus
furA polypeptide of SEQ ID NO:2 was found to share a high degree of
local sequence identity with the amino acid sequence of a fur gene
from Staphylococcus epidermidis (GenBank accession number
gnl.vertline.PID.vertline.e236389). See C. Heidrich et al. (1996)
FEMS Micro. Letts. 140:253-259. The S. aureus furB polypeptide of
SEQ ID NO:2 was found to share a high degree of local sequence
identity with the amino acid sequence of a fur family gene from
Bacillus subtilis (GenBank accession number
gnl.vertline.PID.vertline.e28- 1583). See N. J Cummings et al.
(1997) Microbiology 143:1855-1859. The S. aureus furC polypeptide
of SEQ ID NO:2 was found to share a high degree of local sequence
identity with the amino acid sequence of another fur family gene
from Bacillus subtilis (GenBank accession number
gnl.vertline.PID.vertline.e1185621). See F. Kunst et al. (1997)
Nature 390:249-256.
[0052] The fur polypeptides of the present invention also share
identity among themselves as well as other fur and fur-like genes
from Bacillus subtilis (GenBank accession numbers
gnl.vertline.PID.vertline.e1185777), Streptococcus pyogenes
(GenBank accession number gi.vertline.1667516), Neisseria
meningitidis (GenBank accession number gi.vertline.433299),
Neisseria gonorrheae (GenBank accession number gi.vertline.349012),
Camplyobacter upsaliensis (GenBank accession number
gi.vertline.1228779), Camplyobacter jejuni (GenBank accession
number gi.vertline.511113) Mycobacterium tuberculosis (GenBank
accession numbergnl.vertline.PID.vert- line.e315163), and other
bacteria species. Identities were compared using the computer
program BLAST (Altschul et al., (1990) J. Mol. Biol.
215:403-410).
[0053] The strong homology among the fur proteins of S. aureus and
other bacteria species indicates that furA, furB, and furC are
involved in iron regulation in S. aureus. Since iron is essential
for the growth and multiplication of nearly microorganisms, the
polypeptides of the present invention are useful in screening
methods to make antagonists which block their function. Antagonists
can be used, for instance, as antibiotics to treat infections of S.
aureus or other Staphylococcus species. Antagonists of the
polypeptides of the present invention can be identified by
measuring the ability of bacteria to grow in the presence of
varying concentrations of iron.
[0054] Other uses of the fur polypeptides of the present invention
include: inter alia, to detect S. aureus in immunoassays, as
epitope tags, as molecular weight markers on SDS-PAGE gels, as
molecular weight markers for molecular sieve gel filtration
columns, to generate antibodies that specifically bind S. aureus
furA, furB, and furC for the detection S. aureus in immunoassays,
to generate an immune response against S. aureus and other
Staphylococcus species, and as vaccines against S. aureus, other
Staphylococcus species and other bacteria genuses.
[0055] Isolated nucleic acid molecules of the present invention,
particularly DNA molecules, are useful as probes for gene mapping
and for identifying S. aureus in a biological samples, for
instance, by Southern and Northern blot analysis. fur
polynucleotides of the present invention are also useful in
detecting S. aureus by PCR using primers for a particular fur
polynucleotide. Isolated polynucleotides of the present invention
are also useful in making the polypeptides of the present
invention.
[0056] Features of FmtB, pbpF, and pbpG Polynucleotides and
Polypeptides.
[0057] The nucleotide sequences for fmtB, pbpF, and pbpG were
determined by sequencing the S. aureus clones BTEDA22 and BTEDV18
(SEQ ID NO:9), BTEBG73 and BTAJO70 (SEQ ID NO:11), and BTEBU53 and
BTEFB55 (SEQ ID NO:13), respectively. The nucleotide sequence of
SEQ ID NO:9 contains an open reading frame encoding the fmtB
polypeptide comprising 498 amino acid residues (SEQ ID NO: 10),
including an initiation codon encoding an N-terminal methionine at
nucleotide positions 101-103, and a predicted molecular weight of
about 56.4 kDa.
[0058] The nucleotide sequence of SEQ ID NO:11 contains an open
reading frame encoding the pbpF polypeptide comprising 691 amino
acid residues (SEQ ID NO:12), including an initiation codon
encoding an N-terminal leucine at nucleotide positions 101-103, and
a predicted molecular weight of about 77.2 kDa.
[0059] The nucleotide sequence of SEQ ID NO:13 contains an open
reading frame encoding the pbpG polypeptide comprising 301 amino
acid residues (SEQ ID NO:14), including an initiation codon
encoding an N-terminal methionine at nucleotide positions 101-103,
and a predicted molecular weight of about 34.5 kDa.
[0060] The fmtB, pbpF, and pbpG polypeptides of the present
invention have amino acid sequence homology to known
penicillin-biding proteins among several species. The S. aureus
fmtB polypeptide of SEQ ID NO:10 was found to share local sequence
identity, inter alia, with the amino acid sequence of a
penicillin-binding protein gene from Bacillus subtilis (GenBank
accession number gnl.vertline.PID.sym.e1185286). See F. Kunst et
al. (1997) Nature 390:249-256. fmtB also shares sequence identity
with another Staphylococcus aureus polypeptide associated with
antibiotic resistance (GenBank accession number
gnl.vertline.PID.vertline.d1024918). See H. Komatsuzawa et al.
(1997) Antimicrob. Agents Chemother. 41:2355-2361.
[0061] The S. aureus pbpF polypeptide of SEQ ID NO:12 was found to
share local sequence identity, inter alia, with the amino acid
sequence of penicillin-binding genes from Bacillus subtilis
(GenBank accession number gnl.vertline.PID.vertline.e1181903 and
gnl.vertline.PID.vertline.e1185767- ) and Streptococcus
thermophilus (GenBank accession number gi.vertline.643510). The S.
aureus pbpG polypeptide of SEQ ID NO:14 was found to share local
sequence identity, inter alia, with the amino acid sequence of
penicillin-binding genes from Pseudomonas syringae (GenBank
accession number gi.vertline.551940). See E. Roine et al. (1996) J.
Bacteriol. 178:410-417, and Bacillus subtilis (GenBank accession
number gnl.vertline.PID.vertline.e267588). Identities were compared
using the computer program BLAST (Altschul et al., (1990) J. Mol.
Biol. 215:403-410).
[0062] The strong homology among the S. aureus fmtB, pbpF, and pbpG
polypeptides of the present invention and penicillin-binding
proteins from other bacteria species indicates that fmtB, pbpF, and
pbpG are involved cell wall synthesis and in .beta.-lactam
resistance in S. aureus. The polypeptides of the present invention
are therefore useful for making compounds that inhibit their
function for use as antibiotics. Inhibitors of the polypeptides of
the present invention can be identified by measuring the ability of
bacteria to grow in the presence of varying concentrations of
antibiotics or by cell wall synthesis assays using methods known in
the art.
[0063] Other uses of the fmtB, pbpF, and pbpG polypeptides of the
present invention include: inter alia, to detect S. aureus in
immunoassays, as epitope tags, as molecular weight markers on
SDS-PAGE gels, as molecular weight markers for molecular sieve gel
filtration columns, to generate antibodies that specifically bind
S. aureus fmtB, pbpF, or pbpG for the detection S. aureus in
immunoassays, to generate an immune response against S. aureus and
other Staphylococcus species, and as vaccines against S. aureus,
other Staphylococcus species and other bacteria genuses.
[0064] Isolated nucleic acid molecules of the present invention,
particularly DNA molecules, are useful as probes for gene mapping
and for identifying S. aureus in a biological samples, for
instance, by Southern and Northern blot analysis. fmtB, pbpF, and
pbpG polynucleotides of the present invention are also useful in
detecting S. aureus by PCR using primers for a particular fmtB,
pbpF, or pbpG polynucleotide. Isolated polynucleotides of the
present invention are also useful in making the polypeptides of the
present invention.
[0065] Features of cbrA, cbrB, and cbrC Polynucleotides and
Polypeptides.
[0066] The nucleotide sequences for cbrA (SEQ ID NO: 15), cbrB (SEQ
ID NO: 17), and cbrC ( SEQ ID NO: 19) comprise a single operon and
were determined by sequencing the S. aureus overlapping clones
BTACA44 and BTAGJ54 which span the operon. The nucleotide sequence
of SEQ ID NO: 15 contains an open reading frame encoding the cbrA
polypeptide comprising 330 amino acid residues (SEQ ID NO:16),
including an initiation codon encoding an N-terminal methionine at
nucleotide positions 7-9, and a predicted molecular weight of about
36.8 kDa.
[0067] The nucleotide sequence of SEQ ID NO:17 contains an open
reading frame encoding the cbrB polypeptide comprising 331 amino
acid residues (SEQ ID NO:18), including an initiation codon
encoding an N-terminal leucine at nucleotide positions 19-21, and a
predicted molecular weight of about 35.5 kDa.
[0068] The nucleotide sequence of SEQ ID NO:19 contains an open
reading frame encoding the cbrc polypeptide comprising 332 amino
acid residues (SEQ ID NO:20), including an initiation codon
encoding an N-terminal methionine at nucleotide positions 91-93,
and a predicted molecular weight of about 35.7 kDa.
[0069] The cbr polypeptides (cbrA, cbrB, and cbrC) of the present
invention have amino acid sequence homology to known genes involved
in iron regulation. The S. aureus cbrA (SEQ ID NO:16), cbrB (SEQ ID
NO:18), and cbrc (SEQ ID NO:20) polypeptides were found to share
local sequence identity among themselves and with the amino acid
sequence of a cbrA, cbrB, and cbrC genes from Erwinia chrysanthemi
(GenBank accession numbers gi.vertline.809541, gi.vertline.809542,
and gi.vertline.809541 respectively). See B. Mahe et al. (1995)
Mol. Microbiol. 18:33-43. The cbrA, cbrB, and cbrC polypeptides of
the present invention also share sequence identity and with iron
regulatory genes of other bacterial species including Bacillus
subtilis (GenBank accession number gnl.beta.PID.beta.e1182834,
gnl.vertline.PID.vertline.e1182835, and
gnl.vertline.PID.vertline.e1182836). See F. Kunst et al. (1997)
Nature 390:249-256 and Bacillus intermedius (GenBank accession
number gnl.vertline.PID.vertline.e245932). Identities were compared
using the computer program BLAST (Altschul et al., (1990) J. Mol.
Biol. 215:403-410).
[0070] The strong homology among the cbr proteins of S. aureus and
other bacteria species indicates that cbrA, cbrB, and cbrC are
involved in iron regulation in S. aureus. Since iron is essential
for the growth and multiplication of nearly microorganisms, the
polypeptides of the present invention are useful in screening
methods to make antagonists which block their function. Antagonists
can be used, for instance, as antibiotics to treat infections of S.
aureus or other Staphylococcus species. Antagonists of the
polypeptides of the present invention can be identified by
measuring the ability of bacteria to grow in the presence of
varying concentrations of iron.
[0071] Other uses of the polypeptides of the present invention
include: inter alia, to detect S. aureus in immunoassays, as
epitope tags, as molecular weight markers on SDS-PAGE gels, as
molecular weight markers for molecular sieve gel filtration
columns, to generate antibodies that specifically bind S. aureus
polypeptides of the present invention for the detection S. aureus
in immunoassays, to generate an immune response against S. aureus
and other Staphylococcus species, and as vaccines against S.
aureus, other Staphylococcus species and other bacteria
genuses.
[0072] Isolated nucleic acid molecules of the present invention,
particularly DNA molecules, are useful as probes for gene mapping
and for identifying S. aureus in a biological samples, for
instance, by Southern and Northern blot analysis. S. aureus
polynucleotides of the present invention are also useful in
detecting S. aureus by PCR using primers for a particular S. aureus
polynucleotide. Isolated polynucleotides of the present invention
are also useful in making the polypeptides of the present
invention.
[0073] Features of Enolase Polynucleotides and Polypeptides.
[0074] The nucleotide sequence shown in SEQ ID NO:21 was determined
by sequencing the S. aureus overlapping clones BTAAI44 and BTAGE12.
The nucleotide sequence contains an open reading frame encoding the
enolase polypeptide comprising 434 amino acid residues (SEQ ID
NO:22), including an initiation codon encoding an N-terminal
methionine at nucleotide positions 103-105, and a predicted
molecular weight of about 47.1 kDa.
[0075] The enolase polypeptides of the present invention have amino
acid sequence identity homology to known enolase genes from other
bacterial species. The S. aureus enolase polypeptide of SEQ ID
NO:22 shares local sequence identity with amino acid sequences of
the enolase genes from other bacterial species including Bacillus
subtilis (GenBank accession numbers gi.vertline.460259 and
gnl.vertline.PID.vertline.e1186078), Spongilla sp. (GenBank
accession number gi.vertline.1839206), Mycobacterium tuberculosis
(GenBank accession number gnl.vertline.PID.vertline.e304557)
Methanococcus jannaschii (GenBank accession number
gi.vertline.1590967) and Campylobacter jejuni (GenBank accession
number gi.vertline.437277).
[0076] The S. aureus enolase protein of the present invention was
identified as a molecule involved in laminin (LN)/laminin receptor
(LNRec) interactions. The S. aureus enolase protein of the present
invention was shown to be responsible for LNRec activity in
bridging experiments between the S. aureus and MDCK cell in
culture. The S. aureus enolase gene of the present invention was
cloned by first generating monoclonal antibodies against the LNRec
molecule and using the antibodies to subsequently isolated the
LNRec molecule. The LNRec molecule was purified and partially
sequenced. Partial amino acid sequence analysis was used to clone
and isolate the S. aureus enolase gene of the present invention. A
characteristic feature of infection by S. aureus is bloodstream
invasion and widespread metastatic abscess formation. The S. aureus
enolase polypeptides of the present invention therefore represent a
target for both vaccines and antibiotics. Antibiotics of the
present invention include peptides, polypeptides, antibodies (and
fragments thereof), small molecules, and other drugs that bind the
S. aureus enolase polypeptides of the present invention, or enolase
associated molecules, and prevent binding of S. aureus to laminin.
The blocking molecules of the present invention may act by directly
blocking the binding of enolase polypeptides to laminin or enolase
associated molecules to laminin. Assays for measuring the binding
of molecules to enolase polypeptides or enolase associated
molecules; assays for measuring the binding of S. aureus to
laminin; and assays for measuring the metastatic activity of S.
aureus include those described and referenced in Lopes et al.
(1985) Science 229:275-277, described and referenced in Brentani
(1989) Oncogenesis 1:247-260, known in the art, and disclosed
herein.
[0077] The structural homology and identity between the enolase
polypeptides of S. aureus and those of other bacterial species
indicates that the enolase polypeptides of S. aureus share the same
function as the enolase polypeptides from other bacterial enolase
polypeptides, including those described by Babbitt et al. (1996)
Biochemistry 35:16489-16501. The enolase polynucleotides and
polypeptides of the present invention are useful to produce mutant
S. aureus enolase genes, polypeptides, and mutant S. aureus strains
for use as vaccines and to induce an immune response in humans and
other animals by using the methods described in U.S. Pat. Nos.
5,703,219 and 5,703,219. In the methods of U.S. Pat. Nos. 5,703,219
and 5,703,219 the S. aureus enolase polypeptides and polypeptides
are substituted for the Helicobacter pylori enolase polypeptides
and polypeptides. Modifications to accommodate the S. aureus
enolase polypeptides and polypeptides of the present invention are
made using information disclosed herein and known in the art.
[0078] Other uses of the enolase polypeptides of the present
invention include: inter alia, to detect S. aureus in immunoassays,
as epitope tags, as molecular weight markers on SDS-PAGE gels, as
molecular weight markers for molecular sieve gel filtration
columns, to generate antibodies that specifically bind S. aureus
enolase for the detection S. aureus in immunoassays, to generate an
immune response against S. aureus and other Staphylococcus species,
and as vaccines against S. aureus and other Staphylococcus species
as discussed above.
[0079] Isolated nucleic acid molecules of the present invention,
particularly DNA molecules, are useful as probes for gene mapping
and for identifying S. aureus in a biological samples, for
instance, by Southern and Northern blot analysis enolase
polynucleotides of the present invention are also useful in
detecting S. aureus by PCR using primers for enolase
polynucleotides. Isolated polynucleotides of the present invention
are also useful in making the polypeptides of the present
invention.
DETAILED DESCRIPTION
[0080] The present invention relates to recombinant S. aureus
nucleic acids and fragments thereof. The present invention further
relates to recombinant S. aureus polypeptides and fragments
thereof. The invention also relates to methods for using these
polypeptides to produce immunological responses and to confer
immunological protection to disease caused by members of the genus
Staphylococcus, at least isolates of the S. aureus genus. The
invention further relates to nucleic acid sequences which encode
antigenic S. aureus polypeptides and to methods for detecting S.
aureus nucleic acids and polypeptides in biological samples. The
invention also relates to antibodies specific for the polypeptides
and peptides of the present invention and methods for detecting
such antibodies produced in a host animal.
[0081] Definitions
[0082] The following definitions are provided to clarify the
subject matter which the inventors consider to be the present
invention.
[0083] As used herein, the phrase "pathogenic agent" means an agent
which causes a disease state or affliction in an animal. Included
within this definition, for examples, are bacteria, protozoans,
fungi, viruses and metazoan parasites which either produce a
disease state or render an animal infected with such an organism
susceptible to a disease state (e.g., a secondary infection).
Further included are species and strains of the genus
Staphylococcus which produce disease states in animals.
[0084] As used herein, the term "organism" means any living
biological system, including viruses, regardless of whether it is a
pathogenic agent.
[0085] As used herein, the term "Staphylococcus" means any species
or strain of bacteria which is members of the genus Staphylococcus.
Such species and strains are known to those of skill in the art,
and include those that are pathogenic and those that are not.
[0086] As used herein, the phrase "one or more S. aureus
polypeptides of the present invention" means polypeptides
comprising the amino acid sequence of one or more of the S. aureus
polypeptides described in Table 1 (even SEQ ID NOs). These
polypeptides may be expressed as fusion proteins wherein the S.
aureus polypeptides of the present invention are linked to
additional amino acid sequences which may be of staphylococcal or
non-staphylococcal origin. This phrase further includes polypeptide
comprising fragments of the S. aureus polypeptides of the present
invention. Additional definitions are provided throughout the
specification.
[0087] Explanation of Table 1
[0088] Table 1, below, shows the nucleotide sequence of 11 genes
from S. aureus and the sequence of the polypeptides they encode.
The table lists the name of the S. aureus gene, followed by a
sequence identification number (SEQ ID NO:), and the gene's
nucleotide or polypeptide sequence. The table also lists the
plasmid clones comprising the nucleotide sequences. The actual
nucleotide or amino acid sequence of each gene is also shown in the
Sequence Listing under the corresponding SEQ ID NO.
[0089] Explanation of Table 2
[0090] Table 2 lists residues comprising antigenic epitopes of
antigenic epitope-bearing fragments present in each of the S.
aureus polypeptides described in Table 1 as predicted by the
inventors using the algorithm of Jameson and Wolf, (1988) Comp.
Appl. Biosci. 4:181-186. The Jameson-Wolf antigenic analysis was
performed using the computer program PROTEAN (Version 3.11 for the
Power MacIntosh, DNASTAR, Inc., 1228 South Park Street Madison,
Wis.). Each S. aureus polypeptide shown in Table 1 has one or more
antigenic epitopes comprising residues described in Table 2. It
will be appreciated that depending on the analytical criteria used
to predict antigenic determinants, the exact address of the
determinant may vary slightly. The residues and locations shown
described in Table 2 correspond to the amino acid sequences for
each gene shown in Table 1 and in the Sequence Listing.
[0091] Explanation of Table 3.
[0092] The S. aureus polypeptides of the present invention may
include one or more conservative amino acid substitutions from
natural mutations or human manipulation as indicated in Table 3.
Changes are preferably of a minor nature, such as conservative
amino acid substitutions that do not significantly affect the
folding or activity of the protein. Residues from the following
groups, as indicated in Table 3, may be substituted for one
another: Aromatic, Hydrophobic, Polar, Basic, Acidic, and
Small.
[0093] Nucleic Acid Molecules
[0094] Sequenced S. aureus genomic DNA was obtained from the S.
aureus strain ISP3. S. aureus strain ISP3, has been deposited at
the American Type Culture Collection, as a convenience to those of
skill in the art. The S. aureus strain ISP3 was deposited on 7
April 1998 at the ATCC, 10801 University Blvd. Manassas, Va.
20110-2209, and given accession number 202108. As discussed
elsewhere herein, polynucleotides of the present invention readily
may be obtained by routine application of well known and standard
procedures for cloning and sequencing DNA. Detailed methods for
obtaining libraries and for sequencing are provided below, for
instance. A wide variety of Staphylococcus aureus strains that can
be used to prepare S. aureus genomic DNA for cloning and for
obtaining polynucleotides and polypeptides of the present
invention. A wide variety of Staphylococcus aureus strains are
available to the public from recognized depository institutions,
such as the American Type Culture Collection (ATCC). It is
recognized that minor variation is the nucleic acid and amino acid
sequence may be expected from S aureus strain to strain. The
present invention provides for genes, including both
polynucleotides and polypeptides, of the present invention from all
the Staphylococcus aureus strains. That is, the femX, furA-C, fmtB,
pbpG and --F, and CbrA-C genes from all Staphylococcus aureus
strains are included in the present invention.
[0095] Unless otherwise indicated, all nucleotide sequences
determined by sequencing a DNA molecule herein were determined
using an automated DNA sequencer (such as the Model 373 from
Applied Biosystems, Inc., Foster City, Calif.), and all amino acid
sequences of polypeptides encoded by DNA molecules determined
herein were predicted by translation of a DNA sequence determined
as above. Therefore, as is known in the art for any DNA sequence
determined by this automated approach, any nucleotide sequence
determined herein may contain some errors. Nucleotide sequences
determined by automation are typically at least about 90%
identical, more typically at least about 95% to at least about
99.9% identical to the actual nucleotide sequence of the sequenced
DNA molecule. The actual sequence can be more precisely determined
by other approaches including manual DNA sequencing methods well
known in the art. As is also known in the art, a single insertion
or deletion in a determined nucleotide sequence compared to the
actual sequence will cause a frame shift in translation of the
nucleotide sequence such that the predicted amino acid sequence
encoded by a determined nucleotide sequence will be completely
different from the amino acid sequence actually encoded by the
sequenced DNA molecule, beginning at the point of such an insertion
or deletion. In case of conflict between Table 1 and either the
nucleic acid sequence of the clones listed in Table 1 or the amino
acid sequence of the protein expressed by the clones listed in
Table 1, the clones listed in Table 1 are controlling. By
"nucleotide sequence" of a nucleic acid molecule or polynucleotide
is intended to mean either a DNA or RNA sequence. Using the
information provided herein, such as the nucleotide sequence in
Table 1, a nucleic acid molecule of the present invention encoding
a S. aureus polypeptide may be obtained using standard cloning and
screening procedures, such as those for cloning DNAs using genomic
DNA as starting material. See, e.g., Sambrook et al. MOLECULAR
CLONING: A LABORATORY MANUAL (Cold Spring Harbor, N.Y. 2nd ed.
1989); Ausubel et al., CURRENT PROTOCOLS IN MOLECULAR BIOLOGY (John
Wiley and Sons, N.Y. 1989).
1TABLE 1 Nucleotide and Amino Acid Sequences of 11 S. aureus Genes.
femX nucleotide sequence (SEQ ID NO: 1) clones BTEFS71 and BTEJE39
TGGAAAATTAATGAAGTTCCAAAG- TTTAGATCAAAACTGGAATAATGGTGGAT
GGCGTAAAGCAGAGGTTGCACATAAAGT- TGTTCATAATTATGAAAATGATATG
ATTTTTATTAGACCATTTAAAAAAGCATAATT- TAAATCGAAGGCAGGACATTG
AAATATGAAATTTTCAACTTTAAGTGAAGAAGAATT- TACCAACTACACCAAAA
AGCACTTCAAACATTATACGCAGTCTATAGAATTATATAA- TTATAGAAATAAA
ATAAATCATGAAGCACATATTGTGGGAGTGAAGAATGATAAAAA- TGAAGTTA
TAGCTGCATGTTTATTAACAGAGGCACGAATTTTTAAATTCTACAAATA- TTTCT
ACTCTCATAGAGGTCCTTTACTTGATTATTTCGATGCTAAATTAGTTTGTTA- CT
TTTTAAAGAATTATCTAAATTCATTTATAAAAATAGAGGAGTATTTATTCTTG
TTGATCCATATTTAATAGAGAATTTAAGAGATGCAAATGGTAGGATAATAAAG
AATTATAATAATTCAGTGATAGTAAAGATGCTAGGGAAAATTGGGTATCTCCA
TCAAGGTTATACAACAGGATATTCAAATAAAAGTCAAATTAGGTGGATTTCTG
TATTGGATTTAAAAGATAAAGATGAGAATCAACTTTTAAAAGAAATGGAATAC
CAAACTAGAAGAAATATAAAAAAGACTATTGAGATTGGTGTTAAGGTTGAAG
ATTTATCTATTGAAGAAACAAATCGATTTTATAAATTGTTTCAAATGGCTGAA
GAAAAACATGGTTTTCATTTCATGAATGAAGATTATTTTAAACGAATGCAAGA
AATATATAAAGATAAGGCAATGTTAAAGATAGCTTGTATAAATCTTAATGAAT
ATCAAGATAAATTAAAAATACAATTATTGAAAATCGAAAATGAAATGATGAC
TGTGAACAGAGCATTAAATGAAAATCCAAATTCTAAAAAAAATAAATCAAAA
TTAAATCAGTTAAATATGCAATTATCTAGTATTAATAATAGAATTAGTAAAAC
CGAAGAACTAATATTTGAAGATGGACCTGTTTTGGATTTAGCTGCTGCTTTATT
TATATGTACTGATGATGAAGTTTATTATCTATCAAGTGGATCAAATCCGAAAT
ATAATCAGTATATGGGTGCATATCATCTACAATGGCATATGATAAAATATGCA
AAATCACATAATATTAATAGGTATAATTTTTATGGAATAACAGGCGTCTTTAG
TAATGAGGCGGATGATTTTGGTGTTCAACAATTTAAAAAGGGTTTTAATGCAC
ATGTTGAAGAATTAATTGGTGATTTCATCAAACCAGTAAGACCAATTCTATAT
AAATTTGCAAAACTTATTTATAAGGTTTAATTATAAAGTATGTTGGAAATTGA
AATTTTAAATTCTTTCCAACATACTTTTCACTTTTTAAG femX amino acid sequence
(SEQ ID NO: 2) clones BTEFS71 and BTEJE39
MKFSTLSEEEFTNYTKKHFKHYTQSIELYNYRNKINHEAHIVGVKNDKNEVIAACL
LTEARIFKFYKYFYSHRGPLLDYFDAKLVCYFFKELSKFIYKNRGVFILVDPYLIEN
LRDANGRIIKNYNNSVIVKMLGKIGYLHQGYTTGYSNKSQIRWISVLDLKDKDEN
QLLKEMEYQTRRNIKKTIEIGVKVEDLSIEETNRFYKLFQMAEEKHGFHFMNEDYF
KRMQEIYKDKAMLKIACINLNEYQDKLKIQLLKIENEMMTVNRALNENPNSKKNK
SKLNQLNMQLSSINNRISKTEELIFEDGPVLDLAAALFICTDDEVYYLSSGSNPKYN
QYMGAYHLQWHMIKYAKSHNINRYNFYGITGVFSNEADDFGVQQFKKGFNAHV
EELIGDFIKPVRPILYKFAKLIYKV furA nucleotide sequence (SEQ ID NO: 3)
clone: BTEJQ50 TCTCCGGGTGGTGTaATTGTAGTTCTACTTGTTA-
TTTTACTTATGATTACAATGG CTTATCAGAAAATGCGAATGAAGTTTAAAAAGGGAG-
CTAATATCAATGAATA CAAATGATGCTATTAAAATTTTAAAAGAGAACGGTTTAAAA-
TATACAGATAAA CGTAAAGATATGTTAGATATTTTTGTCGAAGAAGATAAGTATATA-
AACGCAAA GTATATACAACAAGTTATGGATGAAAATTATCCTGGAATTTCATTCGAC- ACAA
TATATAGAAACCTGCACTTATTTAAAGATTTAGGAATTATTGAAAATACAGAA
CTTGATGGTGAAATGAAGTTTAGAATCGCTTGTACAAACCATCATCATCATCA
TTTTATCTGTGAAAAGTGTGGAGATACAAAGGTAATAGATTATTGTCCAATAG
ATCAGATAAAATTATCACTACCTGGTGTTAATATTCACAAACACAAACTTGAA
GTTTATGGTGTATGTGAGTCTTGCCAAGATTAATATAAAGAAATGAGATTTAT
GCACATTTGGTCCGATGTATGCATAAATCT furA amino acid sequence (SEQ ID NO:
4) clone: BTEJQ50 MNTNDAIKILKENGLKYTDKRKDMLDIFV-
EEDKYINAKYIQQVMDENYPGISFDTI YRNLHLFKDLGIIENTELDGEMKFRIACTN-
HHHHFICEKCGDTKVIDYCPIDQIKL SLPGVNIHKHKLEVYGVCESCQD furB nucleotide
sequence (SEQ ID NO: 5) clone: BTALE70
TTAAATGAAATCATCATGTAAATATTGACACGCGCGCAATACTACAGTTATAT
TTATAGTAAGTAATAATAATTATTATATAAGAAAGATGGTGATATAGATGAGT
GTTGAAATAGAATCAATTGAACATGAACTAGAAGAATCAATTGCATCATTGCG
ACAAGCAGGCGTAAGAATTACACCTCAAAGACAAGCAATATTACGTTATTTAA
TTTCTTCACATACTCATCCAACAGCTGATGAAATTTATCAAGCACTTTCACCTG
ATTTTCCAAATATAAGTGTTGCGACAATATATAATAACTTAAGAGTGTTTAAA
GATATTGGAATTGTAAAAGAATTAACATATGGAGACTCATCAAGTCGATTCGA
CTTTAATACACATAATCATTATCATATTATATGTGAACAATGTGGTAAGATTGT
TGATTTTCAATATCCACAGTTAAATGAAATTGAAAGATTAGCTCAGCATATGA
CTGACTTTGACGTAACACATCATCGAATGGAAATTTATGGAGTTTGTAAAGAA
TGCCAAGATAAATAATTTAACTTTGGTAGTATGACAAATTAAAAAAGCGTTAC T furB amino
acid sequence (SEQ ID NO: 6) clone: BTALE70
MSVEIESIEHELEESIASLRQAGVRITPQRQAILRYLISSHTHPTADEIYQALSPDFP- NI
SVATIYNNLRVFKDIGIVKELTYGDSSSRFDFNTHNHYHIICEQCGKIVDFQYPQ- LN
EIERLAQHMTDFDVTHHRMEIYGVCKECQDK furC nucleotide sequence (SEQ ID
NO: 7) clones: BTEBP80 and BTEFD68
TGAGAAAAGCTTGCATTTTATTGAGAAAACTGTTAGTTTTAATTGTAAAGTTTG
AAATAATTTGTAATGATTTTAATTATTAGTAGGGGAGTGGACATCGTTGGAAG
AACGATTAAATCGCGTTAAGCAACAATTACAACAATCATCATATAAGCTAACG
CCACAACGCGAAGCTACTGTTAGAGTTCTAATTGAAAATGAAAAAGATCATCT
AAGTGCTGAAGACGTATATCTGAAAGTAAAAGATAAAGCGCCTGAAATTGGC
TTGGCGACAGTATACAGAACGTTAGAGTTGTTAGCTGAACTAAAAGTTGTCGA
CAAAATTAACTTTGGTGATGGCGTCGCTCGTTTTGATTTAAGAAAAGAAGGCG
CAAAACATTTCCACCATCATTTAGTATGTATGGAATGTGGTCGTGTAGATGAA
ATCGATGAAGATTTGTTACCAGAAGTTGAAAATCGAGTTGAAAATGAGTTCAA
TTTTAAAATTTTAGATCATCGTTTAACTTTCCATGGTGTGTGTGAAACGTGCCA
AGCTAAAGGTAAAGGATAGTAAATTGCGTAGGTTAAATTAACCTTCGCTTTTT
TTAGAGGTGTGGTTAT furC amino acid sequence (SEQ ID NO: 8) clones:
BTEBP80 and BTEFD68 LEERLNRVKQQLQQSSYKLTPQREATVRVLI-
ENEKDHLSAEDVYLKVKDKAPEIG LATVYRTLELLAELKVVDKINFGDGVARFDLRK-
EGAKHFHHHLVCMECGRVDEI DEDLLPEVENRVENEFNFKILDHRLTFHGVCETCQA- KGKG
fmtB nucleotide sequence (SEQ ID NO: 9) clone: BTEDA22 and BTEDV18
GTAAATATACCTCTTTAATTAATTTATTCAATAGAACTGGTATAAT- AAAATAA
ATCTCATTAGGCACTTAAGTAAATTTAACATATAAAAAGGAACGTTTATG- ACT
ACTAAAAAACTGTATTTTCTATCCATTTCTATTATCATTTTAGTCGCCATTTCA
ATTGCTATATATATAACATTAAATAGCAATACGAAGACACGGTTAACCAATGA
TTCGCAACAACAAATAGATACAATTATCGAGCATGATTTACAAAAGGGACAC
ATTCCTGGAGCATCAATTTTAATAGTAAAAAATGGCAAAGTTTTTTTAAATAA
AGGTTATGGTTATCAAGATGTTGATAAAAAAGTCAAAGCTTCTCCCACAACAA
AGTATGAAATTGCTTCTAATACGAAAGCTTTCACAGGTCTTGCAATTTTAAAA
TTAGCTCAAGAAGGTCGATTAAACTTAAATGATGCCGTATCCAAACATGTGCC
TCATTTTAAAATGAACTATAATGGTCAAAATGAAACTATTACGATTAAGCAAC
TTTTGGCTCAAACAAGTGGTATACCTAGTGATATTACAAGCGAAGATTCTGTG
ACAAGCAAAAATAATCGTTTAAATGATGTAACCCATGCAATTATGGGTGATGA
ATTACATCATAAGCCCGGAGAAGAATTTGAATACTCAAATATGAACTATGATT
TATTAGGTTTAATTATCCAAAACGTTACGAAGCAATCCTATACAAAATATATT
ACAAATTCATGGCTCAAGCCTTTGCATATGACACATACATCATTCAAACAAAC
CAATTACAAATCAAAACATGATGCTATTGGCTATGAATTACAAGGTTCGACAC
CTGTCGTCTCTAAACCTGAATTTAACCTTTGGGATACACCATCAGCATATATGA
TGACATCAACTGAAGATTTGGAACATTGGATAAAATTCCAACTTAATCCACCT
GATAAATACAAATCATTAGTTCAACAATCACATAAAAATTTATCTTCAACAAT
TGGTGAACCTAATGCCAATGCATATGCTTCCGGCTGGTTTACCAATAATGATG
AACATTTAGTGTTTCATTCAGGAACGCTAGATAACTTTTCATCATTTATTTTAC
TAAATCCAAAACAAAATTATGGAATTGTTGTACTTGCAAATCTAAATTCGGAA
TATGTACCCAAATTAGTTGAGCATCTTAATACACAAATTGTAAATCACAAGCG
ATATTCGACGGTTGCGTCTATGCTCAATCAATATAAAGATCAATTTAATATTGT
TACCGTTTTGATGACAACACTTATTTTATTAGCATTTATATTCTCAGCTTATCGT
GCTTGGCAAATGCGCCATGGTCAAATTCTTTTGCGTAGATCAAAACGGATTGC
TGTATTGAGTTGGTTATCATTATGTATATGTATCGCTTTAGCGCTCATATTATA
TGCATTACCATATCTCATTCTCGGTAGCAATAATTGGTCTTTTGTACTGACTTG
GCTACCAATAGAAATTAAATTAGCACTAATCACAACATTAATTGCATTATTCA
GTACATTAATTGTAATTCTGTTATTCCTTCATACAAAGATAACGAAGACATAA
TAAAAAAGACTTGTTCGAGCCGTGCGTTTGATAATATATCATCCACGATT fmtB amino acid
sequence (SEQ ID NO: 10) clone: BTEDA22 and BTEDV18
MTTKKLYFLSISIIILVAISIAIYITLNSNTKTRLTNDSQQQIDTIIEHDLQKGHIPGASIL
IVKNGKVFLNKGYGYQDVDKKVKASPTTKYEIASNTKAFTGLAILKLAQEGRLNL
NDAVSKHVPHFKMNYNGQNETITIKQLLAQTSGIPSDITSEDSVTSKNNRLNDVTH
AIMGDELHHKPGEEFEYSNMNYDLLGLIIQNVTKQSYTKYITNSWLKPLHMTHTSF
KQTNYKSKHDAIGYELQGSTPVVSKPEFNLWDTPSAYMMTSTEDLEHWIKFQLNP
PDKYKSLVQQSHKNLSSTIGEPNANAYASGWFTNNDEHLVFHSGTLDNFSSFILLN
PKQNYGIVVLANLNSEYVPKLVEHLNTQIVNHKRYSTVASMLNQYKDQFNIVTVL
MTTLILLAIFIFSAYRAWQMRHGQILLRRSKRIAVLSWLSLCICIALALILYALPYLIL
GSNNWSFVLTWLPIEIKLALITTLIALFSTLIVILLFLHTKITKT pbpF nucleotide
sequence (SEQ ID NO: 11) clones: BTEBG73 and BTAJO70
CTCTTAAATGAGACCGTTATTTTTTTGTCAAAAAGATAGAAATAATTTCTAAAT
TCATATATGATTTAAAGTGAAAGACTTTGAATAGAGGTAGGTAGTTTTGTTAA
AAAGACTAAAAGAAAAATCAAATGATGAAATCGTTCAAAATACCATTAACAA
GAGAATTAACTTTATATTTGGTGTGATTGTATTTATTTTTGCAGTACTAGTACT
ACGTTTAGGTTATTTACAAATCGCACAAGGCTCACATTATAAACAAATTATAA
AAAATGATGAAAACATTACAGTGAATGAGTCTGTGCCAAGAGGTCGTATTTTA
GACAGAAATGGGAAAGTTTTAGTTGATAATGCTTCTAAAATGGCTATTACATA
TACTAGGGGTCGAAAAACAACACAATCGGAAATGTTGGATACGGCTGAAAAG
TTATCAAAGCTAATCAAGATGGATACTAAGAAAATTACAGAACGTGATAAGA
AAGATTTCTGGATTCAGTTGCATCCTAAAAAAGCAAAAGCAATGATGACAAA
AGAACAAGCTATGTTAGCAGATGGAAGTATTAAACAAGATCAATATGATAAA
CAACTGTTATCGAAAATCGGAAAATCACAATTAGATGAATTGTCTTCTAAAGA
TTTACAAGTTTTAGCTATTTTTCGAGAGATGAATGCAGGAACAGTTTTAGATCC
ACAAATGATAAAAAATGAAGATGTCAGTGAAAAAGAGTATGCAGCAGTTTCT
CAGCAACTTTCCAAATTACCAGGTGTTAACACGTCTATGGATTGGGATAGAAA
ATATCCATATGGCGATACTTTAAGAGGTATATTCGGAGATGTATCGACACCTG
CTGAAGGTATTCCAAAAGAATTGACAGAACATTACTTATCCAAAGGATATTCA
CGCAATGATCGTGTTGGAAAATCTTACCTAGAATATCAATATGAAGATGTATT
GCGTGGTAAGAAGAAAGAAATGAAATACACAACGGACAAATCTGGTAAAGTT
ACATCTTCAGAAGTGTTAAATCCTGGCGCTCGCGGTCAAGATTTGAAATTAAC
GATCGATATAGATCTTCAAAAAGAAGTAGAAGCATTATTAGATAAACAAATT
AAGAAGCTTCGCAGTCAAGGTGCCAAAGATATGGATAATGCAATGATGGTTG
TACAAAATCCTAAAAATGGAGACATTCTTGCGCTTGCCGGAAAGCAGATTAAT
AAGAGTGGTAAAATGACTGATTATGACATTGGTACGTTTACTTCTCAATTTGC
GGTTGGATCTTCTGTAAAAGGTGGAACATTATTAGCCGGTTATCAGAATAAAG
CTATCAAAGTTGGAGAAACAATGGTCGATGAACCATTACATTTCCAAGGTGGT
TTGACAAAACGATCATACTTCAATAAAAACGGGCATGTAACTATTAATGATAA
GCAAGCTTTGATGCATTCATCAAACGTATATATGTTTAAAACAGCATTAAAAT
TAGCGGGAGACCCTTATTATTCTGGTATGGCTTTACCTTCAGACATAAGTTCAC
CTGCCCAAAAGCTAAGAAGAGGATTAAATCAAGTAGGCTTAGGTGTGAAAAC
AGGGATAGATTTACCAAATGAAACAAGAGGTCAAATCGAACCATTAACAAAT
AATCCAGGTAATTATCTAGATTTATCAATTGGTCAATATGATACCTATACACC
ATTACAATTATCACAATATGTTTCAACTATAGCGAATGATGGTTATAGAATAC
AGCCACACATTGGATTAACGATTCATGAATCAACTAATAAAGATGAGGTTGGT
CCACTCAAGAAGAAAATTAATGGCACTGTCTTGAACAAGGTTAATAATACTGA
AAAGGAAATCAAACAAATTCAAGAAGGATTCAAAATGGCATTTAATGATAAA
GATGGTACTGGATATGTTAGTTTTAAAGATACAGTAGTACCTACTGCTGGTAA
AACGGGTACCGCAGAAGTGTTCCAAAACGGAGAGCCAAGAGTTAACTCTACT
TATATAGGATACGCGCCAATTGATGATCCAAAATTAGCGTTTTCAATTGTATA
TACAAATCAGCCTGTACCACCACCATGGTTAACAGGTGGAGACTTAGGTAGAG
ATGTAATTAACTACTACTTTAAGCAGTTAGGTAAAGATGATAAAAATAAAGAC
AAAGACAAATAAAATTTAACCTGACGATTGTGTAGCGCATGGTTGTAAAATTT TAACTTTGC
pbpF amino acid sequence (SEQ ID NO: 12) clones: BTEBG73 and
BTAJO70 LLKRLKEKSNDEIVQNTINKRINFIFGVIVFIFAVLVL-
RLGYLQIAQGSHYKQIIKNDE NITVNESVPRGRILDRNGKVLVDNASKMAITYTRGR-
KTTQSEMLDTAEKLSKLIK MDTKKITERDKKDFWIQLHPKKAKAMMTKEQAMLADGS-
IKQDQYDKQLLSKIG KSQLDELSSKDLQVLAIFREMNAGTVLDPQMIKNEDVSEKEY-
AAVSQQLSKLPGV NTSMDWDRKYPYGDTLRGIFGDVSTPAEGIPKELTEHYLSKGYS-
RNDRVGKSYLE YQYEDVLRGKKKEMKYTTDKSGKVTSSEVLNPGARGQDLKLTIDID-
LQKEVEALL DKQIKKLRSQGAKDMDNAMMVVQNPKNGDILALAGKQINKSGKMTDYD- IGTFTS
QFAVGSSVKGGTLLAGYQNKAIKVGETMVDEPLHFQGGLTKRSYFNKNGHV- TIN
DKQALMHSSNVYMFKTALKLAGDPYYSGMALPSDISSPAQKLRRGLNQVGLGVK
TGIDLPNETRGQIEPLTNNPGNYLDLSIGQYDTYTPLQLSQYVSTIANDGYRIQPHI- G
LTIHESTNKDEVGPLKKKINGTVLNKVNNTEKEIKQIQEGFKMAFNDKDGTGYVS
FKDTVVPTAGKTGTAEVFQNGEPRVNSTYIGYAPIDDPKLAFSIVYTNQPVPPPWL
TGGDLGRDVINYYFKQLGKDDKNKDKDK pbpG nucleotide sequence (SEQ ID NO:
13) clones: BTEBU53 and BTEFB55
TCCTATTCCTTATGCATTTCCCCTAATTATAATTAACGTTAAAATAAAAGTCAA
ATTGCCTTAAATATGGTATACTATAACGTAATTTAGGAGGTTAAAGATGACGA
ATCAAGACAACAATCATCAATTGAATCATCGTATATATCATTTTGAAAAGATA
TATAAAGCTATCAAACATGTCATTGTTTACATATTTATGATTTTCATTGCCATC
GTTGCTATCGCTGTGATTGCGATGTCTTTATATTTTCATCATTTAACTAAAACG
TCCGACTCATTATCAGATGATGCTTTAATAAAAAAAGTTCGACAAATACCTGG
CGATGAATTATTAGATCATAATAACAAAAATTTATTATATGAGTATAACCATT
CTCAAAACTCACTCATTATAGGCCCTAAAACATCAAGTCCAAATGTCATTAAA
GCATTAACGTCATCTGAAGACACTTTATTTTATAAACATGATGGCATCTTACCA
AAGGCGATTTTAAGAGCAATGATACAAGATATTTTTAATACTGATCAAAGTTC
AGGTGGTAGCACAATTACACAACAACTTGTTAAAAATCAAGTTCTTACCAACG
AAAAAACATATAGTAGAAAAGCAAATGAACTTCGCCTAGCAATTAGATTAGA
ACACCTACTCTCAAAAGATGAAATTATATATACATATTTAAATATAGTTCCCTT
CGGTAGAGATTATAATGGCGCTAATATTTCCGGAATTGCATCCGCTTCATATA
GTCTATTTGGTATTCCACCAAAAGATTTATCAATTGCACAATCTGCATACCTTA
TCGGTTTGTTGCAAAGCCCATATGGCTATACACCCTACGAAAAAGATGGAACG
TTAAAATCGGATAAAGATTTGAAATATAGTATTCAAAGACAACATTATGTATT
AAAGCGTATGTTAATCGAAGATCAAATCACTGAAAAAGAATACAACGACGCA
TTAAAATATGATATTAAATCACATTTGTTAAATCGAAAAAAGCGTTAATTGAT
GCTCACTTTTTAAAGTAACCACAACAATGAATCCAAATATTAAAA pbpG amino acid
sequence (SEQ ID NO: 14) clones: BTEBU53 and BTEFB55
MTNQDNNHQLNHRIYHFEKIYKAIKHVIVYIFMIFIAVAIAVIAMSLYFHHLTKTSD
SLSDDALIKKVRQIPGDELLDHNNKNLLYEYNHSQNSLIIGPKTSSPNVIKALTSSED
TLFYKHDGILPKAILRAMIQDIFNTDQSSGGSTITQQLVKNQVLTNEKTYSRKANEL
RLAIRLEHLLSKDEIIYTYLNIVPFGRDYNGANISGIASASYSLFGIPPKDLSIAQSAY
LIGLLQSPYGYTPYEKDGTLKSDKDLKYSIQRQHYVLKRMLIEDQITEKEYNDALK
YDIKSHLLNRKKR cbrA nucleotide sequence (SEQ ID NO: 15) clones:
BTACA44 and BTAGJ54 TAGTCAATGAATAAAGTAATTAAAATGCTTG-
TTGTTACGCTTGCTTTCCTACTT GTTTTAGCAGGATGTAGTGGGAATTCAAATAAAC-
AATCATCTGATAACAAAGA TAAGGAAACAACTTCAATTAAACATGCAATGGGTACAA-
CTGAAATTAAAGGG AAACCAAAGCGTGTTGTTACGCTATATCAAGGTGCCACTGACG-
TCGCTGTATC TTTAGGTGTTAAACCTGTAGGTGCTGTAGAATCATGGACACAAAAAC- CGAAAT
TCGAATACATAAAAAATGATTTAAAAGATACTAAGATTGTAGGTCAAGAAC- CT
GCACCTAACTTAGAGGAAATCTCTAAATTAAAACCGGACTTAATTGTCGCGTC
AAAAGTTAGAAATGAAAAAGTTTACGATCAATTATCTAAAATCGCACCAACA
GTTTCTACTGATACAGTTTTCAAATTCAAAGATACAACTAAGTTAATGGGGAA
AGCTTTAGGGAAAGAAAAAGAAGCTGAAGATTTACTTAAAAAGTACGATGAT
AAAGTAGCTGCATTCCAAAAAGATGCAAAAGCAAAGTATAAAGATGCATGGC
CATTGAAAGCTTCAGTTGTTAACTTCCGTGCTGATCATACAAGAATTTATGCTG
GTGGATATGCTGGTGAAATCTTAAATGATTTAGGATTCAAACGTAATAAAGAC
TTACAAAAACAAGTTGATAATGGTAAAGATATTATCCAACTTACATCTAAAGA
AAGCATTCCATTAATGAACGCTGATCATATTTTTGTAGTAAAATCAGATCCAA
ATGCGAAAGATGCTGCATTAGTTAAAAAGACTGAAAGCGAATGGACTTCAAG
TAAAGAGTGGAAAAATTTAGACGCAGTTAAAAACAACCAAGTATCTGATGAT
TTAGATGAAATCACTTGGAACTTAGCTGGCGGATATAAATCTTCATTAAAACT
TATTGACGATTTATATGAAAAGTTAAATATTGAAAAACAATCAAAATAA cbrA amino acid
sequence (SEQ ID NO: 16) clones: BTACA44 and BTAGJ54
MNKVIKMLVVTLAFLLVLAGCSGNSNKQSSDNKDKETTSIKHAMGTTEIKGKPKR
VVTLYQGATDVAVSLGVKPVGAVESWTQKPKFEYIKNDLKDTKIVGQEPAPNLE
EISKLKPDLIVASKVRNEKVYDQLSKIAPTVSTDTVFKFKDTTKLMGKALGKEKEA
EDLLKKYDDKVAAFQKDAKAKYKDAWPLKASVVNFRADHTRIYAGGYAGEILN
DLGFKRNKDLQKQVDNGKDIIQLTSKESIPLMNADHIFVVKSDPNAKDAALVKKT
ESEWTSSKEWKNLDAVKNNQVSDDLDEITWNLAGGYKSSLKLIDDLYEKLNIEKQ SK cbrB
nucleotide sequence (SEQ ID NO: 17) clones: BTACA44 and BTAGJ54
TAATTAAGGAGTTTTACGATGCTACTTAAACCAAAATA- CCAAATCGTTATTGC
TGGTTTATGTCTTGCAATAGTAGCTATCTTAAGTTTAATGAT- TGGAAATACGCT
TGTGTCACCAGGTACGGTGATACAGGCGTTATTCAACTTTGATAG- TGAAAACG
ATTTACATGATGTTGTCACTGGTGCACGGGCGTCGAGAACAATCATTGC- GTTA
TTGACTGGTGCTGCCCTTGCTGTCTCAGGTTTGTTGATGCAAGCACTTACACG- A
AACCCAATAGCCTCACCAGGGCTTTTCGGTGTCAATGCAGGCGCAGTATTTTT
TGTCATTTTTAGTATTACATTTATCCAAATTCAATCTTTTAAAATGATTGTAGTT
ATTGCATTTTTGGGGGCTATTGTTGTTACTGTATTAGTTGTTGCACTAGGTATG
TTTAGACAAACACTATTCTCACCTCACCGTGTCATTTTGGCAGGTGCTGCGATT
GCGATGCTATTTACAGCCTTTACTCAAGGCATACTTATTATGAACGAAACAGA
CTTACAAGGCCTATTATTTTGGTTAAGTGGCTCCGTTTCATTACGTAATATTTG
GGATATCCCATGGATTATTCCGCTTGTATTGATACTTATTTTAATTGCATTTAG
CATGGCTGCACACATCAACATCTTGATGACAAGTGACGACATTGCAACCGGCC
TCGGTCAAAACATAAAATTAATCAAATGGATGATTATTATGCTCATCAGTATG
TTAGCCGGTATTTCGGTAGCCGTAGCTGGATCAATCGTCTTTGTGGGTCTTATC
GTACCGAATATTAGCAAACGATTATTACCACCAAACTATAAGTATTTAATTCC
TTTTACTGCATTAGCTGGAGCAATCCTAATGATCATTTCAGACATTGTTGCTCG
TATAATAATTAAGCCACTAGAGTTGCCTATCGGTGTCGTTACCGCTGTCATTGG
CGCTATTGTCTTAATCTATATTATGAAGAAAGGACGTCAACGCTTATGA cbrB amino acid
sequence (SEQ ID NO: 18) clones: BTACA44 and BTAGJ54
MLLKPKYQIVIAGLCLAIVAILSLMIGNTLVSPGTVIQALFNFDSENDLHDVVTGAR
ASRTIIALLTGAALAVSGLLMQALTRNPIASPGLFGVNAGAVFFVIFSITFIQIQSFKM
IVVIAFLGAIVVTVLVVALGMFRQTLFSPHRVILAGAAIAMLFTAFTQGILMNETD
LQGLLFWLSGSVSLRNIWDIPWIIPLVLILILIAFSMAAHINILMTSDDIATGLGQNIK
LIKWMIIMLISMLAGISVAVAGSIVFVGLIVPNISKRLLPPNYKYLIPFTALAGAILMII
SDIVARIIIKPLELPIGVVTAVIGAIVLIYIMKKGRQRL cbrC nucleotide sequence
(SEQ ID NO: 19) clones: BTACA44 and BTAGJ54
TAAGCCACTAGAGTTGCCTATCGGTGTCGTTACCGCTGTCATTGGCGCTATTGT
CTTAATCTATATTATGAAGAAAGGACGTCAACGCTTATGACCGAAAAGATTAA
TAAAAAAGACAATTACCATCTCATCTTCGCGTTAATCTTTTTAGCCATCGTTTC
AGTGGTAAGTATGATGATTGGTTCAAGCTTTATACCATTACAACGCGTACTGA
TGTACTTTATAAATCCAAATGACAGTATGGATCAATTCACTTTAGAAGTATTA
CGCTTACCTCGCATTACACTTGCGATTTTAGCAGGTGCCGCACTAGGAATGAG
TGGTTTAATGTTGCAAAATGTATTAAAAAATCCAATTGCCTCACCTGATATTAT
CGGTATCACAGGTGGTGCTAGCTTAAGTGCTGTTGTCTTTATTGCATTTTTCAG
CCATTTAACAATACATTTACTTCCACTATTTGCAGTATTAGGTGGCGCAGTTGC
AATGATGATACTATTAGTGTTTCAAACGAAAGGACAAATACGCCCGACAACA
CTCATAATCATCGGTATTTCGATGCAAACGTTGTTTATTGCGCTTGTCCAAGGA
TTACTCATTACAACGAAGCAATTATCTGCTGCCAAAGCTTATACATGGCTAGT
CGGAAGTCTTTACGGTGCTACGTTTAAAGATACAATCATTTTGGGTATGGTTAT
TTTAGCTGTTGTGCCGTTGTTATTTCTTGTTATACCAAAAATGAAAATATCTAT
ACTTGATGACCCTGTAGCGATTGGCTTAGGCTTACATGTACAACGTATGAAAC
TAATCCAATTAATCACTTCTACTATACTCGTATCTATGGCAATCAGTTTAGTAG
GTAACATTGGGTTTGTCGGTTTAATCGCACCACATATCGCGAAAACAATCGTT
CGCGGAAGTTATGCTAAAAAGTTACTAATGTCAGCAATGATTGGTGCCATATC
AATTGTTATTGCAGACTTAATTGGGCGTACCTTATTCTTGCCTAAAGAAGTGCC
AGCAGGTGTATTTATTGCTGCTTTTGGTGCCCCATTCTTCATATACTTATTATTA
ACCGTGAAAAAGTTATAA cbrC amino acid sequence (SEQ ID NO: 20) clones:
BTACA44 and BTAGJ54 MTEKINKKDNYHLIFALIFLAIVSVVS-
MMIGSSFIPLQRVLMYFINPNDSMDQFTLE VLRLPRITLAILAGAALGMSGLMLQNV-
LKNPIASPDIIGITGGASLSAVVFIAFFSHL TIHLLPLFAVLGGAVAMMILLVFQTK-
GQIRPTTLIIIGISMQTLFIALVQGLLITTKQL SAAKAYTWLVGSLYGATFKDTIIL-
GMVILAVVPLLFLVIPKMKISILDDPVAIGLGL HVQRMKLIQLITSTILVSMAISLV-
GNIGFVGLIAPHIAKTIVRGSYAKKLLMSAMIGA ISIVIADLIGRTLFLPKEVPAGV-
FIAAFGAPFFIYLLLTVKKL enolase nucleotide sequence (SEQ ID NO: 21)
clones: BTAAI44 and BTAGE12 TAATGACACTTATTTTTTGAAAA-
TAATAGTAATATCATTTTGTTAAATGAAAGA ATAAAGCTATAATAATTATAGAATAA-
CTATTTAAAGGAGATTATAAACATGCC AATTATTACAGATGTTTACGCTCGCGAAGT-
CTTAGACTCTCGTGGTAACCCAA CTGTTGAAGTAGAAGTATTAACTGAAAGTGGCGC-
ATTTGGTCGTGCATTAGTA CCATCAGGTGCTTCAACTGGTGAACACGAAGCTGTTGA-
ATTACGTGATGGAGA CAAATCACGTTATTTAGGTAAAGGTGTTACTAAAGCAGTTGA-
AAACGTTAATG AAATCATCGCACCAGAAATTATTGAAGGTGAATTTTCAGTATTAGA- TCAAGTA
TCTATTGATAAAATGATGATCGCATTAGACGGTACTCCAAACAAAGGTAA- ATT
AGGTGCAAATGCTATTTTAGGTGTATCTATCGCAGTAGCACGTGCAGCAGCTG
ACTTATTAGGTCAACCACTTTACAAATATTTAGGTGGATTTAATGGTAAGCAG
TTACCAGTACCAATGATGAACATCGTTAATGGTGGTTCTCACTCAGATGCTCC
AATTGCATTCCAAGAATTCATGATTTTACCTGTAGGTGCTACAACGTTCAAAG
AATCATTACGTTGGGGTACTGAAATTTTCCACAACTTAAAATCAATTTTAAGC
CAACGTGGTTTAGAAACTGCCGTAGGTGACGAAGGTGGTTTCGCTCCTAAATT
TGAAGGTACTGAAGATGCTGTTGAAACAATTATCCAAGCAATCGAAGCAGCT
GGTTACAAACCAGGTGAAGAAGTATTCTTAGGATTTGACTGTGCATCATCAGA
ATTCTATGAAAATGGTGTATATGACTACAGTAAGTTCGAAGGCGAACACGGTG
CAAAACGTACAGCTGCAGAACAAGTTGACTACTTAGAACAATTAGTAGACAA
ATATCCTATCATTACAATTGAAGACGGTATGGACGAAAACGACTGGGATGGTT
GGAAACAACTTACAGAACGTATCGGTGACCGTGTACAATTAGTAGGTGACGA
TTTATTCGTAACAAACACTGAAATTTTAGCAAAAGGTATTGAAAACGGAATTG
GTAACTCAATCTTAATTAAAGTTAACCAAATCGGTACATTAACTGAAACATTT
GATGCAATCGAAATGGCTCAAAAAGCTGGTTACACAGCAGTAGTTTCTCACCG
TTCAGGTGAAACAGAAGATACAACAATTGCTGATATTGCTGTTGCTACAAACG
CTGGTCAAATTAAAACTGGTTCATTATCACGTACTGACCGTATTGCTAAATAC
AATCAATTATTACGTATCGAAGATGAATTATTTGAAACTGCTAAATATGACGG
TATCAAATCATTCTATAACTTAGATAAATAATTTTCTTTATAATCAAATGCTGA
CATAATTTTAGTTGAGGATTATTATGACGG enolase amino acid sequence (SEQ ID
NO: 22) clones: BTAAI44 and BTAGE12
MPIITDVYAREVLDSRGNPTVEVEVLTESGAFGRALVPSGASTGEHEAVELRDGD
KSRYLGKGVTKAVENVNEIIAPEIIEGEFSVLDQVSIDKMMIALDGTPNKGKLGAN
AILGVSIAVARAAADLLGQPLYKYLGGFNGKQLPVPMMNIVNGGSHSDAPIAFQE
FMILPVGATTFKESLRWGTEIFHNLKSILSQRGLETAVGDEGGFAPKFEGTEDAVE
TIIQAIEAAGYKPGEEVFLGFDCASSEFYENGVYDYSKFEGEHGAKRTAAEQVDYL
EQLVDKYPIITIEDGMDENDWDGWKQLTERIGDRVQLVGDDLFVTNTEILAKGIEN
GIGNSILIKVNQIGTLTETFDAIEMAQKAGYTAVVSHRSGETEDTTIADIAVATNAG
QIKTGSLSRTDRIAKYNQLLRIEDELFETAKYDGIKSFYNLDK
[0096] Illustrative of the invention, the nucleic acid molecule
described in Table 1 was discovered in a DNA library derived from a
S. aureus ISP3 genomic DNA.
[0097] Nucleic acid molecules of the present invention may be in
the form of RNA, such as mRNA, or in the form of DNA, including,
for instance, DNA and genomic DNA obtained by cloning or produced
synthetically. The DNA may be double-stranded or single-stranded.
Single-stranded DNA or RNA may be the coding strand, also known as
the sense strand, or it may be the non-coding strand, also referred
to as the anti-sense strand.
[0098] By "isolated" polynucleotide sequence is intended a nucleic
acid molecule, DNA or RNA, which has been removed from its native
environment. This includes segments of DNA comprising the S. aureus
polynucleotides of the present invention isolated from the native
chromosome. These fragments include both isolated fragments
consisting only of S. aureus DNA and fragments comprising
heterologous sequences such as vector sequences or other foreign
DNA. For example, recombinant DNA molecules contained in a vector
are considered isolated for the purposes of the present invention
which may be partially or substantially purified. Further examples
of isolated DNA molecules include recombinant DNA molecules
introduced and maintained in heterologous host cells or purified
(partially or substantially) DNA molecules in solution. Isolated
RNA molecules include in vivo or in vitro RNA transcripts of the
DNA molecules of the present invention. Isolated nucleic acid
molecules according to the present invention further include such
molecules produced synthetically which may be partially or
substantially purified. The term "isolated" does not refer to
genomic or cDNA libraries, whole cell mRNA preparations, genomic
DNA digests (including those gel separated by electrophoresis),
sheared whole cell genomic DNA preparations or other compositions
where the art demonstrates no distinguishing features of the
polynucleotides sequences of the present invention.
[0099] In addition, isolated nucleic acid molecules of the
invention include DNA molecules which comprise a sequence
substantially different from those described above but which, due
to the degeneracy of the genetic code, still encode a S. aureus
polypeptides and peptides of the present invention (e.g.
polypeptides of Table 1). That is, all possible DNA sequences that
encode the S. aureus polypeptides of the present invention. This
includes the genetic code and species-specific codon preferences
known in the art. Thus, it would be routine for one skilled in the
art to generate the degenerate variants described above, for
instance, to optimize codon expression for a particular host (e.g.,
change codons in the bacteria mRNA to those preferred by a
mammalian or other bacterial host such as E. coli).
[0100] The invention further provides isolated nucleic acid
molecules having the nucleotide sequence shown in Table 1 or a
nucleic acid molecule having a sequence complementary to one of the
above sequences. Such isolated molecules, particularly DNA
molecules, are useful as probes for gene mapping and for
identifying S. aureus in a biological sample, for instance, by PCR
or Northern blot analysis. In specific embodiments, the
polynucleotides of the present invention are less than 300 kb, 200
kb, 100 kb, 50 kb, 10 kb, 7.5 kb, 5 kb, 2.5 kb, and 1 kb. In
another embodiment, the polynucleotides comprising the coding
sequence for polypeptides of the present.
[0101] The present invention is further directed to nucleic acid
molecules encoding portions or fragments of the polynucleotide
sequences described herein, e.g., shown in the Tables, sequence
listing, or contained in the deposited clones. Uses for the
polynucleotide fragments of the present invention include probes,
primers, molecular weight, markers and for expressing the
polypeptide fragments of the present invention. Fragments include
portions of the polynucleotide sequences, at least 10 contiguous
nucleotides in length selected from any two integers, one of which
representing a 5' nucleotide position and a second of which
representing a 3' nucleotide position, where the first, or 5' most,
nucleotide for each disclosed polynucleotide sequence is position
1. That is, every combination of a 5' and 3' nucleotide position
that a fragment at least 10 contiguous nucleotides in length could
occupy is included in the invention as an individual specie. "At
least" means a fragment may be 10 contiguous nucleotide bases in
length or any integer between 10 and the length of an entire
nucleotide sequence minus 1. Therefore, included in the invention
are contiguous fragments specified by any 5' and 3' nucleotide base
positions of a polynucleotide sequences wherein the contiguous
fragment is any integer between 10 and the length of an entire
nucleotide sequence minus 1. The polynucleotide fragments specified
by 5' and 3' positions can be immediately envisaged using the above
description and are therefore not individually listed solely for
the purpose of not unnecessarily lengthening the specifications.
Although it is particularly pointed out that each of the above
described species are included in the present invention.
[0102] Further, the invention includes polynucleotides comprising
sub-genuses of fragments specified by size, in nucleotides, rather
than by nucleotide positions. The invention includes any fragment
size, in contiguous nucleotides, selected from integers between 10
and the length of an entire nucleotide sequence minus 1 (where 1 is
the first, or 5' most, nucleotide for each disclosed polynucleotide
sequence). Preferred sizes of contiguous nucleotide fragments
include 20 nucleotides, 30 nucleotides, 40 nucleotides, 50
nucleotides, 60 nucleotides, 70 nucleotides, 80 nucleotides, 90
nucleotides, 100 nucleotides, 125 nucleotides, 150 nucleotides, 175
nucleotides, 200 nucleotides, 250 nucleotides, 300 nucleotides, 350
nucleotides, 400 nucleotides, 450 nucleotides, 500 nucleotides, 550
nucleotides, 600 nucleotides, 650 nucleotides, 700 nucleotides, 750
nucleotides, 800 nucleotides, 850 nucleotides, 900 nucleotides, 950
nucleotides, 1000 nucleotides. Other preferred sizes of contiguous
polynucleotide fragments, which may be useful as diagnostic probes
and primers, include fragments 50-300 nucleotides in length which
include, as discussed above, fragment sizes representing each
integer between 50-300. Larger fragments are also useful according
to the present invention corresponding to most, if not all, of the
polynucleotide sequences of the sequence listing or deposited
clones. The preferred sizes are, of course, meant to exemplify not
limit the present invention as all size fragments, representing any
integer between 10 and the length of an entire nucleotide sequence
minus 1 of the sequence listing or deposited clones, are included
in the invention. Additional preferred nucleic acid fragments of
the present invention include nucleic acid molecules encoding
epitope-bearing portions of the polypeptides.
[0103] The polynucleotide fragments, specified in contiguous
nucleotides, can be immediately envisaged using the above
description and are therefore not individually listed solely for
the purpose of not unnecessarily lengthening the specification.
[0104] The present invention also provides for the exclusion of any
fragment, specified by 5' and 3' base positions or by size in
nucleotide bases as described above for any nucleotide sequence of
the sequence listing or deposited clones. Any number of fragments
of nucleotide sequences specified by 5' and 3' base positions or by
size in nucleotides, as described above, may be excluded from the
present invention.
[0105] In another aspect, the invention provides an isolated
nucleic acid molecule comprising a polynucleotide which hybridizes
under stringent hybridization conditions to a portion of a
polynucleotide in a nucleic acid molecules of the invention
described above, for instance, nucleotide sequences of Table 1 or
the S. aureus sequences of the plasmid clones listed in Table 1. By
"stringent hybridization conditions" is intended overnight
incubation at 42.degree. C. in a solution comprising: 50%
formamide, 5.times.SSC (150 mM NaCl, 15 mM trisodium citrate), 50
mM sodium phosphate (pH 7.6), 5.times.Denhardt's solution, 10%
dextran sulfate, and 20 .mu.g/ml denatured, sheared salmon sperm
DNA, followed by washing the filters in 0.1.times.SSC at about
65.degree. C.
[0106] By a polynucleotide which hybridizes to a "portion" of a
polynucleotide is intended a polynucleotide (either DNA or RNA)
hybridizing to at least about 15 nucleotides bases, and more
preferably at least about 20 nucleotides bases, still more
preferably at least about 30 nucleotides bases, and even more
preferably about 30-70 (e.g., 50) nucleotides bases of the
reference polynucleotide. These are useful as diagnostic probes and
primers as discussed above. By a portion of a polynucleotide of "at
least 20 nucleotides bases in length," for example, is intended 20
or more contiguous nucleotides bases nucleotides from the
nucleotide sequence of the reference polynucleotide (e.g., the
nucleotide sequence as shown in Table 1). Portions of a
polynucleotide which hybridizes to a nucleotide sequence in Table
1, which can be used as probes and primers, may also be precisely
specified by 5' and 3' base positions or by size in nucleotide
bases as described above or precisely excluded in the same
manner.
[0107] The nucleic acid molecules of the present invention, which
encode a S. aureus polypeptide, may include, but are not limited
to, nucleic acid molecules encoding: the full length S. aureus
polypeptide of Table 1, the full length polypeptide expressed by
the plasmid clones listed in Table 1, and portions of the S aureus
polypeptides of Table 1 and the polypeptides expressed by the
plasmid clones listed in Table 1. Also included in the present
invention are nucleic acids encoding the above full length
sequences and further comprise additional sequences, such as those
encoding an added secretory leader sequence, such as a pre-, or
pro- or prepro- protein sequence. Further included in the present
invention are nucleic acids encoding the above full length
sequences and portions thereof and further comprise additional
heterologous amino acid sequences encoded by nucleic acid sequences
from a different source.
[0108] Also included in the present invention are nucleic acids
encoding the above protein sequences together with additional,
non-coding sequences, including for example, but not limited to
non-coding 5' and 3' sequences. These sequences include
transcribed, non-translated sequences that may play a role in
transcription, and mRNA processing, for example, ribosome binding
and stability of mRNA. Also included in the present invention are
additional coding sequences which provide additional
functionalities.
[0109] Thus, a nucleotide sequence encoding a polypeptide may be
fused to a marker sequence, such as a sequence encoding a peptide
which facilitates purification of the fused polypeptide. In certain
preferred embodiments of this aspect of the invention, the marker
amino acid sequence is a hexa-histidine peptide, such as the tag
provided in a pQE vector (QIAGEN, Inc., 9259 Eton Avenue,
Chatsworth, Calif., 91311), among others, many of which are
commercially available. For instance, hexa-histidine provides for
convenient purification of the fusion protein. See Gentz et al.
(1989) Proc. Natl. Acad. Sci. 86:821-24. The "HA" tag is another
peptide useful for purification which corresponds to an epitope
derived from the influenza hemagglutinin protein. See Wilson et al.
(1984) Cell 37:767. As discussed below, other such fusion proteins
include the S. aureus fused to Fc at the N-- or C-terminus.
[0110] Variant and Mutant Polynucleotides
[0111] The present invention further relates to variants of the
nucleic acid molecules which encode portions, analogs or
derivatives of a S. aureus polypeptides of Table 1, or encoded by
the plasmid clones listed in Table 1, and variant polypeptides
thereof including portions, analogs, and derivatives of the S.
aureus polypeptides. Variants may occur naturally, such as a
natural allelic variant. By an "allelic variant" is intended one of
several alternate forms of a gene occupying a given locus on a
chromosome of an organism. See, e.g., B. Lewin, Genes IV (1990).
Non-naturally occurring variants may be produced using art-known
mutagenesis techniques.
[0112] Such nucleic acid variants include those produced by
nucleotide substitutions, deletions, or additions. The
substitutions, deletions, or additions may involve one or more
nucleotides. The variants may be altered in coding regions,
non-coding regions, or both. Alterations in the coding regions may
produce conservative or non-conservative amino acid substitutions,
deletions or additions. Especially preferred among these are silent
substitutions, additions and deletions, which do not alter the
properties and activities of a S. aureus protein of the present
invention or portions thereof. Also especially preferred in this
regard are conservative substitutions.
[0113] Such polypeptide variants include those produced by amino
acid substitutions, deletions or additions. The substitutions,
deletions, or additions may involve one or more residues.
Alterations may produce conservative or non-conservative amino acid
substitutions, deletions, or additions. Especially preferred among
these are silent substitutions, additions and deletions, which do
not alter the properties and activities of a S. aureus protein of
the present invention or portions thereof. Also especially
preferred in this regard are conservative substitutions.
[0114] The present invention also relates to recombinant vectors,
which include the isolated nucleic acid molecules of the present
invention, and to host cells containing the recombinant vectors, as
well as to methods of making such vectors and host cells and for
using them for production of S. aureus polypeptides or peptides by
recombinant techniques.
[0115] The present application is directed to nucleic acid
molecules at least 90%, 95%, 96%, 97%, 98% or 99% identical to a
nucleic acid sequence shown in Table 1 or to the nucleic acid
sequence of the plasmid clones listed in Table 1. The above nucleic
acid sequences are included irrespective of whether they encode a
polypeptide having S. aureus activity. This is because even where a
particular nucleic acid molecule does not encode a polypeptide
having S. aureus activity, one of skill in the art would still know
how to use the nucleic acid molecule, for instance, as a
hybridization probe. Uses of the nucleic acid molecules of the
present invention that do not encode a polypeptide having S. aureus
activity include, inter alia, isolating an S. aureus gene or
allelic variants thereof from a DNA library, and detecting S.
aureus mRNA expression samples, environmental samples, suspected of
containing S. aureus by Northern Blot analysis.
[0116] Preferred, are nucleic acid molecules having sequences at
least 90%, 95%, 96%, 97%, 98% or 99% identical to the nucleic acid
sequence shown in Table 1 or to the nucleic acid sequence of the
plasmid clones listed in Table 1, which do, in fact, encode a
polypeptide having S. aureus protein activity By "a polypeptide
having S. aureus activity" is intended polypeptides exhibiting
activity similar, but not necessarily identical, to an activity of
the S. aureus protein of the invention, as measured in a particular
biological assay suitable for measuring activity of the specified
protein.
[0117] Of course, due to the degeneracy of the genetic code, one of
ordinary skill in the art will immediately recognize that a large
number of the nucleic acid molecules having a sequence at least
90%, 95%, 96%, 97%, 98%, or 99% identical to the nucleic acid
sequence of the plasmid clones listed in Table 1 or a nucleic acid
sequence shown in Table 1 will encode a polypeptide having S.
aureus protein activity. In fact, since degenerate variants of
these nucleotide sequences all encode the same polypeptide, this
will be clear to the skilled artisan even without performing the
above described comparison assay. It will be further recognized in
the art that, for such nucleic acid molecules that are not
degenerate variants, a reasonable number will also encode a
polypeptide having S. aureus protein activity. This is because the
skilled artisan is fully aware of amino acid substitutions that are
either less likely or not likely to significantly effect protein
function (e.g., replacing one aliphatic amino acid with a second
aliphatic amino acid), as further described below.
[0118] By a polynucleotide having a nucleotide sequence at least,
for example, 95% "identical" to a reference nucleotide sequence of
the present invention, it is intended that the nucleotide sequence
of the polynucleotide is identical to the reference sequence except
that the polynucleotide sequence may include up to five point
mutations per each 100 nucleotides of the reference nucleotide
sequence encoding the S. aureus polypeptide. In other words, to
obtain a polynucleotide having a nucleotide sequence at least 95%
identical to a reference nucleotide sequence, up to 5% of the
nucleotides in the reference sequence may be deleted, inserted, or
substituted with another nucleotide. The query sequence may be an
entire sequence shown in Table 1, the ORF (open reading frame), or
any fragment specified as described herein.
[0119] As a practical matter, whether any particular nucleic acid
molecule or polypeptide is at least 90%, 95%, 96%, 97%, 98% or 99%
identical to a nucleotide sequence of the presence invention can be
determined conventionally using known computer programs. A
preferred method for determining the best overall match between a
query sequence (a sequence of the present invention) and a subject
sequence, also referred to as a global sequence alignment, can be
determined using the FASTDB computer program based on the algorithm
of Brutlag et al. See Brutlag et al. (1990) Comp. App. Biosci.
6:237-245. In a sequence alignment the query and subject sequences
are both DNA sequences. An RNA sequence can be compared by first
converting U's to T's. The result of said global sequence alignment
is in percent identity. Preferred parameters used in a FASTDB
alignment of DNA sequences to calculate percent identity are:
Matrix=Unitary, k-tuple=4, Mismatch Penalty=1, Joining Penalty=30,
Randomization Group Length=0, Cutoff Score=1, Gap Penalty=5, Gap
Size Penalty 0.05, Window Size=500 or the length of the subject
nucleotide sequence, whichever is shorter.
[0120] If the subject sequence is shorter than the query sequence
because of 5' or 3' deletions, not because of internal deletions, a
manual correction must be made to the results. This is because the
FASTDB program does not account for 5' and 3' truncations of the
subject sequence when calculating percent identity. For subject
sequences truncated at the 5' or 3' ends, relative to the query
sequence, the percent identity is corrected by calculating the
number of bases of the query sequence that are 5' and 3' of the
subject sequence, which are not matched/aligned, as a percent of
the total bases of the query sequence. Whether a nucleotide is
matched/aligned is determined by results of the FASTDB sequence
alignment. This percentage is then subtracted from the percent
identity, calculated by the above FASTDB program using the
specified parameters, to arrive at a final percent identity score.
This corrected score is what is used for the purposes of the
present invention. Only nucleotides outside the 5' and 3'
nucleotides of the subject sequence, as displayed by the FASTDB
alignment, which are not matched/aligned with the query sequence,
are calculated for the purposes of manually adjusting the percent
identity score.
[0121] For example, a 90 nucleotide subject sequence is aligned to
a 100 nucleotide query sequence to determine percent identity. The
deletions occur at the 5' end of the subject sequence and
therefore, the FASTDB alignment does not show a matched/alignment
of the first 10 nucleotides at 5' end. The 10 unpaired nucleotides
represent 10% of the sequence (number of nucleotides at the 5' and
3' ends not matched/total number of nucleotides in the query
sequence) so 10% is subtracted from the percent identity score
calculated by the FASTDB program. If the remaining 90 nucleotides
were perfectly matched the final percent identity would be 90%. In
another example, a 90 nucleotide subject sequence is compared with
a 100 nucleotide query sequence. This time the deletions are
internal deletions so that there are no nucleotides on the 5' or 3'
of the subject sequence which are not matched/aligned with the
query. In this case the percent identity calculated by FASTDB is
not manually corrected. Once again, only nucleotides 5' and 3' of
the subject sequence which are not matched/aligned with the query
sequence are manually corrected for. No other manual corrections
are to made for the purposes of the present invention.
[0122] Vectors and Host Cell
[0123] The present invention also relates to vectors which include
the isolated DNA molecules of the present invention, host cells
comprising the recombinant vectors, and the production of S. aureus
polypeptides and peptides of the present invention expressed by the
host cells.
[0124] Recombinant constructs may be introduced into host cells
using well known techniques such as infection, transduction,
transfection, transvection, electroporation and transformation. The
vector may be, for example, a phage, plasmid, viral or retroviral
vector. Retroviral vectors may be replication competent or
replication defective. In the latter case, viral propagation
generally will occur only in complementing host cells.
[0125] The polynucleotides may be joined to a vector containing a
selectable marker for propagation in a host. Generally, a plasmid
vector is introduced in a precipitate, such as a calcium phosphate
precipitate, or in a complex with a charged lipid. If the vector is
a virus, it may be packaged in vitro using an appropriate packaging
cell line and then transduced into host cells.
[0126] Preferred are vectors comprising cis-acting control regions
to the polynucleotide of interest. Appropriate trans-acting factors
may be supplied by the host, supplied by a complementing vector or
supplied by the vector itself upon introduction into the host.
[0127] In certain preferred embodiments in this regard, the vectors
provide for specific expression, which may be inducible and/or cell
type-specific. Particularly preferred among such vectors are those
inducible by environmental factors that are easy to manipulate,
such as temperature and nutrient additives.
[0128] Expression vectors useful in the present invention include
chromosomal-, episomal- and virus-derived vectors, e.g., vectors
derived from bacterial plasmids, bacteriophage, yeast episomes,
yeast chromosomal elements, viruses such as baculoviruses, papova
viruses, vaccinia viruses, adenoviruses, fowl pox viruses,
pseudorabies viruses and retroviruses, and vectors derived from
combinations thereof, such as cosmids and phagemids.
[0129] The DNA insert should be operatively linked to an
appropriate promoter, such as the phage lambda PL promoter, the E.
coli lac, trp and tac promoters, the SV40 early and late promoters
and promoters of retroviral LTRs, to name a few. Other suitable
promoters will be known to the skilled artisan. The expression
constructs will further contain sites for transcription initiation,
termination and, in the transcribed region, a ribosome binding site
for translation. The coding portion of the mature transcripts
expressed by the constructs will preferably include a translation
initiating site at the beginning and a termination codon (UAA, UGA
or UAG) appropriately positioned at the end of the polypeptide to
be translated.
[0130] As indicated, the expression vectors will preferably include
at least one selectable marker. Such markers include dihydrofolate
reductase or neomycin resistance for eukaryotic cell culture and
tetracycline, kanamycin, or ampicillin resistance genes for
culturing in E. coli and other bacteria. Representative examples of
appropriate hosts include, but are not limited to, bacterial cells,
such as E. coli, Streptomyces and Salmonella typhimurium cells;
fungal cells, such as yeast cells; insect cells such as Drosophila
S2 and Spodoptera Sf9 cells; animal cells such as CHO, COS and
Bowes melanoma cells; and plant cells. Appropriate culture mediums
and conditions for the above-described host cells are known in the
art.
[0131] Among vectors preferred for use in bacteria include pQE70,
pQE60 and pQE9, pQE10 available from Qiagen; pBS vectors,
Phagescript vectors, Bluescript vectors, pNH8A, pNH16a, pNH18A,
pNH46A available from Stratagene; pET series of vectors available
from Novagen; and ptrc99a, pKK223-3, pKK233-3, pDR540, pRIT5
available from Pharmacia. Among preferred eukaryotic vectors are
pWLNEO, pSV2CAT, pOG44, pXT1 and pSG available from Stratagene; and
pSVK3, pBPV, pMSG and pSVL available from Pharmacia. Other suitable
vectors will be readily apparent to the skilled artisan.
[0132] Among known bacterial promoters suitable for use in the
present invention include the E. coli lacI and lacZ promoters, the
T3, T5 and T7 promoters, the gpt promoter, the lambda PR and PL
promoters and the trp promoter. Suitable eukaryotic promoters
include the CMV immediate early promoter, the HSV thymidine kinase
promoter, the early and late SV40 promoters, the promoters of
retroviral LTRs, such as those of the Rous sarcoma virus (RSV), and
metallothionein promoters, such as the mouse metallothionein-I
promoter.
[0133] Introduction of the construct into the host cell can be
effected by calcium phosphate transfection, DEAE-dextran mediated
transfection, cationic lipid-mediated transfection,
electroporation, transduction, infection or other methods. Such
methods are described in many standard laboratory manuals (for
example, Davis, et al., Basic Methods In Molecular Biology
(1986)).
[0134] Transcription of DNA encoding the polypeptides of the
present invention by higher eukaryotes may be increased by
inserting an enhancer sequence into the vector. Enhancers are
cis-acting elements of DNA, usually about from 10 to 300
nucleotides that act to increase transcriptional activity of a
promoter in a given host cell-type. Examples of enhancers include
the SV40 enhancer, which is located on the late side of the
replication origin at nucleotides 100 to 270, the cytomegalovirus
early promoter enhancer, the polyoma enhancer on the late side of
the replication origin, and adenovirus enhancers.
[0135] For secretion of the translated polypeptide into the lumen
of the endoplasmic reticulum, into the periplasmic space or into
the extracellular environment, appropriate secretion signals may be
incorporated into the expressed polypeptide, for example, the amino
acid sequence KDEL. The signals may be endogenous to the
polypeptide or they may be heterologous signals.
[0136] The polypeptide may be expressed in a modified form, such as
a fusion protein, and may include not only secretion signals, but
also additional heterologous functional regions. For instance, a
region of additional amino acids, particularly charged amino acids,
may be added to the N-terminus of the polypeptide to improve
stability and persistence in the host cell, during purification, or
during subsequent handling and storage. Also, peptide moieties may
be added to the polypeptide to facilitate purification. Such
regions may be removed prior to final preparation of the
polypeptide. The addition of peptide moieties to polypeptides to
engender secretion or excretion, to improve stability and to
facilitate purification, among others, are familiar and routine
techniques in the art. A preferred fusion protein comprises a
heterologous region from immunoglobulin that is useful to
solubilize proteins. For example, EP-A-O 464 533 (Canadian
counterpart 2045869) discloses fusion proteins comprising various
portions of constant region of immunoglobulin molecules together
with another human protein or part thereof. In many cases, the Fc
part in a fusion protein is thoroughly advantageous for use in
therapy and diagnosis and thus results, for example, in improved
pharmacokinetic properties (EP-A 0232 262). On the other hand, for
some uses it would be desirable to be able to delete the Fc part
after the fusion protein has been expressed, detected and purified
in the advantageous manner described. This is the case when Fc
portion proves to be a hindrance to use in therapy and diagnosis,
for example when the fusion protein is to be used as antigen for
immunizations. In drug discovery, for example, human proteins, such
as, hIL5-receptor has been fused with Fc portions for the purpose
of high-throughput screening assays to identify antagonists of
hIL-5. See Bennett, D. et al. (1995) J. Molec. Recogn. 8:52-58 and
Johanson, K. et al. (1995) J. Biol. Chem. 270 (16):9459-9471.
[0137] The S. aureus polypeptides can be recovered and purified
from recombinant cell cultures by well-known methods including
ammonium sulfate or ethanol precipitation, acid extraction, anion
or cation exchange chromatography, phosphocellulose chromatography,
hydrophobic interaction chromatography, affinity chromatography,
hydroxylapatite chromatography, lectin chromatography and high
performance liquid chromatography ("HPLC") is employed for
purification. Polypeptides of the present invention include
naturally purified products, products of chemical synthetic
procedures, and products produced by recombinant techniques from a
prokaryotic or eukaryotic host, including, for example, bacterial,
yeast, higher plant, insect and mammalian cells.
[0138] Polypeptides and Fragments
[0139] The invention further provides an isolated S. aureus
polypeptide having the amino acid sequence encoded by a plasmid
clone listed in Table 1, or an amino acid sequence in Table 1, or a
peptide or polypeptide comprising a portion of the above
polypeptides.
[0140] Variant and Mutant Polypeptides
[0141] To improve or alter the characteristics of S. aureus
polypeptides of the present invention, protein engineering may be
employed. Recombinant DNA technology known to those skilled in the
art can be used to create novel mutant proteins or muteins
including single or multiple amino acid substitutions, deletions,
additions, or fusion proteins. Such modified polypeptides can show,
e.g., enhanced activity or increased stability. In addition, they
may be purified in higher yields and show better solubility than
the corresponding natural polypeptide, at least under certain
purification and storage conditions.
[0142] N-Terminal and C-Terminal Deletion Mutants
[0143] It is known in the art that one or more amino acids may be
deleted from the N-terminus or C-terminus without substantial loss
of biological function. For instance, Ron et al. J. Biol. Chem.,
268:2984-2988 (1993), reported modified KGF proteins that had
heparin binding activity even if 3, 8, or 27 N-terminal amino acid
residues were missing. Accordingly, the present invention provides
polypeptides having one or more residues deleted from the amino
terminus of the amino acid sequence of the S. aureus polypeptides
shown in Table 1, and polynucleotides encoding such
polypeptides.
[0144] Similarly, many examples of biologically functional
C-terminal deletion muteins are known. For instance, Interferon
gamma shows up to ten times higher activities by deleting 8-10
amino acid residues from the carboxy terminus of the protein See,
e.g., Dobeli, et al. (1988) J. Biotechnology 7:199-216.
Accordingly, the present invention provides polypeptides having one
or more residues from the carboxy terminus of the amino acid
sequence of the S. aureus polypeptides shown in Table 1. The
invention also provides polypeptides having one or more amino acids
deleted from both the amino and the carboxyl termini as described
below.
[0145] The present invention is further directed to polynucleotide
encoding portions or fragments of the amino acid sequences
described herein as well as to portions or fragments of the
isolated amino acid sequences described herein. Fragments include
portions of the amino acid sequences of the Tables, sequence
listing, and encoded by deposited cDNA clones, at least 7
contiguous amino acid in length, selected from any two integers,
one of which representing a N-terminal position and another
representing a C-- terminal position. The first, or N-terminal
most, codon of each polypeptide disclosed herein is position 1.
Every combination of a N-terminal and C-terminal position that a
fragment at least 7 contiguous amino acid residues in length could
occupy, on any given amino acid sequence is included in the
invention as an individual specie. At least means a fragment may be
7 contiguous amino acid residues in length or any integer between 7
and the number of residues in a full length amino acid sequence
minus 1. Therefore, included in the invention are species of
contiguous fragments specified by any N-terminal and C-- terminal
positions of amino acid sequence set forth in the sequence listing
or encoded by the deposited cDNA clones, wherein the contiguous
fragment is any integer between 7 and the number of residues in a
full length sequence minus 1. The polypeptide fragments specified
by N-terminal and C-terminal positions can be immediately envisaged
using the above description and are therefore not individually
listed solely for the purpose of not unnecessarily lengthening the
specification. Although it is particularly pointed out that each of
the above described species are included in the present
invention.
[0146] Further, the invention includes polypeptides comprising
sub-genuses of fragments specified by size, in amino acid residues,
rather than by N-terminal and C-- terminal positions. The invention
includes any fragment size, in contiguous amino acid residues,
selected from integers between 7 and the number of residues in a
full length sequence minus 1. Preferred sizes of contiguous
polypeptide fragments include at least 7 amino acid residues, at
least 10 amino acid residues, at least 20 amino acid residues, at
least 30 amino acid residues, at least 40 amino acid residues, at
least 50 amino acid residues, at least 75 amino acid residues, at
least 100 amino acid residues, at least 125 amino acid residues, at
least 150 amino acid residues, at least 175 amino acid residues; at
least 200 amino acid residues, at least 225 amino acid residues, at
least 250 amino acid residues, at least 275 amino acid residues, at
least 300 amino acid residues, at least 325 amino acid residues, at
least 350 amino acid residues, at least 375 amino acid residues, at
least 400 amino acid residues, at least 425 amino acid residues,
and at least 450 amino acid residues. The preferred sizes are, of
course, meant to exemplify, not limit, the present invention as all
size fragments representing any integer between 7 and the number of
residues in a full length sequence minus 1 are included in the
invention.
[0147] The contiguous polypeptide fragments specified by size in
amino acid residues of the present invention can be immediately
envisaged using the above description and are therefore not
individually listed solely for the purpose of not unnecessarily
lengthening the specification.
[0148] The present invention also provides for the exclusion of any
fragments specified by N-terminal and C-terminal positions or by
size in amino acid residues as described above. Any number of
fragments specified by N-terminal and C-terminal positions or by
size in amino acid residues as described above.
[0149] It is particularly pointed out that the above fragments need
not be active since they would be useful, for example, in
immunoassays, in epitope mapping, epitope tagging, to generate
antibodies to a particular portion of the polypeptide, as vaccines,
and as molecular weight markers.
[0150] Also preferred are polypeptide and polynucleotide fragments
characterized by structural or functional domains, such as
fragments that comprise alpha-helix and alpha-helix forming
regions, beta-sheet and beta-sheet-forming regions, turn and
turn-forming regions, coil and coil-forming regions, hydrophilic
regions, hydrophobic regions, alpha amphipathic regions, beta
amphipathic regions, flexible regions, surface-forming regions,
substrate binding region, and high antigenic index regions.
[0151] Other preferred fragments are biologically active fragments.
Biologically active fragments are those exhibiting activity
similar, but not necessarily identical, to an activity of the
polypeptide of the present invention. The biological activity of
the fragments may include an improved desired activity, or a
decreased undesirable activity.
[0152] Other Mutants
[0153] In addition to N-- and C-terminal deletion forms of the
protein discussed above, it also will be recognized by one of
ordinary skill in the art that some amino acid sequences of the S.
aureus polypeptide can be varied without significant effect of the
structure or function of the protein. If such differences in
sequence are contemplated, it should be remembered that there will
be critical areas on the protein which determine activity.
[0154] Thus, the invention further includes variations of the S.
aureus polypeptides which show substantial S. aureus polypeptide
activity or which include regions of S. aureus protein such as the
protein portions discussed below. Such mutants include deletions,
insertions, inversions, repeats, and type substitutions selected
according to general rules known in the art so as to have little
effect on activity. For example, guidance concerning how to make
phenotypically silent amino acid substitutions is provided. There
are two main approaches for studying the tolerance of an amino acid
sequence to change. See, Bowie, J. U. et al. (1990), Science
247:1306-1310. The first method relies on the process of evolution,
in which mutations are either accepted or rejected by natural
selection. The second approach uses genetic engineering to
introduce amino acid changes at specific positions of a cloned gene
and selections or screens to identify sequences that maintain
functionality.
[0155] These studies have revealed that proteins are surprisingly
tolerant of amino acid substitutions. The studies indicate which
amino acid changes are likely to be permissive at a certain
position of the protein. For example, most buried amino acid
residues require nonpolar side chains, whereas few features of
surface side chains are generally conserved. Other such
phenotypically silent substitutions are described by Bowie et al.
(supra) and the references cited therein. Typically seen as
conservative substitutions are the replacements, one for another,
among the aliphatic amino acids Ala, Val, Leu and Ile; interchange
of the hydroxyl residues Ser and Thr, exchange of the acidic
residues Asp and Glu, substitution between the amide residues Asn
and Gln, exchange of the basic residues Lys and Arg and
replacements among the aromatic residues Phe, Tyr.
[0156] Thus, the fragment, derivative, analog, or homolog of the
polypeptide of Table 1, or that encoded by the plasmids listed in
Table 1, may be: (i) one in which one or more of the amino acid
residues are substituted with a conserved or non-conserved amino
acid residue (preferably a conserved amino acid residue) and such
substituted amino acid residue may or may not be one encoded by the
genetic code: or (ii) one in which one or more of the amino acid
residues includes a substituent group: or (iii) one in which the S.
aureus polypeptide is fused with another compound, such as a
compound to increase the half-life of the polypeptide (for example,
polyethylene glycol): or (iv) one in which the additional amino
acids are fused to the above form of the polypeptide, such as an
IgG Fc fusion region peptide or leader or secretory sequence or a
sequence which is employed for purification of the above form of
the polypeptide or a proprotein sequence. Such fragments,
derivatives and analogs are deemed to be within the scope of those
skilled in the art from the teachings herein.
[0157] Thus, the S. aureus polypeptides of the present invention
may include one or more amino acid substitutions, deletions, or
additions, either from natural mutations or human manipulation. As
indicated, changes are preferably of a minor nature, such as
conservative amino acid substitutions that do not significantly
affect the folding or activity of the protein (see Table 3).
2TABLE 3 Conservative Amino Acid Substitutions. Aromatic
Phenylalanine Tryptophan Tyrosine Hydrophobic Leucine Isoleucine
Valine Polar Glutamine Asparagine Basic Arginine Lysine Histidine
Acidic Aspartic Acid Glutamic Acid Small Alanine Serine Threonine
Methionine Glycine
[0158] Amino acids in the S. aureus proteins of the present
invention that are essential for function can be identified by
methods known in the art, such as site-directed mutagenesis or
alanine-scanning mutagenesis. See, e.g., Cunningham et al. (1989)
Science 244:1081-1085. The latter procedure introduces single
alanine mutations at every residue in the molecule. The resulting
mutant molecules are then tested for biological activity using
assays appropriate for measuring the function of the particular
protein.
[0159] Of special interest are substitutions of charged amino acids
with other charged or neutral amino acids which may produce
proteins with highly desirable improved characteristics, such as
less aggregation. Aggregation may not only reduce activity but also
be problematic when preparing pharmaceutical formulations, because
aggregates can be immunogenic. See, e.g., Pinckard et al., (1967)
Clin. Exp. Immunol. 2:331-340; Robbins, et al., (1987) Diabetes
36:838-845; Cleland, et al., (1993) Crit. Rev. Therapeutic Drug
Carrier Systems 10:307-377.
[0160] The polypeptides of the present invention are preferably
provided in an isolated form, and preferably are substantially
purified. A recombinantly produced version of the S. aureus
polypeptide can be substantially purified by the one-step method
described by Smith et al. (1988) Gene 67:31-40. Polypeptides of the
invention also can be purified from natural or recombinant sources
using antibodies directed against the polypeptides of the invention
in methods which are well known in the art of protein
purification.
[0161] The invention further provides for isolated S. aureus
polypeptides comprising an amino acid sequence selected from the
group consisting of: (a) the amino acid sequence of a full-length
S. aureus polypeptide having the complete amino acid sequence shown
in Table 1; (b) the amino acid sequence of a full-length S. aureus
polypeptide having the complete amino acid sequence shown in Table
1 excepting the N-terminal methionine; (c) the complete amino acid
sequence encoded by the plasmids listed in Table 1; and (d) the
complete amino acid sequence excepting the N-terminal methionine
encoded by the plasmids listed in Table 1. The polypeptides of the
present invention also include polypeptides having an amino acid
sequence at least 80% identical, more preferably at least 90%
identical, and still more preferably 95%, 96%, 97%, 98% or 99%
identical to those described in (a), (b), (c), and (d) above.
[0162] Further polypeptides of the present invention include
polypeptides which have at least 90% similarity, more preferably at
least 95% similarity, and still more preferably at least 96%, 97%,
98% or 99% similarity to those described above.
[0163] A further embodiment of the invention relates to a
polypeptide which comprises the amino acid sequence of a S. aureus
polypeptide having an amino acid sequence which contains at least
one conservative amino acid substitution, but not more than 50
conservative amino acid substitutions, not more than 40
conservative amino acid substitutions, not more than 30
conservative amino acid substitutions, and not more than 20
conservative amino acid substitutions. Also provided are
polypeptides which comprise the amino acid sequence of a S. aureus
polypeptide, having at least one, but not more than 10, 9, 8, 7, 6,
5, 4, 3, 2 or 1 conservative amino acid substitutions.
[0164] By a polypeptide having an amino acid sequence at least, for
example, 95% "identical" to a query amino acid sequence of the
present invention, it is intended that the amino acid sequence of
the subject polypeptide is identical to the query sequence except
that the subject polypeptide sequence may include up to five amino
acid alterations per each 100 amino acids of the query amino acid
sequence. In other words, to obtain a polypeptide having an amino
acid sequence at least 95% identical to a query amino acid
sequence, up to 5% of the amino acid residues in the subject
sequence may be inserted, deleted, (indels) or substituted with
another amino acid. These alterations of the reference sequence may
occur at the amino or carboxy terminal positions of the reference
amino acid sequence or anywhere between those terminal positions,
interspersed either individually among residues in the reference
sequence or in one or more contiguous groups within the reference
sequence.
[0165] As a practical matter, whether any particular polypeptide is
at least 90%, 95%, 96%, 97%, 98% or 99% identical to, for instance,
the amino acid sequences shown in Table 1 or to the amino acid
sequence encoded by the plasmids listed in Table 1 can be
determined conventionally using known computer programs. A
preferred method for determining the best overall match between a
query sequence (a sequence of the present invention) and a subject
sequence, also referred to as a global sequence alignment, can be
determined using the FASTDB computer program based on the algorithm
of Brutlag et al., (1990) Comp. App. Biosci. 6:237-245. In a
sequence alignment the query and subject sequences are both amino
acid sequences. The result of said global sequence alignment is in
percent identity. Preferred parameters used in a FASTDB amino acid
alignment are: Matrix=PAM 0, k-tuple=2, Mismatch Penalty=1, Joining
Penalty=20, Randomization Group Length=0, Cutoff Score=1, Window
Size=sequence length, Gap Penalty=5, Gap Size Penalty=0.05, Window
Size=500 or the length of the subject amino acid sequence,
whichever is shorter.
[0166] If the subject sequence is shorter than the query sequence
due to N-- or C-- terminal deletions, not because of internal
deletions, the results, in percent identity, must be manually
corrected. This is because the FASTDB program does not account for
N-- and C-terminal truncations of the subject sequence when
calculating global percent identity. For subject sequences
truncated at the N-- and C-termini, relative to the query sequence,
the percent identity is corrected by calculating the number of
residues of the query sequence that are N-- and C-terminal of the
subject sequence, which are not matched/aligned with a
corresponding subject residue, as a percent of the total bases of
the query sequence. Whether a residue is matched/aligned is
determined by results of the FASTDB sequence alignment. This
percentage is then subtracted from the percent identity, calculated
by the above FASTDB program using the specified parameters, to
arrive at a final percent identity score. This final percent
identity score is what is used for the purposes of the present
invention. Only residues to the N-- and C-termini of the subject
sequence, which are not matched/aligned with the query sequence,
are considered for the purposes of manually adjusting the percent
identity score. That is, only query amino acid residues outside the
farthest N-- and C-terminal residues of the subject sequence.
[0167] For example, a 90 amino acid residue subject sequence is
aligned with a 100 residue query sequence to determine percent
identity. The deletion occurs at the N-- terminus of the subject
sequence and therefore, the FASTDB alignment does not match/align
with the first 10 residues at the N-terminus. The 10 unpaired
residues represent 10% of the sequence (number of residues at the
N-- and C-termini not matched/total number of residues in the query
sequence) so 10% is subtracted from the percent identity score
calculated by the FASTDB program. If the remaining 90 residues were
perfectly matched the final percent identity would be 90%. In
another example, a 90 residue subject sequence is compared with a
100 residue query sequence. This time the deletions are internal so
there are no residues at the N-- or C-termini of the subject
sequence which are not matched/aligned with the query. In this case
the percent identity calculated by FASTDB is not manually
corrected. Once again, only residue positions outside the N-- and
C-terminal ends of the subject sequence, as displayed in the FASTDB
alignment, which are not matched/aligned with the query sequence
are manually corrected. No other manual corrections are to made for
the purposes of the present invention.
[0168] The above polypeptide sequences are included irrespective of
whether they have their normal biological activity. This is because
even where a particular polypeptide molecule does not have
biological activity, one of skill in the art would still know how
to use the polypeptide, for instance, as a vaccine or to generate
antibodies. Other uses of the polypeptides of the present invention
that do not have S. aureus activity include, inter alia, as epitope
tags, in epitope mapping, and as molecular weight markers on
SDS-PAGE gels or on molecular sieve gel filtration columns using
methods known to those of skill in the art.
[0169] As described below, the polypeptides of the present
invention can also be used to raise polyclonal and monoclonal
antibodies, which are useful in assays for detecting S. aureus
protein expression or as agonists and antagonists capable of
enhancing or inhibiting S. aureus protein function. Further, such
polypeptides can be used in the yeast two-hybrid system to
"capture" S. aureus protein binding proteins which are also
candidate agonists and antagonists according to the present
invention. See, e.g., Fields et al. (1989) Nature 340:245-246.
[0170] Epitope-Bearing Portions
[0171] In another aspect, the invention provides peptides and
polypeptides comprising epitope-bearing portions of the
polypeptides of the present invention. These epitopes are
immunogenic or antigenic epitopes of the polypeptides of the
present invention. An "immunogenic epitope" is defined as a part of
a protein that elicits an antibody response in vivo when the whole
polypeptide of the present invention, or fragment thereof, is the
immunogen. On the other hand, a region of a polypeptide to which an
antibody can bind is defined as an "antigenic determinant" or
"antigenic epitope." The number of in vivo immunogenic epitopes of
a protein generally is less than the number of antigenic epitopes.
See, e.g., Geysen, et al. (1983) Proc. Natl. Acad. Sci. USA
81:3998-4002. However, antibodies can be made to any antigenic
epitope, regardless of whether it is an immunogenic epitope, by
using methods such as phage display. See e.g., Petersen G. et al.
(1995) Mol. Gen. Genet. 249:425-431. Therefore, included in the
present invention are both immunogenic epitopes and antigenic
epitopes.
[0172] A list of exemplified amino acid sequences comprising
immunogenic epitopes of the invention are described herein. It is
pointed out that these descriptions only lists amino acid residues
comprising epitopes predicted to have the highest degree of
antigenicity using the algorithm of Jameson and Wolf, (1988) Comp.
Appl. Biosci. 4:181-186 (said references incorporated by reference
in their entireties). The Jameson-Wolf antigenic analysis was
performed using the computer program PROTEAN, using default
parameters (Version 3.11 for the Power MacIntosh, DNASTAR, Inc.,
1228 South Park Street Madison, Wis.). Amino acid residues
comprising other immunogenic epitopes may be routinely determined
using algorithms similar to the Jameson-Wolf analysis or by in vivo
testing for an antigenic response using methods known in the art.
See, e.g., Geysen et al., supra; U.S. Pat. Nos. 4,708,781;
5,194,392; 4,433,092; and 5,480,971 (said references incorporated
by reference in their entireties).
[0173] It is particularly pointed out that the described epitopic
amino acid sequences comprise immunogenic epitopes. Table 2 lists
only the critical residues of immunogenic epitopes determined by
the Jameson-Wolf analysis. Thus, additional flanking residues on
either the N-terminal, C-terminal, or both N-- and C-terminal ends
may be added to the sequences to generate an epitope-bearing
polypeptide of the present invention. Therefore, the immunogenic
epitopes may include additional N-terminal or C-terminal amino acid
residues. The additional flanking amino acid residues may be
contiguous flanking N-- terminal and/or C-terminal sequences from
the polypeptides of the present invention, heterologous polypeptide
sequences, or may include both contiguous flanking sequences from
the polypeptides of the present invention and heterologous
polypeptide sequences.
[0174] Polypeptides of the present invention comprising immunogenic
or antigenic epitopes are at least 7 amino acids residues in
length. "At least" means that a polypeptide of the present
invention comprising an immunogenic or antigenic epitope may be 7
amino acid residues in length or any integer between 7 amino acids
and the number of amino acid residues of the full length
polypeptides of the invention. Preferred polypeptides comprising
immunogenic or antigenic epitopes are at least 10, 15, 20, 25, 30,
35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100 amino
acid residues in length. However, it is pointed out that each and
every integer between 7 and the number of amino acid residues of
the full length polypeptide are included in the present
invention.
[0175] The immuno and antigenic epitope-bearing fragments may be
specified by either the number of contiguous amino acid residues,
as described above, or further specified by N-terminal and
C-terminal positions of these fragments on the amino acid sequence
of SEQ ID NO:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, or 22. Every
combination of a N-terminal and C-terminal position that a fragment
of, for example, at least 7 or at least 15 contiguous amino acid
residues in length could occupy on the amino acid sequence of SEQ
ID NO:2 is included in the invention. Again, "at least 7 contiguous
amino acid residues in length" means 7 amino acid residues in
length or any integer between 7 amino acids and the number of amino
acid residues of the full length polypeptide of the present
invention. Specifically, each and every integer between 7 and the
number of amino acid residues of the full length polypeptide are
included in the present invention.
[0176] Immunogenic and antigenic epitope-bearing polypeptides of
the invention are useful, for example, to make antibodies which
specifically bind the polypeptides of the invention, and in
immunoassays to detect the polypeptides of the present invention.
The antibodies are useful, for example, in affinity purification of
the polypeptides of the present invention. The antibodies may also
routinely be used in a variety of qualitative or quantitative
immunoassays, specifically for the polypeptides of the present
invention using methods known in the art. See, e.g., Harlow et al.,
Antibodies: A Laboratory Manual, (Cold Spring Harbor Laboratory
Press; 2nd Ed. 1988).
[0177] The epitope-bearing polypeptides of the present invention
may be produced by any conventional means for making polypeptides
including synthetic and recombinant methods known in the art. For
instance, epitope-bearing peptides may be synthesized using known
methods of chemical synthesis. For instance, Houghten has described
a simple method for the synthesis of large numbers of peptides,
such as 10-20 mgs of 248 individual and distinct 13 residue
peptides representing single amino acid variants of a segment of
the HA1 polypeptide, all of which were prepared and characterized
(by ELISA-type binding studies) in less than four weeks (Houghten,
R. A. Proc. Natl. Acad. Sci. USA 82:5131-5135 (1985)). This
"Simultaneous Multiple Peptide Synthesis (SMPS)" process is further
described in U.S. Pat. No. 4,631,211 to Houghten and coworkers
(1986). In this procedure the individual resins for the solid-phase
synthesis of various peptides are contained in separate
solvent-permeable packets, enabling the optimal use of the many
identical repetitive steps involved in solid-phase methods. A
completely manual procedure allows 500-1000 or more syntheses to be
conducted simultaneously (Houghten et al. (1985) Proc. Natl. Acad.
Sci. 82:5131-5135 at 5134.
[0178] Epitope-bearing polypeptides of the present invention are
used to induce antibodies according to methods well known in the
art including, but not limited to, in vivo immunization, in vitro
immunization, and phage display methods. See, e.g., Sutcliffe, et
al., supra; Wilson, et al., supra, and Bittle, et al. (1985) J.
Gen. Virol. 66:2347-2354. If in vivo immunization is used, animals
may be immunized with free peptide; however, anti-peptide antibody
titer may be boosted by coupling of the peptide to a macromolecular
carrier, such as keyhole limpet hemacyanin (KLH) or tetanus toxoid.
For instance, peptides containing cysteine residues may be coupled
to a carrier using a linker such as
-maleimidobenzoyl-N-hydroxysuccinimide ester (MBS), while other
peptides may be coupled to carriers using a more general linking
agent such as glutaraldehyde. Animals such as rabbits, rats and
mice are immunized with either free or carrier-coupled peptides,
for instance, by intraperitoneal and/or intradermal injection of
emulsions containing about 100 .mu.s of peptide or carrier protein
and Freund's adjuvant. Several booster injections may be needed,
for instance, at intervals of about two weeks, to provide a useful
titer of anti-peptide antibody which can be detected, for example,
by ELISA assay using free peptide adsorbed to a solid surface. The
titer of anti-peptide antibodies in serum from an immunized animal
may be increased by selection of anti-peptide antibodies, for
instance, by adsorption to the peptide on a solid support and
elution of the selected antibodies according to methods well known
in the art.
[0179] As one of skill in the art will appreciate, and discussed
above, the polypeptides of the present invention comprising an
immunogenic or antigenic epitope can be fused to heterologous
polypeptide sequences. For example, the polypeptides of the present
invention may be fused with the constant domain of immunoglobulins
(IgA, IgE, IgG, IgM), or portions thereof (CH1, CH2, CH3, any
combination thereof including both entire domains and portions
thereof) resulting in chimeric polypeptides. These fusion proteins
facilitate purification, and show an increased half-life in vivo.
This has been shown, e.g., for chimeric proteins consisting of the
first two domains of the human CD4-polypeptide and various domains
of the constant regions of the heavy or light chains of mammalian
immunoglobulins. See, e.g., EPA 0,394,827; Traunecker et al. (1988)
Nature 331:84-86. Fusion proteins that have a disulfide-linked
dimeric structure due to the IgG portion can also be more efficient
in binding and neutralizing other molecules than monomeric
polypeptides or fragments thereof alone. See, e.g., Fountoulakis et
al. (1995) J. Biochem. 270:3958-3964. Nucleic acids encoding the
above epitopes can also be recombined with a gene of interest as an
epitope tag to aid in detection and purification of the expressed
polypeptide.
3TABLE 2 Residues Comprising Antigenic Epitope-Bearing Portion. Fem
X About Asn-30 to about Lys-34; about Lys-45 to about Glu-50; about
Asn-99 to about Gly- 101; about Tyr-148 to about Gln-153; about
Asn-181 to about Lys-184; about Asn-272 to about Ser-275; about
Asn-278 to about Lys-281; about Arg-295 to about Lys-298; about
Ser-331 to about Tyr-335; and about Lys-398 to about Val-400, all
of SEQ ID NO: 2. fur A About Asp-45 to about Tyr-48; and about
Lys-96 to about Asp-99, all of SEQ ID NO: 4. fur B About Pro-28 to
about Arg-30; about Pro-44 to about Ala-46; about Asp-85 to about
Arg- 89; about Phe-90 to about Phe-92; about Gln-104 to about
Gly-106; and about Cys-145 to about Lys-148, all of SEQ ID NO: 6.
fur C About Thr-20 to about Arg-23; about Phe-77 to about Gly-80;
and about Ala-145 to about Ter-150, all of SEQ ID NO: 8. fmt B
About Ser-29 to about Gln-40; about Leu-51 to about His-55; about
Gln-78 to about Lys- 82; about Tyr-132 to about Gln-135; about
Ile-155 to about Ser-157; about Val-161 to about Arg-167; about
Lys-183 to about Glu-186; about Thr-232 to about Asp-239; about
Lys-254 to about Glu-256; about Pro-284 to about Lys-289; about
Ser-295 to about Leu- 299; about Glu-305 to about Ala-308; about
Asn-318 to about Glu-321; about Pro-341 to about Asn-344; about
Lys-373 to about Ser-376; about Gln-384 to about Asp-387; and about
Arg-422 to about Arg-426, all of SEQ ID NO: 10. pbpF About Glu-7 to
about Asp-11; about Ile-18 to about Lys-20; about Ile-55 to about
Glu-59; about Ser-66 to about Gly-77; about Thr-92 to about Thr-97;
about Arg-123 to about Asp- 127; about Lys-154 to about Asp-159;
about Ile-166 to about Gln-170; about Arg-230 to about Tyr-234;
about Thr-247 to about Gly-251; about Lys-263 to about Ser-274;
about Thr-294 to about Lys-300; about Gly-310 to about Leu-316;
about Ser-341 to about Asp- 346; about Ile-370 to about Asp-378;
about Ser-393 to about Gly-396; about Leu-425 to about Lys-427;
about Lys-433 to about Gly-435; about Pro-478 to about Gly-485;
about Leu-499 to about Gly-505; about Thr-511 to about Pro-514;
about Asp-543 to about Tyr- 545; about Ser-558 to about Glu-563;
about Asn-598 to about Gly-602; Lys-618 to about Thr-621; about
Gly-628 to about Val-632; about Asp-643 to about Lys-646; about
Asp- 667 to about Arg-670; about Gly-681 to about Asp-684; and
about Asn-686 to about Lys- 689, all of SEQ ID NO: 12. pbpG About
Gln-4 to about His-8; about Lys-55 to about Ser-59; about Ile-72 to
about Asp-75; about Lys-101 to about Ser-104; about Asp-142 to
about Ser-145; about Asp-201 to about Gly-204; about Pro-221 to
about Asp-224; about Pro-245 to about Asp-249; about Lys- 253 to
about Lys-256; and about Asn-297 to about Ter-302, all of SEQ ID
NO: 14. cbrA About Asn-23 to about Lys-35; about Ile-49 to about
Lys-54; about Pro-85 to about Glu- 88; about Asp-233 to about
Lys-236; about Ser-243 to about Ile-247; about Ser-260 to about
Ala-264; about Asp-296 to about Leu-298; and about Tyr-309 to about
Ser-312, all of SEQ ID NO: 16. cbr B About Asp-44 to about Asn-47;
about Thr-219 to about Asp-222; and about Lys-325 to about Arg-328,
all of SEQ ID NO: 18. cbrC About Asn-48 to about Asp-52; and about
Lys-141 to about Arg-145, all of SEQ ID NO: 20. enolase About Leu
13 to about Pro 19; about Gly 63 to about Thr 65; about Thr 102 to
about Lys 107; about Ser 156 to about Asp 159 about Arg 198 to
about Leu 200; about Asp 206 to about Gly 209; about Lys 234 to
about Glu 237; about Tyr 25 to about Asp 257; about Met 294 to
about Gly 301; about Arg 308 to about Asp 311; about His 371 to
about Glu 375; about Ser 397 to about Asp 402; about Lys 422 to
about Gly 425, all of SEQ ID NO: 22.
[0180] Antibodies
[0181] The present invention further relates to antibodies and
T-cell antigen receptors (TCR) which specifically bind the
polypeptides of the present invention. The antibodies of the
present invention include IgG (including IgG1, IgG2, IgG3, and
IgG4), IgA (including IgA1 and IgA2), IgD, IgE, or IgM, and IgY. As
used herein, the term "antibody" (Ab) is meant to include whole
antibodies, including single-chain whole antibodies, and
antigen-binding fragments thereof. Most preferably the antibodies
are human antigen binding antibody fragments of the present
invention include, but are not limited to, Fab, Fab' and F(ab')2,
Fd, single-chain Fvs (scFv), single-chain antibodies,
disulfide-linked Fvs (sdFv) and fragments comprising either a
V.sub.L or V.sub.H domain. The antibodies may be from any animal
origin including birds and mammals. Preferably, the antibodies are
human, murine, rabbit, goat, guinea pig, camel, horse, or
chicken.
[0182] Antigen-binding antibody fragments, including single-chain
antibodies, may comprise the variable region(s) alone or in
combination with the entire or partial of the following: hinge
region, CH1, CH2, and CH3 domains. Also included in the invention
are any combinations of variable region(s) and hinge region, CH1,
CH2, and CH3 domains. The present invention further includes
chimeric, humanized, and human monoclonal and polyclonal antibodies
which specifically bind the polypeptides of the present invention.
The present invention further includes antibodies which are
anti-idiotypic to the antibodies of the present invention.
[0183] The antibodies of the present invention may be monospecific,
bispecific, trispecific or of greater multispecificity.
Multispecific antibodies may be specific for different epitopes of
a polypeptide of the present invention or may be specific for both
a polypeptide of the present invention as well as for heterologous
compositions, such as a heterologous polypeptide or solid support
material. See, e.g., WO 93/17715; WO 92/08802; WO 91/00360; WO
92/05793; Tutt, A. et al. (1991) J. Immunol. 147:60-69; U.S. Pat.
Nos. 5,573,920, 4,474,893, 5,601,819, 4,714,681, 4,925,648;
Kostelny, S. A. et al. (1992) J. Immunol. 148:1547-1553.
[0184] Antibodies of the present invention may be described or
specified in terms of the epitope(s) or portion(s) of a polypeptide
of the present invention which are recognized or specifically bound
by the antibody. The epitope(s) or polypeptide portion(s) may be
specified as described herein, e.g., by N-terminal and C-terminal
positions, by size in contiguous amino acid residues, or listed in
the Tables and Figures. Antibodies which specifically bind any
epitope or polypeptide of the present invention may also be
excluded. Therefore, the present invention includes antibodies that
specifically bind polypeptides of the present invention, and allows
for the exclusion of the same.
[0185] Antibodies of the present invention may also be described or
specified in terms of their cross-reactivity. Antibodies that do
not bind any other analog, ortholog, or homolog of the polypeptides
of the present invention are, included. Antibodies that do not bind
polypeptides with less than 95%, less than 90%, less than 85%, less
than 80%, less than 75%, less than 70%, less than 65%, less than
60%, less than 55%, and less than 50% identity (as calculated using
methods known in the art and described herein) to a polypeptide of
the present invention are also included in the present invention.
Further included in the present invention are antibodies which only
bind polypeptides encoded by polynucleotides which hybridize to a
polynucleotide of the present invention under stringent
hybridization conditions (as described herein). Antibodies of the
present invention may also be described or specified in terms of
their binding affinity. Preferred binding affinities include those
with a dissociation constant or Kd less than 5.times.10.sup.-6M,
10.sup.-6M, 5.times.10.sup.-7M, 10.sup.-7M, 5.times.10.sup.-8M,
5.times.10.sup.-9M, 10.sup.-9M, 5.times.10.sup.-10M, 10.sup.-10M,
5.times.10.sup.-11M, 10.sup.-11M, 5.times.10.sup.-12M, 10.sup.-12M,
5.times.10.sup.-13M, 10.sup.-13M, 5.times.10.sup.-14M, 10.sup.-14M,
5.times.10.sup.-15M, and 10.sup.-15M.
[0186] Antibodies of the present invention have uses that include,
but are not limited to, methods known in the art to purify, detect,
and target the polypeptides of the present invention including both
in vitro and in vivo diagnostic and therapeutic methods. For
example, the antibodies have use in immunoassays for qualitatively
and quantitatively measuring levels of the polypeptides of the
present invention in biological samples. See, e.g., Harlow et al.,
ANTIBODIES: A LABORATORY MANUAL, (Cold Spring Harbor Laboratory
Press, 2nd ed. 1988) (incorporated by reference in the
entirety).
[0187] The antibodies of the present invention may be used either
alone or in combination with other compositions. The antibodies may
further be recombinantly fused to a heterologous polypeptide at the
N-- or C-terminus or chemically conjugated (including covalently
and non-covalently conjugations) to polypeptides or other
compositions. For example, antibodies of the present invention may
be recombinantly fused or conjugated to molecules useful as labels
in detection assays and effector molecules such as heterologous
polypeptides, drugs, or toxins. See, e.g., WO 92/08495; WO
91/14438; WO 89/12624; U.S. Pat. No. 5,314,995; and EP 0 396
387.
[0188] The antibodies of the present invention may be prepared by
any suitable method known in the art. For example, a polypeptide of
the present invention or an antigenic fragment thereof can be
administered to an animal in order to induce the production of sera
containing polyclonal antibodies. Monoclonal antibodies can be
prepared using a wide of techniques known in the art including the
use of hybridoma and recombinant technology. See, e.g., Harlow et
al., ANTIBODIES: A LABORATORY MANUAL, (Cold Spring Harbor
Laboratory Press, 2nd ed. 1988); Hammerling, et al., in: MONOCLONAL
ANTIBODIES AND T-CELL HYBRIDOMAS 563-681 (Elsevier, N.Y., 1981)
(said references incorporated by reference in their
entireties).
[0189] Fab and F(ab')2 fragments may be produced by proteolytic
cleavage, using enzymes such as papain (to produce Fab fragments)
or pepsin (to produce F(ab')2 fragments).
[0190] Alternatively, antibodies of the present invention can be
produced through the application of recombinant DNA technology or
through synthetic chemistry using methods known in the art. For
example, the antibodies of the present invention can be prepared
using various phage display methods known in the art. In phage
display methods, functional antibody domains are displayed on the
surface of a phage particle which carries polynucleotide sequences
encoding them. Phage with a desired binding property are selected
from a repertoire or combinatorial antibody library (e.g. human or
murine) by selecting directly with antigen, typically antigen bound
or captured to a solid surface or bead. Phage used in these methods
are typically filamentous phage including fd and M13 with Fab, Fv
or disulfide stabilized Fv antibody domains recombinantly fused to
either the phage gene III or gene VIII protein. Examples of phage
display methods that can be used to make the antibodies of the
present invention include those disclosed in Brinkman U. et al.
(1995) J. Immunol. Methods 182:41-50; Ames, R. S. et al. (1995) J.
Immunol. Methods 184:177-186; Kettleborough, C. A. et al. (1994)
Eur. J. Immunol. 24:952-958; Persic, L. et al. (1997) Gene 187
9-18; Burton, D. R. et al. (1994) Advances in Immunology
57:191-280; PCT/GB91/01134; WO 90/02809; WO 91/10737; WO 92/01047;
WO 92/18619; WO 93/11236; WO 95/15982; WO 95/20401; and U.S. Pat.
Nos. 5,698,426, 5,223,409, 5,403,484, 5,580,717, 5,427,908,
5,750,753, 5,821,047, 5,571,698, 5,427,908, 5,516,637, 5,780,225,
5,658,727 and 5,733,743 (said references incorporated by reference
in their entireties).
[0191] As described in the above references, after phage selection,
the antibody coding regions from the phage can be isolated and used
to generate whole antibodies, including human antibodies, or any
other desired antigen binding fragment, and expressed in any
desired host including mammalian cells, insect cells, plant cells,
yeast, and bacteria. For example, techniques to recombinantly
produce Fab, Fab' and F(ab')2 fragments can also be employed using
methods known in the art such as those disclosed in WO 92/22324;
Mullinax, R. L. et al. (1992) BioTechniques 12(6):864-869; and
Sawai, H. et al. (1995) AJRI 34:26-34; and Better, M. et al. (1988)
Science 240:1041-1043 (said references incorporated by reference in
their entireties).
[0192] Examples of techniques which can be used to produce
single-chain Fvs and antibodies include those described in U.S.
Pat. Nos. 4,946,778 and 5,258,498; Huston et al. (1991) Methods in
Enzymology 203:46-88; Shu, L. et al. (1993) PNAS 90:7995-7999; and
Skerra, A. et al. (1988) Science 240:1038-1040. For some uses,
including in vivo use of antibodies in humans and in vitro
detection assays, it may be preferable to use chimeric, humanized,
or human antibodies. Methods for producing chimeric antibodies are
known in the art. See e.g., Morrison, Science 229:1202 (1985); Oi
et al., BioTechniques 4:214 (1986); Gillies, S. D. et al. (1989) J.
Immunol. Methods 125:191-202; and U.S. Pat. No. 5,807,715.
Antibodies can be humanized using a variety of techniques including
CDR-grafting (EP 0 239 400; WO 91/09967; U.S. Pat. Nos. 5,530,101;
and 5,585,089), veneering or resurfacing (EP 0 592 106; EP 0 519
596; Padlan E. A., (1991) Molecular Immunology 28(4/5):489-498;
Studnicka G. M. et al. (1994) Protein Engineering 7(6):805-814;
Roguska M. A. et al. (1994) PNAS 91:969-973), and chain shuffling
(U.S. Pat. No. 5,565,332). Human antibodies can be made by a
variety of methods known in the art including phage display methods
described above. See also, U.S. Pat. Nos. 4,444,887, 4,716,111,
5,545,806, and 5,814,318; and WO 98/46645 (said references
incorporated by reference in their entireties).
[0193] Further included in the present invention are antibodies
recombinantly fused or chemically conjugated (including both
covalently and non-covalently conjugations) to a polypeptide of the
present invention. The antibodies may be specific for antigens
other than polypeptides of the present invention. For example,
antibodies may be used to target the polypeptides of the present
invention to particular cell types, either in vitro or in vivo, by
fusing or conjugating the polypeptides of the present invention to
antibodies specific for particular cell surface receptors.
Antibodies fused or conjugated to the polypeptides of the present
invention may also be used in in vitro immunoassays and
purification methods using methods known in the art. See e.g.,
Harbor et al. supra and WO 93/21232; EP 0 439 095; Naramura, M. et
al. (1994) Immunol. Lett. 39:91-99; US Patent 5,474,981; Gillies,
S. O. et al. (1992) PNAS 89:1428-1432; Fell, H. P. et al. (1991) J.
Immunol. 146:2446-2452 (said references incorporated by reference
in their entireties).
[0194] The present invention further includes compositions
comprising the polypeptides of the present invention fused or
conjugated to antibody domains other than the variable regions. For
example, the polypeptides of the present invention may be fused or
conjugated to an antibody Fc region, or portion thereof. The
antibody portion fused to a polypeptide of the present invention
may comprise the hinge region, CH1 domain, CH2 domain, and CH3
domain or any combination of whole domains or portions thereof. The
polypeptides of the present invention may be fused or conjugated to
the above antibody portions to increase the in vivo half life of
the polypeptides or for use in immunoassays using methods known in
the art. The polypeptides may also be fused or conjugated to the
above antibody portions to form multimers. For example, Fc portions
fused to the polypeptides of the present invention can form dimers
through disulfide bonding between the Fc portions. Higher
multimeric forms can be made by fusing the polypeptides to portions
of IgA and IgM. Methods for fusing or conjugating the polypeptides
of the present invention to antibody portions are known in the art.
See e.g., U.S. Pat. Nos. 5,336,603, 5,622,929, 5,359,046,
5,349,053, 5,447,851, 5,112,946; EP 0 307 434, EP 0 367 166; WO
96/04388, WO 91/06570; Ashkenazi, A. et al. (1991) PNAS
88:10535-10539; Zheng, X. X. et al. (1995) J. Immunol.
154:5590-5600; and Vil, H. et al. (1992) PNAS 89:11337-11341 (said
references incorporated by reference in their entireties).
[0195] The invention further relates to antibodies which act as
agonists or antagonists of the polypeptides of the present
invention. For example, the present invention includes antibodies
which disrupt the receptor/ligand interactions with the
polypeptides of the invention either partially or fully. Included
are both receptor-specific antibodies and ligand-specific
antibodies. Included are receptor-specific antibodies which do not
prevent ligand binding but prevent receptor activation. Receptor
activation (i.e., signaling) may be determined by techniques
described herein or otherwise known in the art. Also include are
receptor-specific antibodies which both prevent ligand binding and
receptor activation. Likewise, included are neutralizing antibodies
which bind the ligand and prevent binding of the ligand to the
receptor, as well as antibodies which bind the ligand, thereby
preventing receptor activation, but do not prevent the ligand from
binding the receptor. Further included are antibodies which
activate the receptor. These antibodies may act as agonists for
either all or less than all of the biological activities affected
by ligand-mediated receptor activation. The antibodies may be
specified as agonists or antagonists for biological activities
comprising specific activities disclosed herein. The above antibody
agonists can be made using methods known in the art. See e.g., WO
96/40281; U.S. Pat. No. 5,811,097; Deng, B. et al. (1998) Blood
92(6):1981-1988; Chen, Z. et al. (1998) Cancer Res.
58(16):3668-3678; Harrop, J. A. et al. (1998) J. Immunol.
161(4):1786-1794; Zhu, Z. et al. (1998) Cancer Res.
58(15):3209-3214; Yoon, D. Y. et al. (1998) J. Immunol.
160(7):3170-3179; Prat, M. et al. (1998) J. Cell. Sci.
111(Pt2):237-247; Pitard, V. et al. (1997) J. Immunol. Methods
205(2):177-190; Liautard, J. et al. (1997) Cytokinde 9(4):233-241;
Carlson, N. G. et al. (1997) J. Biol. Chem. 272(17):11295-11301;
Taryman, R. E. et al. (1995) Neuron 14(4):755-762; Muller, Y. A. et
al. (1998) Structure 6(9):1153-1167; Bartunek, P. et al. (1996)
Cytokine 8(1):14-20 (said references incorporated by reference in
their entireties).
[0196] Diagnostic Assays
[0197] The present invention further relates to methods for
assaying staphylococcal infection in an animal by detecting the
expression of genes encoding staphylococcal polypeptides of the
present invention. The methods comprise analyzing tissue or body
fluid from the animal for Staphylococcus-specific antibodies,
nucleic acids, or proteins. Analysis of nucleic acid specific to
Staphylococcus is assayed by PCR or hybridization techniques using
nucleic acid sequences of the present invention as either
hybridization probes or primers. See, e.g., Sambrook et al.
Molecular cloning: A Laboratory Manual (Cold Spring Harbor
Laboratory Press, 2nd ed., 1989, page 54 reference); Eremeeva et
al. (1994) J. Clin. Microbiol. 32:803-810 (describing
differentiation among spotted fever group Rickettsiae species by
analysis of restriction fragment length polymorphism of
PCR-amplified DNA) and Chen et al. 1994 J. Clin. Microbiol.
32:589-595 (detecting B. burgdorferi nucleic acids via PCR).
[0198] Where diagnosis of a disease state related to infection with
Staphylococcus has already been made, the present invention is
useful for monitoring progression or regression of the disease
state whereby patients exhibiting enhanced Staphylococcus gene
expression will experience a worse clinical outcome relative to
patients expressing these gene(s) at a lower level.
[0199] By "biological sample" is intended any biological sample
obtained from an animal, cell line, tissue culture, or other source
which contains Staphylococcus polypeptide, mRNA, or DNA. Biological
samples include body fluids (such as saliva, blood, plasma, urine,
mucus, synovial fluid, etc.) tissues (such as muscle, skin, and
cartilage) and any other biological source suspected of containing
Staphylococcus polypeptides or nucleic acids. Methods for obtaining
biological samples such as tissue are well known in the art.
[0200] The present invention is useful for detecting diseases
related to Staphylococcus infections in animals. Preferred animals
include monkeys, apes, cats, dogs, birds, cows, pigs, mice, horses,
rabbits and humans. Particularly preferred are humans.
[0201] Total RNA can be isolated from a biological sample using any
suitable technique such as the single-step
guanidinium-thiocyanate-phenol- -chloroform method described in
Chomczynski et al. (1987) Anal. Biochem. 162:156-159. mRNA encoding
Staphylococcus polypeptides having sufficient homology to the
nucleic acid sequences identified in Table 1 to allow for
hybridization between complementary sequences are then assayed
using any appropriate method. These include Northern blot analysis,
S1 nuclease mapping, the polymerase chain reaction (PCR), reverse
transcription in combination with the polymerase chain reaction
(RT-PCR), and reverse transcription in combination with the ligase
chain reaction (RT-LCR).
[0202] Northern blot analysis can be performed as described in
Harada et al. (1990) Cell 63:303-312. Briefly, total RNA is
prepared from a biological sample as described above. For the
Northern blot, the RNA is denatured in an appropriate buffer (such
as glyoxal/dimethyl sulfoxide/sodium phosphate buffer), subjected
to agarose gel electrophoresis, and transferred onto a
nitrocellulose filter. After the RNAs have been linked to the
filter by a UV linker, the filter is prehybridized in a solution
containing formamide, SSC, Denhardt's solution, denatured salmon
sperm, SDS, and sodium phosphate buffer. A S. aureus polypeptide
DNA sequence shown in Table 1 labeled according to any appropriate
method (such as the .sup.32P-multiprimed DNA labeling system
(Amersham)) is used as probe. After hybridization overnight, the
filter is washed and exposed to x-ray film. DNA for use as probe
according to the present invention is described in the sections
above and will preferably at least 15 nucleotides in length.
[0203] S1 mapping can be performed as described in Fujita et al.
(1987) Cell 49:357-367. To prepare probe DNA for use in S1 mapping,
the sense strand of an above-described S. aureus DNA sequence of
the present invention is used as a template to synthesize labeled
antisense DNA. The antisense DNA can then be digested using an
appropriate restriction endonuclease to generate further DNA probes
of a desired length. Such antisense probes are useful for
visualizing protected bands corresponding to the target mRNA (i.e.,
mRNA encoding Staphylococcus polypeptides).
[0204] Levels of mRNA encoding Staphylococcus polypeptides are
assayed, for e.g., using the RT-PCR method described in Makino et
al. (1990) Technique 2:295-301. By this method, the radioactivities
of the "amplicons" in the polyacrylamide gel bands are linearly
related to the initial concentration of the target mRNA. Briefly,
this method involves adding total RNA isolated from a biological
sample in a reaction mixture containing a RT primer and appropriate
buffer. After incubating for primer annealing, the mixture can be
supplemented with a RT buffer, dNTPs, DTT, RNase inhibitor and
reverse transcriptase. After incubation to achieve reverse
transcription of the RNA, the RT products are then subject to PCR
using labeled primers. Alternatively, rather than labeling the
primers, a labeled dNTP can be included in the PCR reaction
mixture. PCR amplification can be performed in a DNA thermal cycler
according to conventional techniques. After a suitable number of
rounds to achieve amplification, the PCR reaction mixture is
electrophoresed on a polyacrylamide gel. After drying the gel, the
radioactivity of the appropriate bands (corresponding to the mRNA
encoding the Staphylococcus polypeptides of the present invention)
are quantified using an imaging analyzer. RT and PCR reaction
ingredients and conditions, reagent and gel concentrations, and
labeling methods are well known in the art. Variations on the
RT-PCR method will be apparent to the skilled artisan. Other PCR
methods that can detect the nucleic acid of the present invention
can be found in PCR PRIMER: A LABORATORY MANUAL (C. W. Dieffenbach
et al. eds., Cold Spring Harbor Lab Press, 1995).
[0205] The polynucleotides of the present invention, including both
DNA and RNA, may be used to detect polynucleotides of the present
invention or Staphylococcal species including S. aureus using
bio-chip technology. The present invention includes both high
density chip arrays (>1000 oligonucleotides per cm2) and low
density chip arrays (<1000 oligonucleotides per cm.sup.2).
Bio-chips comprising arrays of polynucleotides of the present
invention may be used to detect Staphylococcal species, including
S. aureus, in biological and environmental samples and to diagnose
an animal, including humans, with an S. aureus or other
Staphylococcal infection. The bio-chips of the present invention
may comprise polynucleotide sequences of other pathogens including
bacteria, viral, parasitic, and fungal polynucleotide sequences, in
addition to the polynucleotide sequences of the present invention,
for use in rapid differential pathogenic detection and diagnosis.
The bio-chips can also be used to monitor an S. aureus or other
Staphylococcal infections and to monitor the genetic changes
(deletions, insertions, mismatches, etc.) in response to drug
therapy in the clinic and drug development in the laboratory. The
bio-chip technology comprising arrays of polynucleotides of the
present invention may also be used to simultaneously monitor the
expression of a multiplicity of genes, including those of the
present invention. In addition, the bio-chips of the present
invention may be used to screen large numbers of peptides,
polypeptides, antibodies, small molecules and other drug compounds
which bind to the polynucleotides of the present invention. The
bio-chips may also be used to measure relative binding or binding
affinities (in on-rates or off-rates) of peptides, polypeptides,
antibodies, small molecules and other drug compounds to the
polynucleotides of the present invention. The polynucleotides used
to comprise a selected array may be specified in the same manner as
for the fragments, i.e., by their 5' and 3' positions or length in
contiguous base pairs and include from. Methods and particular uses
of the polynucleotides of the present invention to detect
Staphylococcal species, including S. aureus, using bio-chip
technology include those known in the art and those of: U.S. Pat.
Nos.: 5,324,633, 5,510,270, 5,545,531, 5,445,934, 5,677,195,
5,532,128, 5,556,752, 5,527,681, 5,451,683, 5,424,186, 5,607,646,
5,658,732 and World Patent Nos. WO/9710365, WO/9511995, WO/9743447,
WO/9535505, each incorporated herein in their entireties.
[0206] Biosensors using the polynucleotides of the present
invention may also be used to detect, diagnose, and monitor S.
aureus or other Staphylococcal species and infections thereof.
Biosensors using the polynucleotides of the present invention may
also be used to detect particular polynucleotides of the present
invention. Biosensors using the polynucleotides of the present
invention may also be used to monitor the genetic changes
(deletions, insertions, mismatches, etc.) in response to drug
therapy in the clinic and drug development in the laboratory. In
addition, the biosensors of the present invention may be used to
screen large numbers of polynucleotides, peptides, polypeptides,
antibodies, small molecules and other drug compounds which bind to
the polynucleotides of the present invention. The biosensors may
also be used to measure relative binding or binding affinities (in
on-rates or off-rates) of polynucleotides, peptides, polypeptides,
antibodies, small molecules, and other drug compounds to the
polynucleotides of the present invention. Methods and particular
uses of the polynucleotides of the present invention to detect
Staphylococcal species, including S. aureus, using biosensors
include those known in the art and those of: U.S. Pat. Nos.
5,721,102, 5,658,732, 5,631,170, and World Patent Nos. WO/973501 1,
WO/9720203, each incorporated herein in their entireties.
[0207] Thus, the present invention includes both bio-chips and
biosensors comprising polynucleotides of the present invention and
methods of their use.
[0208] Assaying Staphylococcus polypeptide levels in a biological
sample can occur using any art-known method, such as antibody-based
techniques. For example, Staphylococcus polypeptide expression in
tissues can be studied with classical immunohistological methods.
In these, the specific recognition is provided by the primary
antibody (polyclonal or monoclonal) but the secondary detection
system can utilize fluorescent, enzyme, or other conjugated
secondary antibodies. As a result, an immunohistological staining
of tissue section for pathological examination is obtained. Tissues
can also be extracted, e.g., with urea and neutral detergent, for
the liberation of Staphylococcus polypeptides for Western-blot or
dot/slot assay. See, e.g., Jalkanen, M. et al. (1985) J. Cell.
Biol. 101:976-985; Jalkanen, M. et al. (1987) J. Cell. Biol.
105:3087-3096. In this technique, which is based on the use of
cationic solid phases, quantitation of a Staphylococcus polypeptide
can be accomplished using an isolated Staphylococcus polypeptide as
a standard. This technique can also be applied to body fluids.
[0209] Other antibody-based methods useful for detecting
Staphylococcus polypeptide gene expression include immunoassays,
such as the ELISA and the radioimmunoassay (RIA). For example, a
Staphylococcus polypeptide-specific monoclonal antibodies can be
used both as an immunoabsorbent and as an enzyme-labeled probe to
detect and quantify a Staphylococcus polypeptide. The amount of a
Staphylococcus polypeptide present in the sample can be calculated
by reference to the amount present in a standard preparation using
a linear regression computer algorithm. Such an ELISA is described
in lacobelli et al. (1988) Breast Cancer Research and Treatment
11:19-30. In another ELISA assay, two distinct specific monoclonal
antibodies can be used to detect Staphylococcus polypeptides in a
body fluid. In this assay, one of the antibodies is used as the
immunoabsorbent and the other as the enzyme-labeled probe.
[0210] The above techniques may be conducted essentially as a
"one-step" or "two-step" assay. The "one-step" assay involves
contacting the Staphylococcus polypeptide with immobilized antibody
and, without washing, contacting the mixture with the labeled
antibody. The "two-step" assay involves washing before contacting
the mixture with the labeled antibody. Other conventional methods
may also be employed as suitable. It is usually desirable to
immobilize one component of the assay system on a support, thereby
allowing other components of the system to be brought into contact
with the component and readily removed from the sample. Variations
of the above and other immunological methods included in the
present invention can also be found in Harlow et al., ANTIBODIES: A
LABORATORY MANUAL, (Cold Spring Harbor Laboratory Press, 2nd ed.
1988).
[0211] Suitable enzyme labels include, for example, those from the
oxidase group, which catalyze the production of hydrogen peroxide
by reacting with substrate. Glucose oxidase is particularly
preferred as it has good stability and its substrate (glucose) is
readily available. Activity of an oxidase label may be assayed by
measuring the concentration of hydrogen peroxide formed by the
enzyme-labeled antibody/substrate reaction. Besides enzymes, other
suitable labels include radioisotopes, such as iodine (.sup.125I,
.sup.121I, carbon (.sup.14C), sulphur (.sup.35S), tritium
(.sup.3H), indium (.sup.112In), and technetium (.sup.99mTc),
fluorescent labels, such as fluorescein and rhodamine, and
biotin.
[0212] Further suitable labels for the Staphylococcus
polypeptide-specific antibodies of the present invention are
provided below. Examples of suitable enzyme labels include malate
dehydrogenase, staphylococcal nuclease, delta-5-steroid isomerase,
yeast-alcohol dehydrogenase, alpha-glycerol phosphate
dehydrogenase, triose phosphate isomerase, peroxidase, alkaline
phosphatase, asparaginase, glucose oxidase, beta-galactosidase,
ribonuclease, urease, catalase, glucose-6-phosphate dehydrogenase,
glucoamylase, and acetylcholine esterase.
[0213] Examples of suitable radioisotopic labels include .sup.3H,
.sup.111In, .sup.125I, .sup.131I, .sup.32P, .sup.35S, .sup.14C,
.sup.51Cr, .sup.57To, .sup.58Co, .sup.59Fe, .sup.75Se, .sup.152Eu,
.sup.90Y, .sup.67Cu, .sup.27Ci, .sup.211At, .sup.212Pb, .sup.47Sc,
.sup.109Pd, etc. .sup.111In is a preferred isotope where in vivo
imaging is used since its avoids the problem of dehalogenation of
the .sup.125I or .sup.131I-labeled monoclonal antibody by the
liver. In addition, this radionucleotide has a more favorable gamma
emission energy for imaging. See, e.g., Perkins et al. (1985) Eur.
J. Nucl. Med. 10:296-301; Carasquillo et al. (1987) J. Nucl. Med.
28:281-287. For example, .sup.111In coupled to monoclonal
antibodies with 1-(P-isothiocyanatobenzy- l)-DPTA has shown little
uptake in non-tumors tissues, particularly the liver, and therefore
enhances specificity of tumor localization. See, Esteban et al.
(1987) J. Nucl. Med. 28:861-870.
[0214] Examples of suitable non-radioactive isotopic labels include
.sup.157Gd, .sup.55Mn, .sup.162Dy, .sup.52Tr, and .sup.56Fe.
[0215] Examples of suitable fluorescent labels include an
.sup.152Eu label, a fluorescein label, an isothiocyanate label, a
rhodamine label, a phycoerythrin label, a phycocyanin label, an
allophycocyanin label, an o-phthaldehyde label, and a fluorescamine
label.
[0216] Examples of suitable toxin labels include, Pseudomonas
toxin, diphtheria toxin, ricin, and cholera toxin.
[0217] Examples of chemiluminescent labels include a luminal label,
an isoluminal label, an aromatic acridinium ester label, an
imidazole label, an acridinium salt label, an oxalate ester label,
a luciferin label, a luciferase label, and an aequorin label.
[0218] Examples of nuclear magnetic resonance contrasting agents
include heavy metal nuclei such as Gd, Mn, and iron.
[0219] Typical techniques for binding the above-described labels to
antibodies are provided by Kennedy et al. (1976) Clin. Chim. Acta
70:1-31, and Schurs et al. (1977) Clin. Chim. Acta 81:1-40.
Coupling techniques mentioned in the latter are the glutaraldehyde
method, the periodate method, the dimaleimide method, the
m-maleimidobenzyl-N-hydroxy- -succinimide ester method, all of
which methods are incorporated by reference herein.
[0220] In a related aspect, the invention includes a diagnostic kit
for use in screening serum containing antibodies specific against
S. aureus infection. Such a kit may include an isolated S. aureus
antigen comprising an epitope which is specifically immunoreactive
with at least one anti-S. aureus antibody. Such a kit also includes
means for detecting the binding of said antibody to the antigen. In
specific embodiments, the kit may include a recombinantly produced
or chemically synthesized peptide or polypeptide antigen. The
peptide or polypeptide antigen may be attached to a solid
support.
[0221] In a more specific embodiment, the detecting means of the
above-described kit includes a solid support to which said peptide
or polypeptide antigen is attached. Such a kit may also include a
non-attached reporter-labeled anti-human antibody. In this
embodiment, binding of the antibody to the S. aureus antigen can be
detected by binding of the reporter labeled antibody to the anti-S.
aureus polypeptide antibody.
[0222] In a related aspect, the invention includes a method of
detecting S. aureus infection in a subject. This detection method
includes reacting a body fluid, preferably serum, from the subject
with an isolated S. aureus antigen, and examining the antigen for
the presence of bound antibody. In a specific embodiment, the
method includes a polypeptide antigen attached to a solid support,
and serum is reacted with the support. Subsequently, the support is
reacted with a reporter-labeled anti-human antibody. The support is
then examined for the presence of reporter-labeled antibody.
[0223] The solid surface reagent employed in the above assays and
kits is prepared by known techniques for attaching protein material
to solid support material, such as polymeric beads, dip sticks,
96-well plates or filter material. These attachment methods
generally include non-specific adsorption of the protein to the
support or covalent attachment of the protein, typically through a
free amine group, to a chemically reactive group on the solid
support, such as an activated carboxyl, hydroxyl, or aldehyde
group. Alternatively, streptavidin coated plates can be used in
conjunction with biotinylated antigen(s).
[0224] The polypeptides and antibodies of the present invention,
including fragments thereof, may be used to detect Staphylococcal
species including S. aureus using bio-chip and biosensor
technology. Bio-chip and biosensors of the present invention may
comprise the polypeptides of the present invention to detect
antibodies, which specifically recognize Staphylococcal species,
including S. aureus. Bio-chip and biosensors of the present
invention may also comprise antibodies which specifically recognize
the polypeptides of the present invention to detect Staphylococcal
species, including S. aureus or specific polypeptides of the
present invention. Bio-chips or biosensors comprising polypeptides
or antibodies of the present invention may be used to detect
Staphylococcal species, including S. aureus, in biological and
environmental samples and to diagnose an animal, including humans,
with an S. aureus or other Staphylococcal infection. Thus, the
present invention includes both bio-chips and biosensors comprising
polypeptides or antibodies of the present invention and methods of
their use.
[0225] The bio-chips of the present invention, discussed above, may
further comprise polypeptide sequences of other pathogens including
bacteria, viral, parasitic, and fungal polypeptide sequences, in
addition to the polypeptide sequences of the present invention, for
use in rapid differential pathogenic detection and diagnosis. The
bio-chips of the present invention may further comprise antibodies
or fragments thereof specific for other pathogens including
bacteria, viral, parasitic, and fungal polypeptide sequences, in
addition to the antibodies or fragments thereof of the present
invention, for use in rapid differential pathogenic detection and
diagnosis. The bio-chips and biosensors of the present invention
may also be used to monitor an S. aureus or other Staphylococcal
infection and to monitor the genetic changes (amino acid deletions,
insertions, substitutions, etc.) in response to drug therapy in the
clinic and drug development in the laboratory. The bio-chip and
biosensors comprising polypeptides or antibodies of the present
invention may also be used to simultaneously monitor the expression
of a multiplicity of polypeptides, including those of the present
invention. In addition, the bio-chips and biosensors of the present
invention may be used to screen large numbers of polynucleotides,
peptides, polypeptides, antibodies, small molecules, and other drug
compounds which bind to the polypeptides of the present invention.
The bio-chips may also be used to measure relative binding or
binding affinities (in on-rates or off-rates) of polynucleotides,
peptides, polypeptides, antibodies, small molecules and other drug
compounds to the polypeptides of the present invention. The
polypeptides used to comprise a bio-chip or biosensor of the
present invention may be specified in the same manner as for the
fragments, i.e., by their N-terminal and C-terminal positions or
length in contiguous amino acid residue. Methods and particular
uses of the polypeptides and antibodies of the present invention to
detect Staphylococcal species, including S. aureus, or specific
polypeptides using bio-chip and biosensor technology include those
known in the art, those of the U.S. Patent Nos. and World Patent
Nos. listed above for bio-chips and biosensors using
polynucleotides of the present invention, and those of: U.S. Pat.
Nos.: 5,324,633, 5,658,732, 5,135,852, 5,567,301, 5,677,196,
5,690,894 5,527,681, 5,510,270, 5,545,531, 5,445,934, 5,677,195,
5,532,128, 5,556,752, 5,451,683, 5,424,186, 5,607,646, and World
Patent Nos. WO/9729366, WO/9612957, WO/9710365, WO/9511995,
WO/9743447, WO/9535505, each incorporated herein in their
entireties.
[0226] Treatment
[0227] Agonists and Antagonists--Assays and Molecules
[0228] The invention also provides a method of screening compounds
to identify those which enhance or block the biological activity of
the S. aureus polypeptides of the present invention. The present
invention further provides where the compounds kill or slow the
growth of S. aureus. The ability of S. aureus antagonists,
including S. aureus ligands, to prophylactically or therapeutically
block antibiotic resistance may be easily tested by the skilled
artisan. See, e.g., Straden et al. (1997) J Bacteriol.
179(1):9-16.
[0229] An agonist is a compound which increases the natural
biological function or which functions in a manner similar to the
polypeptides of the present invention, while antagonists decrease
or eliminate such functions. Potential antagonists include small
organic molecules, peptides, polypeptides, and antibodies that bind
to a polypeptide of the invention and thereby inhibit or extinguish
its activity.
[0230] The antagonists may be employed for instance to inhibit
peptidoglycan cross bridge formation. Antibodies against S. aureus
may be employed to bind to and inhibit S. aureus activity to treat
antibiotic resistance. Any of the above antagonists may be employed
in a composition with a pharmaceutically acceptable carrier.
[0231] Vaccines
[0232] The present invention also provides vaccines comprising one
or more polypeptides of the present invention. Heterogeneity in the
composition of a vaccine may be provided by combining S. aureus
polypeptides of the present invention. Multi-component vaccines of
this type are desirable because they are likely to be more
effective in eliciting protective immune responses against multiple
species and strains of the Staphylococcus genus than single
polypeptide vaccines.
[0233] Multi-component vaccines are known in the art to elicit
antibody production to numerous immunogenic components. See, e.g.,
Decker et al. (1996) J. Infect. Dis. 174:S270-275. In addition, a
hepatitis B, diphtheria, tetanus, pertussis tetravalent vaccine has
recently been demonstrated to elicit protective levels of
antibodies in human infants against all four pathogenic agents.
See, e.g., Aristegui, J. et al. (1997) Vaccine 15:7-9.
[0234] The present invention in addition to single-component
vaccines includes multi-component vaccines. These vaccines comprise
more than one polypeptide, immunogen or antigen. Thus, a
multi-component vaccine would be a vaccine comprising more than one
of the S. aureus polypeptides of the present invention.
[0235] Further within the scope of the invention are whole cell and
whole viral vaccines. Such vaccines may be produced recombinantly
and involve the expression of one or more of the S. aureus
polypeptides described in Table 1. For example, the S. aureus
polypeptides of the present invention may be either secreted or
localized intracellular, on the cell surface, or in the periplasmic
space. Further, when a recombinant virus is used, the S. aureus
polypeptides of the present invention may, for example, be
localized in the viral envelope, on the surface of the capsid, or
internally within the capsid. Whole cells vaccines which employ
cells expressing heterologous proteins are known in the art. See,
e.g., Robinson, K. et al. (1997) Nature Biotech. 15:653-657;
Sirard, J. et al. (1997) Infect. Immun. 65:2029-2033; Chabalgoity,
J. et al. (1997) Infect. Immun. 65:2402-2412. These cells may be
administered live or may be killed prior to administration.
Chabalgoity, J. et al., supra, for example, report the successful
use in mice of a live attenuated Salmonella vaccine strain which
expresses a portion of a platyhelminth fatty acid-binding protein
as a fusion protein on its cells surface.
[0236] A multi-component vaccine can also be prepared using
techniques known in the art by combining one or more S. aureus
polypeptides of the present invention, or fragments thereof, with
additional non-staphylococcal components (e.g., diphtheria toxin or
tetanus toxin, and/or other compounds known to elicit an immune
response). Such vaccines are useful for eliciting protective immune
responses to both members of the Staphylococcus genus and
non-staphylococcal pathogenic agents.
[0237] The vaccines of the present invention also include DNA
vaccines. DNA vaccines are currently being developed for a number
of infectious diseases. See, et al., Boyer, et al. (1997) Nat. Med.
3:526-532; reviewed in Spier, R. (1996) Vaccine 14:1285-1288. Such
DNA vaccines contain a nucleotide sequence encoding one or more S.
aureus polypeptides of the present invention oriented in a manner
that allows for expression of the subject polypeptide. For example,
the direct administration of plasmid DNA encoding B. burgdorgeri
OspA has been shown to elicit protective immunity in mice against
borrelial challenge. See, Luke et al. (1997) J. Infect. Dis.
175:91-97.
[0238] The present invention also relates to the administration of
a vaccine which is co-administered with a molecule capable of
modulating immune responses. Kim et al. (1997) Nature Biotech.
15:641-646, for example, report the enhancement of immune responses
produced by DNA immunizations when DNA sequences encoding molecules
which stimulate the immune response are co-administered. In a
similar fashion, the vaccines of the present invention may be
co-administered with either nucleic acids encoding immune
modulators or the immune modulators themselves. These immune
modulators include granulocyte macrophage colony stimulating factor
(GM-CSF) and CD86.
[0239] The vaccines of the present invention may be used to confer
resistance to staphylococcal infection by either passive or active
immunization. When the vaccines of the present invention are used
to confer resistance to staphylococcal infection through active
immunization, a vaccine of the present invention is administered to
an animal to elicit a protective immune response which either
prevents or attenuates a staphylococcal infection. When the
vaccines of the present invention are used to confer resistance to
staphylococcal infection through passive immunization, the vaccine
is provided to a host animal (e.g., human, dog, or mouse), and the
antisera elicited by this antisera is recovered and directly
provided to a recipient suspected of having an infection caused by
a member of the Staphylococcus genus.
[0240] The ability to label antibodies, or fragments of antibodies,
with toxin molecules provides an additional method for treating
staphylococcal infections when passive immunization is conducted.
In this embodiment, antibodies, or fragments of antibodies, capable
of recognizing the S. aureus polypeptides disclosed herein, or
fragments thereof, as well as other Staphylococcus proteins, are
labeled with toxin molecules prior to their administration to the
patient. When such toxin derivatized antibodies bind to
Staphylococcus cells, toxin moieties will be localized to these
cells and will cause their death.
[0241] The present invention thus concerns and provides a means for
preventing or attenuating a staphylococcal infection resulting from
organisms which have antigens that are recognized and bound by
antisera produced in response to the polypeptides of the present
invention. As used herein, a vaccine is said to prevent or
attenuate a disease if its administration to an animal results
either in the total or partial attenuation (i.e., suppression) of a
symptom or condition of the disease, or in the total or partial
immunity of the animal to the disease.
[0242] The administration of the vaccine (or the antisera which it
elicits) may be for either a "prophylactic" or "therapeutic"
purpose. When provided prophylactically, the compound(s) are
provided in advance of any symptoms of staphylococcal infection.
The prophylactic administration of the compound(s) serves to
prevent or attenuate any 4 subsequent infection. When provided
therapeutically, the compound(s) is provided upon or after the
detection of symptoms which indicate that an animal may be infected
with a member of the Staphylococcus genus. The therapeutic
administration of the compound(s) serves to attenuate any actual
infection. Thus, the S. aureus polypeptides, and fragments thereof,
of the present invention may be provided either prior to the onset
of infection (so as to prevent or attenuate an anticipated
infection) or after the initiation of an actual infection.
[0243] The polypeptides of the invention, whether encoding a
portion of a native protein or a functional derivative thereof, may
be administered in pure form or may be coupled to a macromolecular
carrier. Example of such carriers are proteins and carbohydrates.
Suitable proteins which may act as macromolecular carrier for
enhancing the immunogenicity of the polypeptides of the present
invention include keyhole limpet hemacyanin (KLH) tetanus toxoid,
pertussis toxin, bovine serum albumin, and ovalbumin. Methods for
coupling the polypeptides of the present invention to such
macromolecular carriers are disclosed in Harlow et al., ANTIBODIES:
A LABORATORY MANUAL, (Cold Spring Harbor Laboratory Press, 2nd ed.
1988).
[0244] A composition is said to be "pharmacologically or
physiologically acceptable" if its administration can be tolerated
by a recipient animal and is otherwise suitable for administration
to that animal. Such an agent is said to be administered in a
"therapeutically effective amount" if the amount administered is
physiologically significant. An agent is physiologically
significant if its presence results in a detectable change in the
physiology of a recipient patient.
[0245] While in all instances the vaccine of the present invention
is administered as a pharmacologically acceptable compound, one
skilled in the art would recognize that the composition of a
pharmacologically acceptable compound varies with the animal to
which it is administered. For example, a vaccine intended for human
use will generally not be co-administered with Freund's adjuvant.
Further, the level of purity of the S. aureus polypeptides of the
present invention will normally be higher when administered to a
human than when administered to a non-human animal.
[0246] As would be understood by one of ordinary skill in the art,
when the vaccine of the present invention is provided to an animal,
it may be in a composition which may contain salts, buffers,
adjuvants, or other substances which are desirable for improving
the efficacy of the composition. Adjuvants are substances that can
be used to specifically augment a specific immune response. These
substances generally perform two functions: (1) they protect the
antigen(s) from being rapidly catabolized after administration and
(2) they nonspecifically stimulate immune responses.
[0247] Normally, the adjuvant and the composition are mixed prior
to presentation to the immune system, or presented separately, but
into the same site of the animal being immunized. Adjuvants can be
loosely divided into several groups based upon their composition.
These groups include oil adjuvants (for example, Freund's complete
and incomplete), mineral salts (for example, AlK(SO.sub.4).sub.2,
AlNa(SO.sub.4).sub.2, AlNH.sub.4(SO.sub.4), silica, kaolin, and
carbon), polynucleotides (for example, poly IC and poly AU acids),
and certain natural substances (for example, wax D from
Mycobacterium tuberculosis, as well as substances found in
Corynebacterium parvum, or Bordetella pertussis, and members of the
genus Brucella. Other substances useful as adjuvants are the
saponins such as, for example, Quil A. (Superfos A/S, Denmark).
Preferred adjuvants for use in the present invention include
aluminum salts, such as AlK(SO.sub.4).sub.2, AlNa(SO.sub.4).sub.2,
and AlNH.sub.4(SO.sub.4). Examples of materials suitable for use in
vaccine compositions are provided in REMINGTON'S PHARMACEUTICAL
SCIENCES 1324-1341 (A. Osol, ed, Mack Publishing Co, Easton, Pa.,
(1980) (incorporated herein by reference).
[0248] The therapeutic compositions of the present invention can be
administered parenterally by injection, rapid infusion,
nasopharyngeal absorption (intranasopharangeally), dermoabsorption,
or orally. The compositions may alternatively be administered
intramuscularly, or intravenously. Compositions for parenteral
administration include sterile aqueous or non-aqueous solutions,
suspensions, and emulsions. Examples of non-aqueous solvents are
propylene glycol, polyethylene glycol, vegetable oils such as olive
oil, and injectable organic esters such as ethyl oleate. Carriers
or occlusive dressings can be used to increase skin permeability
and enhance antigen absorption. Liquid dosage forms for oral
administration may generally comprise a liposome solution
containing the liquid dosage form. Suitable forms for suspending
liposomes include emulsions, suspensions, solutions, syrups, and
elixirs containing inert diluents commonly used in the art, such as
purified water. Besides the inert diluents, such compositions can
also include adjuvants, wetting agents, emulsifying and suspending
agents, or sweetening, flavoring, or perfuming agents.
[0249] Therapeutic compositions of the present invention can also
be administered in encapsulated form. For example, intranasal
immunization using vaccines encapsulated in biodegradable
microsphere composed of poly(DL-lactide-co-glycolide). See, Shahin,
R. et al. (1995) Infect. Immun. 63:1195-1200. Similarly, orally
administered encapsulated Salmonella typhimurium antigens can also
be used. Allaoui-Attarki, K. et al. (1997) Infect. Immun.
65:853-857. Encapsulated vaccines of the present invention can be
administered by a variety of routes including those involving
contacting the vaccine with mucous membranes (e.g., intranasally,
intracolonicly, intraduodenally).
[0250] Many different techniques exist for the timing of the
immunizations when a multiple administration regimen is utilized.
It is possible to use the compositions of the invention more than
once to increase the levels and diversities of expression of the
immunoglobulin repertoire expressed by the immunized animal.
Typically, if multiple immunizations are given, they will be given
one to two months apart.
[0251] According to the present invention, an "effective amount" of
a therapeutic composition is one which is sufficient to achieve a
desired biological effect. Generally, the dosage needed to provide
an effective amount of the composition will vary depending upon
such factors as the animal's or human's age, condition, sex, and
extent of disease, if any, and other variables which can be
adjusted by one of ordinary skill in the art.
[0252] The antigenic preparations of the invention can be
administered by either single or multiple dosages of an effective
amount. Effective amounts of the compositions of the invention can
vary from 0.01-1,000 .mu.g/ml per dose, more preferably 0.1-500
.mu.g/ml per dose, and most preferably 10-300 .mu.g/ml per
dose.
EXAMPLES
Example 1
Isolation of a Selected DNA Clone from the Deposited Sample
[0253] Three approaches can be used to isolate a S. aureus clone
comprising a polynucleotide of the present invention from any S.
aureus genomic DNA library. The S. aureus strain ISP3 has been
deposited as a convienent source for obtaining a S. aureus strain
although a wide varity of strains S. aureus strains can be used
which are known in the art.
[0254] S. aureus genomic DNA is prepared using the following
method. A 20 ml overnight bacterial culture grown in a rich medium
(e.g;, Trypticase Soy Broth, Brain Heart Infusion broth or Super
broth), pelleted, washed two times with TES (30 mM Tris-pH 8.0, 25
mM EDTA, 50 mM NaCl), and resuspended in 5 ml high salt TES (2.5M
NaCl). Lysostaphin is added to final concentration of approx 50
ug/ml and the mixture is rotated slowly 1 hour at 37 C to make
protoplast cells. The solution is then placed in incubator (or
place in a shaking water bath) and warmed to 55 C. Five hundred
micro liter of 20% sarcosyl in TES (final concentration 2%) is then
added to lyse the cells. Next, guanidine HCl is added to a final
concentration of 7M (3.69 g in 5.5 ml). The mixture is swirled
slowly at 55 C for 60-90 min (solution should clear). A CsCl
gradient is then set up in SW41 ultra clear tubes using 2.0 ml 5.7M
CsCl and overlaying with 2.85M CsCl. The gradient is carefully
overlayed with the DNA-containing GuHCl solution. The gradient is
spun at 30,000 rpm, 20 C for 24 hr and the lower DNA band is
collected. The volume is increased to 5 ml with TE buffer. The DNA
is then treated with protease K (10 ug/ml) overnight at 37 C, and
precipitated with ethanol. The precipitated DNA is resuspended in a
desired buffer.
[0255] In the first method, a plasmid is directly isolated by
screening a plasmid S. aureus genomic DNA library using a
polynucleotide probe corresponding to a polynucleotide of the
present invention. Particularly, a specific polynucleotide with
30-40 nucleotides is synthesized using an Applied Biosystems DNA
synthesizer according to the sequence reported. The oligonucleotide
is labeled, for instance, with .sup.32P-.gamma.-ATP using T4
polynucleotide kinase and purified according to routine methods.
(See, e.g., Maniatis et al., Molecular Cloning: A Laboratory
Manual, Cold Spring Harbor Press, Cold Spring, N.Y. (1982).) The
library is transformed into a suitable host, as indicated above
(such as XL-1 Blue (Stratagene)) using techniques known to those of
skill in the art. See, e.g., Sambrook et al. MOLECULAR CLONING: A
LABORATORY MANUAL (Cold Spring Harbor, N.Y. 2nd ed. 1989); Ausubel
et al., CURRENT PROTOCALS IN MOLECULAR BIOLOGY (John Wiley and
Sons, N.Y. 1989). The transformants are plated on 1.5% agar plates
(containing the appropriate selection agent, e.g., ampicillin) to a
density of about 150 transformants (colonies) per plate. These
plates are screened using Nylon membranes according to routine
methods for bacterial colony screening. See, e.g., Sambrook et al.
MOLECULAR CLONING: A LABORATORY MANUAL (Cold Spring Harbor, N.Y.
2nd ed. 1989); Ausubel et al., CURRENT PROTOCALS IN MOLECULAR
BIOLOGY (John Wiley and Sons, N.Y. 1989) or other techniques known
to those of skill in the art.
[0256] Alternatively, two primers of 15-25 nucleotides derived from
the 5' and 3' ends of a polynucleotide of Table 1 are synthesized
and used to amplify the desired DNA by PCR using a S. aureus
genomic DNA prep (e.g., the deposited S. aureus ISP3) as a
template. PCR is carried out under routine conditions, for
instance, in 25 .mu.l of reaction mixture with 0.5 ug of the above
DNA template. A convenient reaction mixture is 1.5-5 mM MgCl.sub.2,
0.01% (w/v) gelatin, 20 .mu.M each of DATP, dCTP, dGTP, dTTP, 25
pmol of each primer and 0.25 Unit of Taq polymerase. Thirty five
cycles of PCR (denaturation at 94.degree. C. for 1 min; annealing
at 55.degree. C. for 1 min; elongation at 72.degree. C. for 1 min)
are perform with a Perkin-Elmer Cetus automated thermal cycler. The
amplified product is analyzed by agarose gel electrophoresis and
the DNA band with expected molecular weight is excised and
purified. The PCR product is verified to be the selected sequence
by subcloning and sequencing the DNA product.
[0257] Finally, overlapping oligos of the DNA sequences of Table 1
can be synthesized and used to generate a nucleotide sequence of
desired length using PCR methods known in the art.
Example 2(a)
Expression and Purification staphylococcal Polypeptides in E.
coli
[0258] The bacterial expression vector pQE60 is used for bacterial
expression in this example. (QIAGEN, Inc., 9259 Eton Avenue,
Chatsworth, Calif., 91311). pQE60 encodes ampicillin antibiotic
resistance ("Ampr") and contains a bacterial origin of replication
("ori"), an IPTG inducible promoter, a ribosome binding site
("RBS"), six codons encoding histidine residues that allow affinity
purification using nickel-nitrilo-tri-acetic acid ("Ni--NTA")
affinity resin (QIAGEN, Inc., supra) and suitable single
restriction enzyme cleavage sites. These elements are arranged such
that an inserted DNA fragment encoding a polypeptide expresses that
polypeptide with the six His residues (i.e., a "6.times.His tag")
covalently linked to the carboxyl terminus of that polypeptide.
[0259] The DNA sequence encoding the desired portion of a S. aureus
protein of the present invention is amplified from S. aureus
genomic DNA or from the deposited DNA clone using PCR
oligonucleotide primers which anneal to the 5' and 3' sequences
coding for the portion of the S. aureus polynucleotide. Additional
nucleotides containing restriction sites to facilitate cloning in
the pQE60 vector are added to the 5' and 3' sequences,
respectively.
[0260] For cloning the mature protein, the 5' primer has a sequence
containing an appropriate restriction site followed by nucleotides
of the amino terminal coding sequence of the desired S. aureus
polynucleotide sequence in Table 1. One of ordinary skill in the
art would appreciate that the point in the protein coding sequence
where the 5' and 3' primers begin may be varied to amplify a DNA
segment encoding any desired portion of the complete protein
shorter or longer than the mature form. The 3' primer has a
sequence containing an appropriate restriction site followed by
nucleotides complementary to the 3' end of the desired coding
sequence of Table 1, excluding a stop codon, with the coding
sequence aligned with the restriction site so as to maintain its
reading frame with that of the six His codons in the pQE60
vector.
[0261] The amplified S. aureus DNA fragment and the vector pQE60
are digested with restriction enzymes which recognize the sites in
the primers and the digested DNAs are then ligated together. The S.
aureus DNA is inserted into the restricted pQE60 vector in a manner
which places the S. aureus protein coding region downstream from
the IPTG-inducible promoter and in-frame with an initiating AUG and
the six histidine codons.
[0262] The ligation mixture is transformed into competent E. coli
cells using standard procedures such as those described by Sambrook
et al., supra. E. coli strain M15/rep4, containing multiple copies
of the plasmid pREP4, which expresses the lac repressor and confers
kanamycin resistance ("Kan.sup.r"), is used in carrying out the
illustrative example described herein. This strain, which is only
one of many that are suitable for expressing a S. aureus
polypeptide, is available commercially (QIAGEN, Inc., supra).
Transformants are identified by their ability to grow on LB plates
in the presence of ampicillin and kanamycin. Plasmid DNA is
isolated from resistant colonies and the identity of the cloned DNA
confirmed by restriction analysis, PCR and DNA sequencing.
[0263] Clones containing the desired constructs are grown overnight
("O/N") in liquid culture in LB media supplemented with both
ampicillin (100 .mu.g/ml) and kanamycin (25 .mu.g/ml). The O/N
culture is used to inoculate a large culture, at a dilution of
approximately 1:25 to 1:250. The cells are grown to an optical
density at 600 nm ("OD.sup.600") of between 0.4 and 0.6.
Isopropyl-.beta.-D-thiogalactopyranoside ("IPTG") is then added to
a final concentration of 1 mM to induce transcription from the lac
repressor sensitive promoter, by inactivating the lacI repressor.
Cells subsequently are incubated further for 3 to 4 hours. Cells
then are harvested by centrifugation.
[0264] The cells are then stirred for 3-4 hours at 4.degree. C. in
6M guanidine-HCl, pH 8. The cell debris is removed by
centrifugation, and the supernatant containing the S. aureus
polypeptide is loaded onto a nickel-nitrilo-tri-acetic acid
("Ni--NTA") affinity resin column (QIAGEN, Inc., supra). Proteins
with a 6.times.His tag bind to the Ni--NTA resin with high affinity
and can be purified in a simple one-step procedure (for details
see: The QIAexpressionist, 1995, QIAGEN, Inc., supra). Briefly the
supernatant is loaded onto the column in 6 M guanidine-HCl, pH 8,
the column is first washed with 10 volumes of 6 M guanidine-HCl, pH
8, then washed with 10 volumes of 6 M guanidine-HCl pH 6, and
finally the S. aureus polypeptide is eluted with 6 M guanidine-HCl,
pH 5.
[0265] The purified protein is then renatured by dialyzing it
against phosphate-buffered saline (PBS) or 50 mM Na-acetate, pH 6
buffer plus 200 mM NaCl. Alternatively, the protein can be
successfully refolded while immobilized on the Ni--NTA column. The
recommended conditions are as follows: renature using a linear
6M-1M urea gradient in 500 mM NaCl, 20% glycerol, 20 mM Tris/HCl pH
7.4, containing protease inhibitors. The renaturation should be
performed over a period of 1.5 hours or more. After renaturation
the proteins can be eluted by the addition of 250 mM imidazole.
Imidazole is removed by a final dialyzing step against PBS or 50 mM
sodium acetate pH 6 buffer plus 200 mM NaCl. The purified protein
is stored at 4.degree. C. or frozen at -80.degree. C.
[0266] Alternatively, the polypeptides of the present invention can
be produced by a non-denaturing method. In this method, after the
cells are harvested by centrifugation, the cell pellet from each
liter of culture is resuspended in 25 ml of Lysis Buffer A at
4.degree. C. (Lysis Buffer A=50 mM Na-phosphate, 300 mM NaCl, 10 mM
2-mercaptoethanol, 10% Glycerol, pH 7.5 with 1 tablet of Complete
EDTA-free protease inhibitor cocktail (Boehringer Mannheim
#1873580) per 50 ml of buffer). Absorbance at 550 nm is
approximately 10-20 O.D./ml. The suspension is then put through
three freeze/thaw cycles from -70.degree. C. (using a ethanol-dry
ice bath) up to room temperature. The cells are lysed via
sonication in short 10 sec bursts over 3 minutes at approximately
80 W while kept on ice. The sonicated sample is then centrifuged at
15,000 RPM for 30 minutes at 4.degree. C. The supernatant is passed
through a column containing 1.0 ml of CL-4B resin to pre-clear the
sample of any proteins that may bind to agarose non-specifically,
and the flow-through fraction is collected.
[0267] The pre-cleared flow-through is applied to a
nickel-nitrilo-tri-acetic acid ("Ni--NTA") affinity resin column
(Qiagen, Inc., supra). Proteins with a 6.times.His tag bind to the
Ni--NTA resin with high affinity and can be purified in a simple
one-step procedure. Briefly, the supernatant is loaded onto the
column in Lysis Buffer A at 4.degree. C., the column is first
washed with 10 volumes of Lysis Buffer A until the A280 of the
eluate returns to the baseline. Then, the column is washed with 5
volumes of 40 mM Imidazole (92% Lysis Buffer A/8% Buffer B) (Buffer
B=50 mM Na-Phosphate, 300 mM NaCl, 10% Glycerol, 10 mM
2-mercaptoethanol, 500 mM Imidazole, pH of the final buffer should
be 7.5). The protein is eluted off of the column with a series of
increasing Imidazole solutions made by adjusting the ratios of
Lysis Buffer A to Buffer B. Three different concentrations are
used: 3 volumes of 75 mM Imidazole, 3 volumes of 150 mM Imidazole,
5 volumes of 500 mM Imidazole. The fractions containing the
purified protein are analyzed using 8%, 10% or 14% SDS-PAGE
depending on the protein size. The purified protein is then
dialyzed 2.times. against phosphate-buffered saline (PBS) in order
to place it into an easily workable buffer. The purified protein is
stored at 4.degree. C. or frozen at -80.degree..
[0268] The following is another alternative method may be used to
purify S. aureus expressed in E coli when it is present in the form
of inclusion bodies. Unless otherwise specified, all of the
following steps are conducted at 4-10.degree. C.
[0269] Upon completion of the production phase of the E. coli
fermentation, the cell culture is cooled to 4-10.degree. C. and the
cells are harvested by continuous centrifugation at 15,000 rpm
(Heraeus Sepatech). On the basis of the expected yield of protein
per unit weight of cell paste and the amount of purified protein
required, an appropriate amount of cell paste, by weight, is
suspended in a buffer solution containing 100 mM Tris, 50 mM EDTA,
pH 7.4. The cells are dispersed to a homogeneous suspension using a
high shear mixer.
[0270] The cells are then lysed by passing the solution through a
microfluidizer (Microfluidics, Corp. or APV Gaulin, Inc.) twice at
4000-6000 psi. The homogenate is then mixed with NaCl solution to a
final concentration of 0.5 M NaCl, followed by centrifugation at
7000.times.g for 15 min. The resultant pellet is washed again using
0.5M NaCl, 100 mM Tris, 50 mM EDTA, pH 7.4.
[0271] The resulting washed inclusion bodies are solubilized with
1.5 M guanidine hydrochloride (GuHCl) for 2-4 hours. After
7000.times.g centrifugation for 15 min., the pellet is discarded
and the S. aureus polypeptide-containing supernatant is incubated
at 4.degree. C. overnight to allow further GuHCl extraction.
[0272] Following high speed centrifugation (30,000.times.g) to
remove insoluble particles, the GuHCl solubilized protein is
refolded by quickly mixing the GuHCl extract with 20 volumes of
buffer containing 50 mM sodium, pH 4.5, 150 mM NaCl, 2 mM EDTA by
vigorous stirring. The refolded diluted protein solution is kept at
4.degree. C. without mixing for 12 hours prior to further
purification steps.
[0273] To clarify the refolded S. aureus polypeptide solution, a
previously prepared tangential filtration unit equipped with 0.16
.mu.m membrane filter with appropriate surface area (e.g.,
Filtron), equilibrated with 40 mM sodium acetate, pH 6.0 is
employed. The filtered sample is loaded onto a cation exchange
resin (e.g., Poros HS-50, Perseptive Biosystems). The column is
washed with 40 mM sodium acetate, pH 6.0 and eluted with 250 mM,
500 mM, 1000 mM, and 1500 mM NaCl in the same buffer, in a stepwise
manner. The absorbance at 280 mm of the effluent is continuously
monitored. Fractions are collected and further analyzed by
SDS-PAGE.
[0274] Fractions containing the S. aureus polypeptide are then
pooled and mixed with 4 volumes of water. The diluted sample is
then loaded onto a previously prepared set of tandem columns of
strong anion (Poros HQ-50, Perseptive Biosystems) and weak anion
(Poros CM-20, Perseptive Biosystems) exchange resins. The columns
are equilibrated with 40 mM sodium acetate, pH 6.0. Both columns
are washed with 40 mM sodium acetate, pH 6.0, 200 mM NaCl. The
CM-20 column is then eluted using a 10 column volume linear
gradient ranging from 0.2 M NaCl, 50 mM sodium acetate, pH 6.0 to
1.0 M NaCl, 50 mM sodium acetate, pH 6.5. Fractions are collected
under constant A.sub.280 monitoring of the effluent. Fractions
containing the S. aureus polypeptide (determined, for instance, by
16% SDS-PAGE) are then pooled.
[0275] The resultant S. aureus polypeptide exhibits greater than
95% purity after the above refolding and purification steps. No
major contaminant bands are observed from Commassie blue stained
16% SDS-PAGE gel when 5 .mu.g of purified protein is loaded. The
purified protein is also tested for endotoxin/LPS contamination,
and typically the LPS content is less than 0.1 ng/ml according to
LAL assays.
Example 2(b)
Expression and Purification Staphylococcal Polypeptides in E.
coli
[0276] Alternatively, the vector pQE10 can be used to clone and
express polypeptides of the present invention. The difference being
such that an inserted DNA fragment encoding a polypeptide expresses
that polypeptide with the six His residues (i.e., a "6.times.His
tag") covalently linked to the amino terminus of that polypeptide.
The bacterial expression vector pQE10 (QIAGEN, Inc., 9259 Eton
Avenue, Chatsworth, Calif., 91311) is used in this example. The
components of the pQE10plasmid are arranged such that the inserted
DNA sequence encoding a polypeptide of the present invention
expresses the polypeptide with the six His residues (i.e., a
"6.times.His tag")) covalently linked to the amino terminus.
[0277] The DNA sequences encoding the desired portions of a
polypeptide of Table 1 or expressed by the plasmids listed in Table
1 are amplified using PCR oligonucleotide primers from either
genomic S. aureus DNA or DNA from the plasmid clones listed in
Table 1 clones of the present invention. The PCR primers anneal to
the nucleotide sequences encoding the desired amino acid sequence
of a polypeptide of the present invention. Additional nucleotides
containing restriction sites to facilitate cloning in the pQE10
vector are added to the 5' and 3' primer sequences,
respectively.
[0278] For cloning a polypeptide of the present invention, the 5'
and 3' primers are selected to amplify their respective nucleotide
coding sequences. One of ordinary skill in the art would appreciate
that the point in the protein coding sequence where the 5' and 3'
primers begins may be varied to amplify a DNA segment encoding any
desired portion of a polypeptide of the present invention. The 5'
primer is designed so the coding sequence of the 6.times.His tag is
aligned with the restriction site so as to maintain its reading
frame with that of S. aureus polypeptide. The 3' is designed to
include an stop codon. The amplified DNA fragment is then cloned,
and the protein expressed, as described above for the pQE60
plasmid.
[0279] The DNA sequences encoding the amino acid sequences of Table
1 may also be cloned and expressed as fusion proteins by a protocol
similar to that described directly above, wherein the pET-32b(+)
vector (Novagen, 601 Science Drive, Madison, Wis. 53711) is
preferentially used in place of pQE10.
Example 2(c)
Expression and Purification of Stahphlococcusl Polypeptides in E.
coli
[0280] The bacterial expression vector pQE60 is used for bacterial
expression in this example (QIAGEN, Inc., 9259 Eton Avenue,
Chatsworth, Calif., 91311). However, in this example, the
polypeptide coding sequence is inserted such that translation of
the six His codons is prevented and, therefore, the polypeptide is
produced with no 6.times.His tag.
[0281] The DNA sequence encoding the desired portion of the S.
aureus amino acid sequence is amplified from a S. aureus genomic
DNA prep using PCR oligonucleotide primers which anneal to the 5'
and 3' nucleotide sequences corresponding to the desired portion of
the S. aureus polypeptides. Additional nucleotides containing
restriction sites to facilitate cloning in the pQE60 vector are
added to the 5' and 3' primer sequences.
[0282] For cloning a S. aureus polypeptides of the present
invention, 5' and 3' primers are selected to amplify their
respective nucleotide coding sequences. One of ordinary skill in
the art would appreciate that the point in the protein coding
sequence where the 5' and 3' primers begin may be varied to amplify
a DNA segment encoding any desired portion of a polypeptide of the
present invention. The 3' and 5' primers contain appropriate
restriction sites followed by nucleotides complementary to the 5'
and 3' ends of the coding sequence respectively. The 3' primer is
additionally designed to include an in-frame stop codon.
[0283] The amplified S. aureus DNA fragments and the vector pQE60
are digested with restriction enzymes recognizing the sites in the
primers and the digested DNAs are then ligated together. Insertion
of the S. aureus DNA into the restricted pQE60 vector places the S.
aureus protein coding region including its associated stop codon
downstream from the IPTG-inducible promoter and in-frame with an
initiating AUG. The associated stop codon prevents translation of
the six histidine codons downstream of the insertion point.
[0284] The ligation mixture is transformed into competent E. coli
cells using standard procedures such as those described by Sambrook
et al. E. coli strain M15/rep4, containing multiple copies of the
plasmid pREP4, which expresses the lac repressor and confers
kanamycin resistance ("Kan.sup.r"), is used in carrying out the
illustrative example described herein. This strain, which is only
one of many that are suitable for expressing S. aureus polypeptide,
is available commercially (QIAGEN, Inc., supra). Transformants are
identified by their ability to grow on LB plates in the presence of
ampicillin and kanamycin. Plasmid DNA is isolated from resistant
colonies and the identity of the cloned DNA confirmed by
restriction analysis, PCR and DNA sequencing.
[0285] Clones containing the desired constructs are grown overnight
("O/N") in liquid culture in LB media supplemented with both
ampicillin (100 .mu.g/ml) and kanamycin (25 .mu.g/ml). The O/N
culture is used to inoculate a large culture, at a dilution of
approximately 1:25 to 1:250. The cells are grown to an optical
density at 600 nm ("OD600") of between 0.4 and 0.6.
isopropyl-b-D-thiogalactopyranoside ("IPTG") is then added to a
final concentration of 1 mM to induce transcription from the lac
repressor sensitive promoter, by inactivating the lacI repressor.
Cells subsequently are incubated further for 3 to 4 hours. Cells
then are harvested by centrifugation.
[0286] To purify the S. aureus polypeptide, the cells are then
stirred for 3-4 hours at 4.degree. C. in 6M guanidine-HCl, pH 8.
The cell debris is removed by centrifugation, and the supernatant
containing the S. aureus polypeptide is dialyzed against 50 mM
Na-acetate buffer pH 6, supplemented with 200 mM NaCl.
Alternatively, the protein can be successfully refolded by
dialyzing it against 500 mM NaCl, 20% glycerol, 25 mM Tris/HCl pH
7.4, containing protease inhibitors. After renaturation the protein
can be purified by ion exchange, hydrophobic interaction and size
exclusion chromatography. Alternatively, an affinity chromatography
step such as an antibody column can be used to obtain pure S.
aureus polypeptide. The purified protein is stored at 4.degree. C.
or frozen at -80.degree. C.
[0287] The following alternative method may be used to purify S.
aureus polypeptides expressed in E coli when it is present in the
form of inclusion bodies. Unless otherwise specified, all of the
following steps are conducted at 4-10.degree. C.
[0288] Upon completion of the production phase of the E. coli
fermentation, the cell culture is cooled to 4-10.degree. C. and the
cells are harvested by continuous centrifugation at 15,000 rpm
(Heraeus Sepatech). On the basis of the expected yield of protein
per unit weight of cell paste and the amount of purified protein
required, an appropriate amount of cell paste, by weight, is
suspended in a buffer solution containing 100 mM Tris, 50 mM EDTA,
pH 7.4. The cells are dispersed to a homogeneous suspension using a
high shear mixer.
[0289] The cells ware then lysed by passing the solution through a
microfluidizer (Microfluidics, Corp. or APV Gaulin, Inc.) twice at
4000-6000 psi. The homogenate is then mixed with NaCl solution to a
final concentration of 0.5 M NaCl, followed by centrifugation at
7000.times.g for 15 min. The resultant pellet is washed again using
0.5M NaCl, 100 mM Tris, 50 mM EDTA, pH 7.4.
[0290] The resulting washed inclusion bodies are solubilized with
1.5 M guanidine hydrochloride (GuHCl) for 2-4 hours. After
7000.times.g centrifugation for 15 min., the pellet is discarded
and the S. aureus polypeptide-containing supernatant is incubated
at 4.degree. C. overnight to allow further GuHCl extraction.
[0291] Following high speed centrifugation (30,000.times.g) to
remove insoluble particles, the GuHCl solubilized protein is
refolded by quickly mixing the GuHCl extract with 20 volumes of
buffer containing 50 mM sodium, pH 4.5, 150 mM NaCl, 2 mM EDTA by
vigorous stirring. The refolded diluted protein solution is kept at
4.degree. C. without mixing for 12 hours prior to further
purification steps.
[0292] To clarify the refolded S. aureus polypeptide solution, a
previously prepared tangential filtration unit equipped with 0.16
.mu.m membrane filter with appropriate surface area (e.g.,
Filtron), equilibrated with 40 mM sodium acetate, pH 6.0 is
employed. The filtered sample is loaded onto a cation exchange
resin (e.g., Poros HS-50, Perseptive Biosystems). The column is
washed with 40 mM sodium acetate, pH 6.0 and eluted with 250 mM,
500 mM, 1000 mM, and 1500 mM NaCl in the same buffer, in a stepwise
manner. The absorbance at 280 mm of the effluent is continuously
monitored. Fractions are collected and further analyzed by
SDS-PAGE.
[0293] Fractions containing the S. aureus polypeptide are then
pooled and mixed with 4 volumes of water. The diluted sample is
then loaded onto a previously prepared set of tandem columns of
strong anion (Poros HQ-50, Perseptive Biosystems) and weak anion
(Poros CM-20, Perseptive Biosystems) exchange resins. The columns
are equilibrated with 40 mM sodium acetate, pH 6.0. Both columns
are washed with 40 mM sodium acetate, pH 6.0, 200 mM NaCl. The
CM-20 column is then eluted using a 10 column volume linear
gradient ranging from 0.2 M NaCl, 50 mM sodium acetate, pH 6.0 to
1.0 M NaCl, 50 mM sodium acetate, pH 6.5. Fractions are collected
under constant A.sub.280 monitoring of the effluent. Fractions
containing the S. aureus polypeptide (determined, for instance, by
16% SDS-PAGE) are then pooled.
[0294] The resultant S. aureus polypeptide exhibits greater than
95% purity after the above refolding and purification steps. No
major contaminant bands are observed from Commassie blue stained
16% SDS-PAGE gel when 5 .mu.g of purified protein is loaded. The
purified protein is also tested for endotoxin/LPS contamination,
and typically the LPS content is less than 0.1 ng/ml according to
LAL assays.
Example 2(d)
Cloning and Expression of S. aureus in Other Bacteria
[0295] S. aureus polypeptides can also be produced in: S. aureus
using the methods of S. Skinner et al., (1988) Mol. Microbiol.
2:289-297 or J. I. Moreno (1996) Protein Expr. Purif. 8(3):332-340;
Lactobacillus using the methods of C. Rush et al., 1997 Appl.
Microbiol. Biotechnol. 47(5):537-542; or in Bacillus subtilis using
the methods Chang et al., U.S. Pat. No. 4,952,508.
Example 3
Cloning and Expression in COS Cells
[0296] A S. aureus expression plasmid is made by cloning a portion
of the DNA encoding a S. aureus polypeptide into the expression
vector pDNAI/Amp or pDNAIII (which can be obtained from Invitrogen,
Inc.). The expression vector pDNAI/amp contains: (1) an E. coli
origin of replication effective for propagation in E. coli and
other prokaryotic cells; (2) an ampicillin resistance gene for
selection of plasmid-containing prokaryotic cells; (3) an SV40
origin of replication for propagation in eukaryotic cells; (4) a
CMV promoter, a polylinker, an SV40 intron; (5) several codons
encoding a hemagglutinin fragment (i.e., an "HA" tag to facilitate
purification) followed by a termination codon and polyadenylation
signal arranged so that a DNA can be conveniently placed under
expression control of the CMV promoter and operably linked to the
SV40 intron and the polyadenylation signal by means of restriction
sites in the polylinker. The HA tag corresponds to an epitope
derived from the influenza hemagglutinin protein described by
Wilson et al. 1984 Cell 37:767. The fusion of the HA tag to the
target protein allows easy detection and recovery of the
recombinant protein with an antibody that recognizes the HA
epitope. pDNAIII contains, in addition, the selectable neomycin
marker.
[0297] A DNA fragment encoding a S. aureus polypeptide is cloned
into the polylinker region of the vector so that recombinant
protein expression is directed by the CMV promoter. The plasmid
construction strategy is as follows. The DNA from a S. aureus
genomic DNA prep is amplified using primers that contain convenient
restriction sites, much as described above for construction of
vectors for expression of S. aureus in E. coli. The 5' primer
contains a Kozak sequence, an AUG start codon, and nucleotides of
the 5' coding region of the S. aureus polypeptide. The 3' primer,
contains nucleotides complementary to the 3' coding sequence of the
S. aureus DNA, a stop codon, and a convenient restriction site.
[0298] The PCR amplified DNA fragment and the vector, pDNAI/Amp,
are digested with appropriate restriction enzymes and then ligated.
The ligation mixture is transformed into an appropriate E. coli
strain such as SURE.TM. (Stratagene Cloning Systems, La Jolla,
Calif. 92037), and the transformed culture is plated on ampicillin
media plates which then are incubated to allow growth of ampicillin
resistant colonies. Plasmid DNA is isolated from resistant colonies
and examined by restriction analysis or other means for the
presence of the fragment encoding the S. aureus polypeptide
[0299] For expression of a recombinant S. aureus polypeptide, COS
cells are transfected with an expression vector, as described
above, using DEAE-dextran, as described, for instance, by Sambrook
et al. (supra). Cells are incubated under conditions for expression
of S. aureus by the vector.
[0300] Expression of the S. aureus-HA fusion protein is detected by
radiolabeling and immunoprecipitation, using methods described in,
for example Harlow et al., supra. To this end, two days after
transfection, the cells are labeled by incubation in media
containing .sup.35S-cysteine for 8 hours. The cells and the media
are collected, and the cells are washed and the lysed with
detergent-containing RIPA buffer: 150 mM NaCl, 1% NP-40, 0.1% SDS,
1% NP-40, 0.5% DOC, 50 mM TRIS, pH 7.5, as described by Wilson et
al. (supra). Proteins are precipitated from the cell lysate and
from the culture media using an HA-specific monoclonal antibody.
The precipitated proteins then are analyzed by SDS-PAGE and
autoradiography. An expression product of the expected size is seen
in the cell lysate, which is not seen in negative controls.
Example 4
Cloning and Expression in CHO Cells
[0301] The vector pC4 is used for the expression of S. aureus
polypeptide in this example. Plasmid pC4 is a derivative of the
plasmid pSV2-dhfr (ATCC Accession No. 37146). The plasmid contains
the mouse DHFR gene under control of the SV40 early promoter.
Chinese hamster ovary cells or other cells lacking dihydrofolate
activity that are transfected with these plasmids can be selected
by growing the cells in a selective medium (alpha minus MEM, Life
Technologies) supplemented with the chemotherapeutic agent
methotrexate. The amplification of the DHFR genes in cells
resistant to methotrexate (MTX) has been well documented. See,
e.g.; Alt et al., 1978, J. Biol. Chem. 253:1357-1370; Hamlin et
al., 1990, Biochem. et Biophys. Acta, 1097:107-143; Page et al.,
1991, Biotechnology 9:64-68. Cells grown in increasing
concentrations of MTX develop resistance to the drug by
overproducing the target enzyme, DHFR, as a result of amplification
of the DHFR gene. If a second gene is linked to the DHFR gene, it
is usually co-amplified and over-expressed. It is known in the art
that this approach may be used to develop cell lines carrying more
than 1,000 copies of the amplified gene(s). Subsequently, when the
methotrexate is withdrawn, cell lines are obtained which contain
the amplified gene integrated into one or more chromosome(s) of the
host cell.
[0302] Plasmid pC4 contains the strong promoter of the long
terminal repeat (LTR) of the Rouse Sarcoma Virus, for expressing a
polypeptide of interest, Cullen, et al. (1985) Mol. Cell. Biol.
5:438-447; plus a fragment isolated from the enhancer of the
immediate early gene of human cytomegalovirus (CMV), Boshart, et
al., 1985, Cell 41:521-530. Downstream of the promoter are the
following single restriction enzyme cleavage sites that allow the
integration of the genes: Bam HI, Xba I, and Asp 718. Behind these
cloning sites the plasmid contains the 3' intron and
polyadenylation site of the rat preproinsulin gene. Other high
efficiency promoters can also be used for the expression, e.g., the
human .beta.-actin promoter, the SV40 early or late promoters or
the long terminal repeats from other retroviruses, e.g., HIV and
HTLVI. Clontech's Tet-Off and Tet-On gene expression systems and
similar systems can be used to express the S. aureus polypeptide in
a regulated way in mammalian cells (Gossen et al., 1992, Proc.
Natl. Acad. Sci. USA 89:5547-5551. For the polyadenylation of the
mRNA other signals, e.g., from the human growth hormone or globin
genes can be used as well. Stable cell lines carrying a gene of
interest integrated into the chromosomes can also be selected upon
co-transfection with a selectable marker such as gpt, G418 or
hygromycin. It is advantageous to use more than one selectable
marker in the beginning, e.g., G418 plus methotrexate.
[0303] The plasmid pC4 is digested with the restriction enzymes and
then dephosphorylated using calf intestinal phosphates by
procedures known in the art. The vector is then isolated from a 1%
agarose gel. The DNA sequence encoding the S. aureus polypeptide is
amplified using PCR oligonucleotide primers corresponding to the 5'
and 3' sequences of the desired portion of the gene. A 5' primer
containing a restriction site, a Kozak sequence, an AUG start
codon, and nucleotides of the 5' coding region of the S. aureus
polypeptide is synthesized and used. A 3' primer, containing a
restriction site, stop codon, and nucleotides complementary to the
3' coding sequence of the S. aureus polypeptides is synthesized and
used. The amplified fragment is digested with the restriction
endonucleases and then purified again on a 1% agarose gel. The
isolated fragment and the dephosphorylated vector are then ligated
with T4 DNA ligase. E. coli HB101 or XL-1 Blue cells are then
transformed and bacteria are identified that contain the fragment
inserted into plasmid pC4 using, for instance, restriction enzyme
analysis.
[0304] Chinese hamster ovary cells lacking an active DHFR gene are
used for transfection. Five .mu.g of the expression plasmid pC4 is
cotransfected with 0.5 .mu.g of the plasmid pSVneo using a
lipid-mediated transfection agent such as Lipofectin.TM. or
LipofectAMINE.TM. (LifeTechnologies Gaithersburg, Md.). The plasmid
pSV2-neo contains a dominant selectable marker, the neo gene from
Tn5 encoding an enzyme that confers resistance to a group of
antibiotics including G418. The cells are seeded in alpha minus MEM
supplemented with 1 mg/ml G418. After 2 days, the cells are
trypsinized and seeded in hybridoma cloning plates (Greiner,
Germany) in alpha minus MEM supplemented with 10, 25, or 50 ng/ml
of methotrexate plus 1 mg/ml G418. After about 10-14 days single
clones are trypsinized and then seeded in 6-well petri dishes or 10
ml flasks using different concentrations of methotrexate (50 nM,
100 nM, 200 nM, 400 nM, 800 nM). Clones growing at the highest
concentrations of methotrexate are then transferred to new 6-well
plates containing even higher concentrations of methotrexate (1
.mu.M, 2 .mu.M, 5 .mu.M, 10 mM, 20 mM). The same procedure is
repeated until clones are obtained which grow at a concentration of
100-200 .mu.M. Expression of the desired gene product is analyzed,
for instance, by SDS-PAGE and Western blot or by reversed phase
HPLC analysis.
Example 5
Quantitative Murine Soft Tissue Infection Model for S. aureus
[0305] Compositions of the present invention, including
polypeptides and peptides, are assayed for their ability to
function as vaccines or to enhance/stimulate an immune response to
a bacterial species (e.g., S. aureus) using the following
quantitative murine soft tissue infection model. Mice (e.g., NIH
Swiss female mice, approximately 7 weeks old) are first treated
with a biologically protective effective amount, or immune
enhancing/stimulating effective amount of a composition of the
present invention using methods known in the art, such as those
discussed above. See, e.g., Harlow et al., ANTIBODIES: A LABORATORY
MANUAL, (Cold Spring Harbor Laboratory Press, 2nd ed. 1988). An
example of an appropriate starting dose is 20 ug per animal.
[0306] The desired bacterial species used to challenge the mice,
such as S. aureus, is grown as an overnight culture. The culture is
diluted to a concentration of 5.times.10.sup.8 cfu/ml, in an
appropriate media, mixed well, serially diluted, and titered. The
desired doses are further diluted 1:2 with sterilized Cytodex 3
microcarrier beads preswollen in sterile PBS (3 g/100 ml). Mice are
anesthetize briefly until docile, but still mobile and injected
with 0.2 ml of the Cytodex 3 bead/bacterial mixture into each
animal subcutaneously in the inguinal region. After four days,
counting the day of injection as day one, mice are sacrificed and
the contents of the abscess is excised and placed in a 15 ml
conical tube containing 1.0 ml of sterile PBS. The contents of the
abscess is then enzymatically treated and plated as follows.
[0307] The abscess is first disrupted by vortexing with sterilized
glass beads placed in the tubes. 3.0 mls of prepared enzyme mixture
(1.0 ml Collagenase D (4.0 mg/ml), 1.0 ml Trypsin (6.0 mg/ml) and
8.0 ml PBS) is then added to each tube followed by a 20 min.
incubation at 37 C. The solution is then centrifuged and the
supernatant drawn off. 0.5 ml dH20 is then added and the tubes are
vortexed and then incubated for 10 min. at room temperature. 0.5 ml
media is then added and samples are serially diluted and plated
onto agar plates, and grown overnight at 37 C. Plates with distinct
and separate colonies are then counted, compared to positive and
negative control samples, and quantified. The method can be used to
identify composition and determine appropriate and effective doses
for humans and other animals by comparing the effective doses of
compositions of the present invention with compositions known in
the art to be effective in both mice and humans. Doses for the
effective treatment of humans and other animals, using compositions
of the present invention, are extrapolated using the data from the
above experiments of mice. It is appreciated that further studies
in humans and other animals may be needed to determine the most
effective doses using methods of clinical practice known in the
art.
Example 6
Murine Systemic Neutropenic Model for S. aureus Infection
[0308] Compositions of the present invention, including
polypeptides and peptides, are assayed for their ability to
function as vaccines or to enhance/stimulate an immune response to
a bacterial species (e.g., S. aureus) using the following
qualitative murine systemic neutropenic model. Mice (e.g., NIH
Swiss female mice, approximately 7 weeks old) are first treated
with a biologically protective effective amount, or immune
enhancing/stimulating effective amount of a composition of the
present invention using methods known in the art, such as those
discussed above. See, e.g., Harlow et al., ANTIBODIES: A LABORATORY
MANUAL, (Cold Spring Harbor Laboratory Press, 2nd ed. 1988). An
example of an appropriate starting dose is 20 ug per animal.
[0309] Mice are then injected with 250-300 mg/kg cyclophosphamide
intraperitonially. Counting the day of C.P. injection as day one,
the mice are left untreated for 5 days to begin recovery of
PMNL'S.
[0310] The desired bacterial species used to challenge the mice,
such as S. aureus, is grown as an overnight culture. The culture is
diluted to a concentration of 5.times.18 cfu/ml, in an appropriate
media, mixed well, serially diluted, and titered. The desired doses
are further diluted 1:2 in 4% Brewer's yeast in media.
[0311] Mice are injected with the bacteria/brewer's yeast challenge
intraperitonially. The Brewer's yeast solution alone is used as a
control. The mice are then monitored twice daily for the first week
following challenge, and once a day for the next week to ascertain
morbidity and mortality. Mice remaining at the end of the
experiment are sacrificed. The method can be used to identify
compositions and determine appropriate and effective doses for
humans and other animals by comparing the effective doses of
compositions of the present invention with compositions known in
the art to be effective in both mice and humans. Doses for the
effective treatment of humans and other animals, using compositions
of the present invention, are extrapolated using the data from the
above experiments of mice. It is appreciated that further studies
in humans and other animals may be needed to determine the most
effective doses using methods of clinical practice known in the
art.
[0312] The disclosure of all publications (including patents,
patent applications, journal articles, laboratory manuals, books,
or other documents) cited herein are hereby incorporated by
reference in their entireties.
[0313] The present invention is not to be limited in scope by the
specific embodiments described herein, which are intended as single
illustrations of individual aspects of the invention. Functionally
equivalent methods and components are within the scope of the
invention, in addition to those shown and described herein and will
become apparent to those skilled in the art from the foregoing
description and accompanying drawings. Such modifications are
intended to fall within the scope of the appended claims.
Sequence CWU 1
1
22 1 1470 DNA Staphylococcus aureus 1 tggaaaatta atgaagttcc
aaagtttaga tcaaaactgg aataatggtg gatggcgtaa 60 agcagaggtt
gcacataaag ttgttcataa ttatgaaaat gatatgattt ttattagacc 120
atttaaaaaa gcataattta aatcgaaggc aggacattga aatatgaaat tttcaacttt
180 aagtgaagaa gaatttacca actacaccaa aaagcacttc aaacattata
cgcagtctat 240 agaattatat aattatagaa ataaaataaa tcatgaagca
catattgtgg gagtgaagaa 300 tgataaaaat gaagttatag ctgcatgttt
attaacagag gcacgaattt ttaaattcta 360 caaatatttc tactctcata
gaggtccttt acttgattat ttcgatgcta aattagtttg 420 ttactttttt
aaagaattat ctaaattcat ttataaaaat agaggagtat ttattcttgt 480
tgatccatat ttaatagaga atttaagaga tgcaaatggt aggataataa agaattataa
540 taattcagtg atagtaaaga tgctagggaa aattgggtat ctccatcaag
gttatacaac 600 aggatattca aataaaagtc aaattaggtg gatttctgta
ttggatttaa aagataaaga 660 tgagaatcaa cttttaaaag aaatggaata
ccaaactaga agaaatataa aaaagactat 720 tgagattggt gttaaggttg
aagatttatc tattgaagaa acaaatcgat tttataaatt 780 gtttcaaatg
gctgaagaaa aacatggttt tcatttcatg aatgaagatt attttaaacg 840
aatgcaagaa atatataaag ataaggcaat gttaaagata gcttgtataa atcttaatga
900 atatcaagat aaattaaaaa tacaattatt gaaaatcgaa aatgaaatga
tgactgtgaa 960 cagagcatta aatgaaaatc caaattctaa aaaaaataaa
tcaaaattaa atcagttaaa 1020 tatgcaatta tctagtatta ataatagaat
tagtaaaacc gaagaactaa tatttgaaga 1080 tggacctgtt ttggatttag
ctgctgcttt atttatatgt actgatgatg aagtttatta 1140 tctatcaagt
ggatcaaatc cgaaatataa tcagtatatg ggtgcatatc atctacaatg 1200
gcatatgata aaatatgcaa aatcacataa tattaatagg tataattttt atggaataac
1260 aggcgtcttt agtaatgagg cggatgattt tggtgttcaa caatttaaaa
agggttttaa 1320 tgcacatgtt gaagaattaa ttggtgattt catcaaacca
gtaagaccaa ttctatataa 1380 atttgcaaaa cttatttata aggtttaatt
ataaagtatg ttggaaattg aaattttaaa 1440 ttctttccaa catacttttc
actttttaag 1470 2 414 PRT Staphylococcus aureus 2 Met Lys Phe Ser
Thr Leu Ser Glu Glu Glu Phe Thr Asn Tyr Thr Lys 1 5 10 15 Lys His
Phe Lys His Tyr Thr Gln Ser Ile Glu Leu Tyr Asn Tyr Arg 20 25 30
Asn Lys Ile Asn His Glu Ala His Ile Val Gly Val Lys Asn Asp Lys 35
40 45 Asn Glu Val Ile Ala Ala Cys Leu Leu Thr Glu Ala Arg Ile Phe
Lys 50 55 60 Phe Tyr Lys Tyr Phe Tyr Ser His Arg Gly Pro Leu Leu
Asp Tyr Phe 65 70 75 80 Asp Ala Lys Leu Val Cys Tyr Phe Phe Lys Glu
Leu Ser Lys Phe Ile 85 90 95 Tyr Lys Asn Arg Gly Val Phe Ile Leu
Val Asp Pro Tyr Leu Ile Glu 100 105 110 Asn Leu Arg Asp Ala Asn Gly
Arg Ile Ile Lys Asn Tyr Asn Asn Ser 115 120 125 Val Ile Val Lys Met
Leu Gly Lys Ile Gly Tyr Leu His Gln Gly Tyr 130 135 140 Thr Thr Gly
Tyr Ser Asn Lys Ser Gln Ile Arg Trp Ile Ser Val Leu 145 150 155 160
Asp Leu Lys Asp Lys Asp Glu Asn Gln Leu Leu Lys Glu Met Glu Tyr 165
170 175 Gln Thr Arg Arg Asn Ile Lys Lys Thr Ile Glu Ile Gly Val Lys
Val 180 185 190 Glu Asp Leu Ser Ile Glu Glu Thr Asn Arg Phe Tyr Lys
Leu Phe Gln 195 200 205 Met Ala Glu Glu Lys His Gly Phe His Phe Met
Asn Glu Asp Tyr Phe 210 215 220 Lys Arg Met Gln Glu Ile Tyr Lys Asp
Lys Ala Met Leu Lys Ile Ala 225 230 235 240 Cys Ile Asn Leu Asn Glu
Tyr Gln Asp Lys Leu Lys Ile Gln Leu Leu 245 250 255 Lys Ile Glu Asn
Glu Met Met Thr Val Asn Arg Ala Leu Asn Glu Asn 260 265 270 Pro Asn
Ser Lys Lys Asn Lys Ser Lys Leu Asn Gln Leu Asn Met Gln 275 280 285
Leu Ser Ser Ile Asn Asn Arg Ile Ser Lys Thr Glu Glu Leu Ile Phe 290
295 300 Glu Asp Gly Pro Val Leu Asp Leu Ala Ala Ala Leu Phe Ile Cys
Thr 305 310 315 320 Asp Asp Glu Val Tyr Tyr Leu Ser Ser Gly Ser Asn
Pro Lys Tyr Asn 325 330 335 Gln Tyr Met Gly Ala Tyr His Leu Gln Trp
His Met Ile Lys Tyr Ala 340 345 350 Lys Ser His Asn Ile Asn Arg Tyr
Asn Phe Tyr Gly Ile Thr Gly Val 355 360 365 Phe Ser Asn Glu Ala Asp
Asp Phe Gly Val Gln Gln Phe Lys Lys Gly 370 375 380 Phe Asn Ala His
Val Glu Glu Leu Ile Gly Asp Phe Ile Lys Pro Val 385 390 395 400 Arg
Pro Ile Leu Tyr Lys Phe Ala Lys Leu Ile Tyr Lys Val 405 410 3 561
DNA Staphylococcus aureus 3 tctccgggtg gtgtaattgt agttctactt
gttattttac ttatgattac aatggcttat 60 cagaaaatgc gaatgaagtt
taaaaaggga gctaatatca atgaatacaa atgatgctat 120 taaaatttta
aaagagaacg gtttaaaata tacagataaa cgtaaagata tgttagatat 180
ttttgtcgaa gaagataagt atataaacgc aaagtatata caacaagtta tggatgaaaa
240 ttatcctgga atttcattcg acacaatata tagaaacctg cacttattta
aagatttagg 300 aattattgaa aatacagaac ttgatggtga aatgaagttt
agaatcgctt gtacaaacca 360 tcatcatcat cattttatct gtgaaaagtg
tggagataca aaggtaatag attattgtcc 420 aatagatcag ataaaattat
cactacctgg tgttaatatt cacaaacaca aacttgaagt 480 ttatggtgta
tgtgagtctt gccaagatta atataaagaa atgagattta tgcacatttg 540
gtccgatgta tgcataaatc t 561 4 136 PRT Staphylococcus aureus 4 Met
Asn Thr Asn Asp Ala Ile Lys Ile Leu Lys Glu Asn Gly Leu Lys 1 5 10
15 Tyr Thr Asp Lys Arg Lys Asp Met Leu Asp Ile Phe Val Glu Glu Asp
20 25 30 Lys Tyr Ile Asn Ala Lys Tyr Ile Gln Gln Val Met Asp Glu
Asn Tyr 35 40 45 Pro Gly Ile Ser Phe Asp Thr Ile Tyr Arg Asn Leu
His Leu Phe Lys 50 55 60 Asp Leu Gly Ile Ile Glu Asn Thr Glu Leu
Asp Gly Glu Met Lys Phe 65 70 75 80 Arg Ile Ala Cys Thr Asn His His
His His His Phe Ile Cys Glu Lys 85 90 95 Cys Gly Asp Thr Lys Val
Ile Asp Tyr Cys Pro Ile Asp Gln Ile Lys 100 105 110 Leu Ser Leu Pro
Gly Val Asn Ile His Lys His Lys Leu Glu Val Tyr 115 120 125 Gly Val
Cys Glu Ser Cys Gln Asp 130 135 5 586 DNA Staphylococcus aureus 5
ttaaatgaaa tcatcatgta aatattgaca cgcgcgcaat actacagtta tatttatagt
60 aagtaataat aattattata taagaaagat ggtgatatag atgagtgttg
aaatagaatc 120 aattgaacat gaactagaag aatcaattgc atcattgcga
caagcaggcg taagaattac 180 acctcaaaga caagcaatat tacgttattt
aatttcttca catactcatc caacagctga 240 tgaaatttat caagcacttt
cacctgattt tccaaatata agtgttgcga caatatataa 300 taacttaaga
gtgtttaaag atattggaat tgtaaaagaa ttaacatatg gagactcatc 360
aagtcgattc gactttaata cacataatca ttatcatatt atatgtgaac aatgtggtaa
420 gattgttgat tttcaatatc cacagttaaa tgaaattgaa agattagctc
agcatatgac 480 tgactttgac gtaacacatc atcgaatgga aatttatgga
gtttgtaaag aatgccaaga 540 taaataattt aactttggta gtatgacaaa
ttaaaaaagc gttact 586 6 148 PRT Staphylococcus aureus 6 Met Ser Val
Glu Ile Glu Ser Ile Glu His Glu Leu Glu Glu Ser Ile 1 5 10 15 Ala
Ser Leu Arg Gln Ala Gly Val Arg Ile Thr Pro Gln Arg Gln Ala 20 25
30 Ile Leu Arg Tyr Leu Ile Ser Ser His Thr His Pro Thr Ala Asp Glu
35 40 45 Ile Tyr Gln Ala Leu Ser Pro Asp Phe Pro Asn Ile Ser Val
Ala Thr 50 55 60 Ile Tyr Asn Asn Leu Arg Val Phe Lys Asp Ile Gly
Ile Val Lys Glu 65 70 75 80 Leu Thr Tyr Gly Asp Ser Ser Ser Arg Phe
Asp Phe Asn Thr His Asn 85 90 95 His Tyr His Ile Ile Cys Glu Gln
Cys Gly Lys Ile Val Asp Phe Gln 100 105 110 Tyr Pro Gln Leu Asn Glu
Ile Glu Arg Leu Ala Gln His Met Thr Asp 115 120 125 Phe Asp Val Thr
His His Arg Met Glu Ile Tyr Gly Val Cys Lys Glu 130 135 140 Cys Gln
Asp Lys 145 7 600 DNA Staphylococcus aureus 7 tgagaaaagc ttgcatttta
ttgagaaaac tgttagtttt aattgtaaag tttgaaataa 60 tttgtaatga
ttttaattat tagtagggga gtggacatcg ttggaagaac gattaaatcg 120
cgttaagcaa caattacaac aatcatcata taagctaacg ccacaacgcg aagctactgt
180 tagagttcta attgaaaatg aaaaagatca tctaagtgct gaagacgtat
atctgaaagt 240 aaaagataaa gcgcctgaaa ttggcttggc gacagtatac
agaacgttag agttgttagc 300 tgaactaaaa gttgtcgaca aaattaactt
tggtgatggc gtcgctcgtt ttgatttaag 360 aaaagaaggc gcaaaacatt
tccaccatca tttagtatgt atggaatgtg gtcgtgtaga 420 tgaaatcgat
gaagatttgt taccagaagt tgaaaatcga gttgaaaatg agttcaattt 480
taaaatttta gatcatcgtt taactttcca tggtgtgtgt gaaacgtgcc aagctaaagg
540 taaaggatag taaattgcgt aggttaaatt aaccttcgct ttttttagag
gtgtggttat 600 8 149 PRT Staphylococcus aureus 8 Leu Glu Glu Arg
Leu Asn Arg Val Lys Gln Gln Leu Gln Gln Ser Ser 1 5 10 15 Tyr Lys
Leu Thr Pro Gln Arg Glu Ala Thr Val Arg Val Leu Ile Glu 20 25 30
Asn Glu Lys Asp His Leu Ser Ala Glu Asp Val Tyr Leu Lys Val Lys 35
40 45 Asp Lys Ala Pro Glu Ile Gly Leu Ala Thr Val Tyr Arg Thr Leu
Glu 50 55 60 Leu Leu Ala Glu Leu Lys Val Val Asp Lys Ile Asn Phe
Gly Asp Gly 65 70 75 80 Val Ala Arg Phe Asp Leu Arg Lys Glu Gly Ala
Lys His Phe His His 85 90 95 His Leu Val Cys Met Glu Cys Gly Arg
Val Asp Glu Ile Asp Glu Asp 100 105 110 Leu Leu Pro Glu Val Glu Asn
Arg Val Glu Asn Glu Phe Asn Phe Lys 115 120 125 Ile Leu Asp His Arg
Leu Thr Phe His Gly Val Cys Glu Thr Cys Gln 130 135 140 Ala Lys Gly
Lys Gly 145 9 1647 DNA Staphylococcus aureus 9 gtaaatatac
ctctttaatt aatttattca atagaactgg tataataaaa taaatctcat 60
taggcactta agtaaattta acatataaaa aggaacgttt atgactacta aaaaactgta
120 ttttctatcc atttctatta tcattttagt cgccatttca attgctatat
atataacatt 180 aaatagcaat acgaagacac ggttaaccaa tgattcgcaa
caacaaatag atacaattat 240 cgagcatgat ttacaaaagg gacacattcc
tggagcatca attttaatag taaaaaatgg 300 caaagttttt ttaaataaag
gttatggtta tcaagatgtt gataaaaaag tcaaagcttc 360 tcccacaaca
aagtatgaaa ttgcttctaa tacgaaagct ttcacaggtc ttgcaatttt 420
aaaattagct caagaaggtc gattaaactt aaatgatgcc gtatccaaac atgtgcctca
480 ttttaaaatg aactataatg gtcaaaatga aactattacg attaagcaac
ttttggctca 540 aacaagtggt atacctagtg atattacaag cgaagattct
gtgacaagca aaaataatcg 600 tttaaatgat gtaacccatg caattatggg
tgatgaatta catcataagc ccggagaaga 660 atttgaatac tcaaatatga
actatgattt attaggttta attatccaaa acgttacgaa 720 gcaatcctat
acaaaatata ttacaaattc atggctcaag cctttgcata tgacacatac 780
atcattcaaa caaaccaatt acaaatcaaa acatgatgct attggctatg aattacaagg
840 ttcgacacct gtcgtctcta aacctgaatt taacctttgg gatacaccat
cagcatatat 900 gatgacatca actgaagatt tggaacattg gataaaattc
caacttaatc cacctgataa 960 atacaaatca ttagttcaac aatcacataa
aaatttatct tcaacaattg gtgaacctaa 1020 tgccaatgca tatgcttccg
gctggtttac caataatgat gaacatttag tgtttcattc 1080 aggaacgcta
gataactttt catcatttat tttactaaat ccaaaacaaa attatggaat 1140
tgttgtactt gcaaatctaa attcggaata tgtacccaaa ttagttgagc atcttaatac
1200 acaaattgta aatcacaagc gatattcgac ggttgcgtct atgctcaatc
aatataaaga 1260 tcaatttaat attgttaccg ttttgatgac aacacttatt
ttattagcat ttatattctc 1320 agcttatcgt gcttggcaaa tgcgccatgg
tcaaattctt ttgcgtagat caaaacggat 1380 tgctgtattg agttggttat
cattatgtat atgtatcgct ttagcgctca tattatatgc 1440 attaccatat
ctcattctcg gtagcaataa ttggtctttt gtactgactt ggctaccaat 1500
agaaattaaa ttagcactaa tcacaacatt aattgcatta ttcagtacat taattgtaat
1560 tctgttattc cttcatacaa agataacgaa gacataataa aaaagacttg
ttcgagccgt 1620 gcgtttgata atatatcatc cacgatt 1647 10 498 PRT
Staphylococcus aureus 10 Met Thr Thr Lys Lys Leu Tyr Phe Leu Ser
Ile Ser Ile Ile Ile Leu 1 5 10 15 Val Ala Ile Ser Ile Ala Ile Tyr
Ile Thr Leu Asn Ser Asn Thr Lys 20 25 30 Thr Arg Leu Thr Asn Asp
Ser Gln Gln Gln Ile Asp Thr Ile Ile Glu 35 40 45 His Asp Leu Gln
Lys Gly His Ile Pro Gly Ala Ser Ile Leu Ile Val 50 55 60 Lys Asn
Gly Lys Val Phe Leu Asn Lys Gly Tyr Gly Tyr Gln Asp Val 65 70 75 80
Asp Lys Lys Val Lys Ala Ser Pro Thr Thr Lys Tyr Glu Ile Ala Ser 85
90 95 Asn Thr Lys Ala Phe Thr Gly Leu Ala Ile Leu Lys Leu Ala Gln
Glu 100 105 110 Gly Arg Leu Asn Leu Asn Asp Ala Val Ser Lys His Val
Pro His Phe 115 120 125 Lys Met Asn Tyr Asn Gly Gln Asn Glu Thr Ile
Thr Ile Lys Gln Leu 130 135 140 Leu Ala Gln Thr Ser Gly Ile Pro Ser
Asp Ile Thr Ser Glu Asp Ser 145 150 155 160 Val Thr Ser Lys Asn Asn
Arg Leu Asn Asp Val Thr His Ala Ile Met 165 170 175 Gly Asp Glu Leu
His His Lys Pro Gly Glu Glu Phe Glu Tyr Ser Asn 180 185 190 Met Asn
Tyr Asp Leu Leu Gly Leu Ile Ile Gln Asn Val Thr Lys Gln 195 200 205
Ser Tyr Thr Lys Tyr Ile Thr Asn Ser Trp Leu Lys Pro Leu His Met 210
215 220 Thr His Thr Ser Phe Lys Gln Thr Asn Tyr Lys Ser Lys His Asp
Ala 225 230 235 240 Ile Gly Tyr Glu Leu Gln Gly Ser Thr Pro Val Val
Ser Lys Pro Glu 245 250 255 Phe Asn Leu Trp Asp Thr Pro Ser Ala Tyr
Met Met Thr Ser Thr Glu 260 265 270 Asp Leu Glu His Trp Ile Lys Phe
Gln Leu Asn Pro Pro Asp Lys Tyr 275 280 285 Lys Ser Leu Val Gln Gln
Ser His Lys Asn Leu Ser Ser Thr Ile Gly 290 295 300 Glu Pro Asn Ala
Asn Ala Tyr Ala Ser Gly Trp Phe Thr Asn Asn Asp 305 310 315 320 Glu
His Leu Val Phe His Ser Gly Thr Leu Asp Asn Phe Ser Ser Phe 325 330
335 Ile Leu Leu Asn Pro Lys Gln Asn Tyr Gly Ile Val Val Leu Ala Asn
340 345 350 Leu Asn Ser Glu Tyr Val Pro Lys Leu Val Glu His Leu Asn
Thr Gln 355 360 365 Ile Val Asn His Lys Arg Tyr Ser Thr Val Ala Ser
Met Leu Asn Gln 370 375 380 Tyr Lys Asp Gln Phe Asn Ile Val Thr Val
Leu Met Thr Thr Leu Ile 385 390 395 400 Leu Leu Ala Phe Ile Phe Ser
Ala Tyr Arg Ala Trp Gln Met Arg His 405 410 415 Gly Gln Ile Leu Leu
Arg Arg Ser Lys Arg Ile Ala Val Leu Ser Trp 420 425 430 Leu Ser Leu
Cys Ile Cys Ile Ala Leu Ala Leu Ile Leu Tyr Ala Leu 435 440 445 Pro
Tyr Leu Ile Leu Gly Ser Asn Asn Trp Ser Phe Val Leu Thr Trp 450 455
460 Leu Pro Ile Glu Ile Lys Leu Ala Leu Ile Thr Thr Leu Ile Ala Leu
465 470 475 480 Phe Ser Thr Leu Ile Val Ile Leu Leu Phe Leu His Thr
Lys Ile Thr 485 490 495 Lys Thr 11 2226 DNA Staphylococcus aureus
11 ctcttaaatg agaccgttat ttttttgtca aaaagataga aataatttct
aaattcatat 60 atgatttaaa gtgaaagact ttgaatagag gtaggtagtt
ttgttaaaaa gactaaaaga 120 aaaatcaaat gatgaaatcg ttcaaaatac
cattaacaag agaattaact ttatatttgg 180 tgtgattgta tttatttttg
cagtactagt actacgttta ggttatttac aaatcgcaca 240 aggctcacat
tataaacaaa ttataaaaaa tgatgaaaac attacagtga atgagtctgt 300
gccaagaggt cgtattttag acagaaatgg gaaagtttta gttgataatg cttctaaaat
360 ggctattaca tatactaggg gtcgaaaaac aacacaatcg gaaatgttgg
atacggctga 420 aaagttatca aagctaatca agatggatac taagaaaatt
acagaacgtg ataagaaaga 480 tttctggatt cagttgcatc ctaaaaaagc
aaaagcaatg atgacaaaag aacaagctat 540 gttagcagat ggaagtatta
aacaagatca atatgataaa caactgttat cgaaaatcgg 600 aaaatcacaa
ttagatgaat tgtcttctaa agatttacaa gttttagcta tttttcgaga 660
gatgaatgca ggaacagttt tagatccaca aatgataaaa aatgaagatg tcagtgaaaa
720 agagtatgca gcagtttctc agcaactttc caaattacca ggtgttaaca
cgtctatgga 780 ttgggataga aaatatccat atggcgatac tttaagaggt
atattcggag atgtatcgac 840 acctgctgaa ggtattccaa aagaattgac
agaacattac ttatccaaag gatattcacg 900 caatgatcgt gttggaaaat
cttacctaga atatcaatat gaagatgtat tgcgtggtaa 960 gaagaaagaa
atgaaataca caacggacaa atctggtaaa gttacatctt cagaagtgtt 1020
aaatcctggc gctcgcggtc aagatttgaa attaacgatc gatatagatc ttcaaaaaga
1080 agtagaagca ttattagata aacaaattaa gaagcttcgc agtcaaggtg
ccaaagatat 1140 ggataatgca atgatggttg tacaaaatcc taaaaatgga
gacattcttg cgcttgccgg 1200 aaagcagatt aataagagtg gtaaaatgac
tgattatgac attggtacgt ttacttctca 1260 atttgcggtt ggatcttctg
taaaaggtgg aacattatta gccggttatc agaataaagc 1320 tatcaaagtt
ggagaaacaa tggtcgatga accattacat ttccaaggtg gtttgacaaa 1380
acgatcatac ttcaataaaa acgggcatgt aactattaat gataagcaag ctttgatgca
1440 ttcatcaaac gtatatatgt ttaaaacagc attaaaatta gcgggagacc
cttattattc 1500 tggtatggct
ttaccttcag acataagttc acctgcccaa aagctaagaa gaggattaaa 1560
tcaagtaggc ttaggtgtga aaacagggat agatttacca aatgaaacaa gaggtcaaat
1620 cgaaccatta acaaataatc caggtaatta tctagattta tcaattggtc
aatatgatac 1680 ctatacacca ttacaattat cacaatatgt ttcaactata
gcgaatgatg gttatagaat 1740 acagccacac attggattaa cgattcatga
atcaactaat aaagatgagg ttggtccact 1800 caagaagaaa attaatggca
ctgtcttgaa caaggttaat aatactgaaa aggaaatcaa 1860 acaaattcaa
gaaggattca aaatggcatt taatgataaa gatggtactg gatatgttag 1920
ttttaaagat acagtagtac ctactgctgg taaaacgggt accgcagaag tgttccaaaa
1980 cggagagcca agagttaact ctacttatat aggatacgcg ccaattgatg
atccaaaatt 2040 agcgttttca attgtatata caaatcagcc tgtaccacca
ccatggttaa caggtggaga 2100 cttaggtaga gatgtaatta actactactt
taagcagtta ggtaaagatg ataaaaataa 2160 agacaaagac aaataaaatt
taacctgacg attgtgtagc gcatggttgt aaaattttaa 2220 ctttgc 2226 12 691
PRT Staphylococcus aureus 12 Leu Leu Lys Arg Leu Lys Glu Lys Ser
Asn Asp Glu Ile Val Gln Asn 1 5 10 15 Thr Ile Asn Lys Arg Ile Asn
Phe Ile Phe Gly Val Ile Val Phe Ile 20 25 30 Phe Ala Val Leu Val
Leu Arg Leu Gly Tyr Leu Gln Ile Ala Gln Gly 35 40 45 Ser His Tyr
Lys Gln Ile Ile Lys Asn Asp Glu Asn Ile Thr Val Asn 50 55 60 Glu
Ser Val Pro Arg Gly Arg Ile Leu Asp Arg Asn Gly Lys Val Leu 65 70
75 80 Val Asp Asn Ala Ser Lys Met Ala Ile Thr Tyr Thr Arg Gly Arg
Lys 85 90 95 Thr Thr Gln Ser Glu Met Leu Asp Thr Ala Glu Lys Leu
Ser Lys Leu 100 105 110 Ile Lys Met Asp Thr Lys Lys Ile Thr Glu Arg
Asp Lys Lys Asp Phe 115 120 125 Trp Ile Gln Leu His Pro Lys Lys Ala
Lys Ala Met Met Thr Lys Glu 130 135 140 Gln Ala Met Leu Ala Asp Gly
Ser Ile Lys Gln Asp Gln Tyr Asp Lys 145 150 155 160 Gln Leu Leu Ser
Lys Ile Gly Lys Ser Gln Leu Asp Glu Leu Ser Ser 165 170 175 Lys Asp
Leu Gln Val Leu Ala Ile Phe Arg Glu Met Asn Ala Gly Thr 180 185 190
Val Leu Asp Pro Gln Met Ile Lys Asn Glu Asp Val Ser Glu Lys Glu 195
200 205 Tyr Ala Ala Val Ser Gln Gln Leu Ser Lys Leu Pro Gly Val Asn
Thr 210 215 220 Ser Met Asp Trp Asp Arg Lys Tyr Pro Tyr Gly Asp Thr
Leu Arg Gly 225 230 235 240 Ile Phe Gly Asp Val Ser Thr Pro Ala Glu
Gly Ile Pro Lys Glu Leu 245 250 255 Thr Glu His Tyr Leu Ser Lys Gly
Tyr Ser Arg Asn Asp Arg Val Gly 260 265 270 Lys Ser Tyr Leu Glu Tyr
Gln Tyr Glu Asp Val Leu Arg Gly Lys Lys 275 280 285 Lys Glu Met Lys
Tyr Thr Thr Asp Lys Ser Gly Lys Val Thr Ser Ser 290 295 300 Glu Val
Leu Asn Pro Gly Ala Arg Gly Gln Asp Leu Lys Leu Thr Ile 305 310 315
320 Asp Ile Asp Leu Gln Lys Glu Val Glu Ala Leu Leu Asp Lys Gln Ile
325 330 335 Lys Lys Leu Arg Ser Gln Gly Ala Lys Asp Met Asp Asn Ala
Met Met 340 345 350 Val Val Gln Asn Pro Lys Asn Gly Asp Ile Leu Ala
Leu Ala Gly Lys 355 360 365 Gln Ile Asn Lys Ser Gly Lys Met Thr Asp
Tyr Asp Ile Gly Thr Phe 370 375 380 Thr Ser Gln Phe Ala Val Gly Ser
Ser Val Lys Gly Gly Thr Leu Leu 385 390 395 400 Ala Gly Tyr Gln Asn
Lys Ala Ile Lys Val Gly Glu Thr Met Val Asp 405 410 415 Glu Pro Leu
His Phe Gln Gly Gly Leu Thr Lys Arg Ser Tyr Phe Asn 420 425 430 Lys
Asn Gly His Val Thr Ile Asn Asp Lys Gln Ala Leu Met His Ser 435 440
445 Ser Asn Val Tyr Met Phe Lys Thr Ala Leu Lys Leu Ala Gly Asp Pro
450 455 460 Tyr Tyr Ser Gly Met Ala Leu Pro Ser Asp Ile Ser Ser Pro
Ala Gln 465 470 475 480 Lys Leu Arg Arg Gly Leu Asn Gln Val Gly Leu
Gly Val Lys Thr Gly 485 490 495 Ile Asp Leu Pro Asn Glu Thr Arg Gly
Gln Ile Glu Pro Leu Thr Asn 500 505 510 Asn Pro Gly Asn Tyr Leu Asp
Leu Ser Ile Gly Gln Tyr Asp Thr Tyr 515 520 525 Thr Pro Leu Gln Leu
Ser Gln Tyr Val Ser Thr Ile Ala Asn Asp Gly 530 535 540 Tyr Arg Ile
Gln Pro His Ile Gly Leu Thr Ile His Glu Ser Thr Asn 545 550 555 560
Lys Asp Glu Val Gly Pro Leu Lys Lys Lys Ile Asn Gly Thr Val Leu 565
570 575 Asn Lys Val Asn Asn Thr Glu Lys Glu Ile Lys Gln Ile Gln Glu
Gly 580 585 590 Phe Lys Met Ala Phe Asn Asp Lys Asp Gly Thr Gly Tyr
Val Ser Phe 595 600 605 Lys Asp Thr Val Val Pro Thr Ala Gly Lys Thr
Gly Thr Ala Glu Val 610 615 620 Phe Gln Asn Gly Glu Pro Arg Val Asn
Ser Thr Tyr Ile Gly Tyr Ala 625 630 635 640 Pro Ile Asp Asp Pro Lys
Leu Ala Phe Ser Ile Val Tyr Thr Asn Gln 645 650 655 Pro Val Pro Pro
Pro Trp Leu Thr Gly Gly Asp Leu Gly Arg Asp Val 660 665 670 Ile Asn
Tyr Tyr Phe Lys Gln Leu Gly Lys Asp Asp Lys Asn Lys Asp 675 680 685
Lys Asp Lys 690 13 1056 DNA Staphylococcus aureus 13 tcctattcct
tatgcatttc ccctaattat aattaacgtt aaaataaaag tcaaattgcc 60
ttaaatatgg tatactataa cgtaatttag gaggttaaag atgacgaatc aagacaacaa
120 tcatcaattg aatcatcgta tatatcattt tgaaaagata tataaagcta
tcaaacatgt 180 cattgtttac atatttatga ttttcattgc catcgttgct
atcgctgtga ttgcgatgtc 240 tttatatttt catcatttaa ctaaaacgtc
cgactcatta tcagatgatg ctttaataaa 300 aaaagttcga caaatacctg
gcgatgaatt attagatcat aataacaaaa atttattata 360 tgagtataac
cattctcaaa actcactcat tataggccct aaaacatcaa gtccaaatgt 420
cattaaagca ttaacgtcat ctgaagacac tttattttat aaacatgatg gcatcttacc
480 aaaggcgatt ttaagagcaa tgatacaaga tatttttaat actgatcaaa
gttcaggtgg 540 tagcacaatt acacaacaac ttgttaaaaa tcaagttctt
accaacgaaa aaacatatag 600 tagaaaagca aatgaacttc gcctagcaat
tagattagaa cacctactct caaaagatga 660 aattatatat acatatttaa
atatagttcc cttcggtaga gattataatg gcgctaatat 720 ttccggaatt
gcatccgctt catatagtct atttggtatt ccaccaaaag atttatcaat 780
tgcacaatct gcatacctta tcggtttgtt gcaaagccca tatggctata caccctacga
840 aaaagatgga acgttaaaat cggataaaga tttgaaatat agtattcaaa
gacaacatta 900 tgtattaaag cgtatgttaa tcgaagatca aatcactgaa
aaagaataca acgacgcatt 960 aaaatatgat attaaatcac atttgttaaa
tcgaaaaaag cgttaattga tgctcacttt 1020 ttaaagtaac cacaacaatg
aatccaaata ttaaaa 1056 14 301 PRT Staphylococcus aureus 14 Met Thr
Asn Gln Asp Asn Asn His Gln Leu Asn His Arg Ile Tyr His 1 5 10 15
Phe Glu Lys Ile Tyr Lys Ala Ile Lys His Val Ile Val Tyr Ile Phe 20
25 30 Met Ile Phe Ile Ala Ile Val Ala Ile Ala Val Ile Ala Met Ser
Leu 35 40 45 Tyr Phe His His Leu Thr Lys Thr Ser Asp Ser Leu Ser
Asp Asp Ala 50 55 60 Leu Ile Lys Lys Val Arg Gln Ile Pro Gly Asp
Glu Leu Leu Asp His 65 70 75 80 Asn Asn Lys Asn Leu Leu Tyr Glu Tyr
Asn His Ser Gln Asn Ser Leu 85 90 95 Ile Ile Gly Pro Lys Thr Ser
Ser Pro Asn Val Ile Lys Ala Leu Thr 100 105 110 Ser Ser Glu Asp Thr
Leu Phe Tyr Lys His Asp Gly Ile Leu Pro Lys 115 120 125 Ala Ile Leu
Arg Ala Met Ile Gln Asp Ile Phe Asn Thr Asp Gln Ser 130 135 140 Ser
Gly Gly Ser Thr Ile Thr Gln Gln Leu Val Lys Asn Gln Val Leu 145 150
155 160 Thr Asn Glu Lys Thr Tyr Ser Arg Lys Ala Asn Glu Leu Arg Leu
Ala 165 170 175 Ile Arg Leu Glu His Leu Leu Ser Lys Asp Glu Ile Ile
Tyr Thr Tyr 180 185 190 Leu Asn Ile Val Pro Phe Gly Arg Asp Tyr Asn
Gly Ala Asn Ile Ser 195 200 205 Gly Ile Ala Ser Ala Ser Tyr Ser Leu
Phe Gly Ile Pro Pro Lys Asp 210 215 220 Leu Ser Ile Ala Gln Ser Ala
Tyr Leu Ile Gly Leu Leu Gln Ser Pro 225 230 235 240 Tyr Gly Tyr Thr
Pro Tyr Glu Lys Asp Gly Thr Leu Lys Ser Asp Lys 245 250 255 Asp Leu
Lys Tyr Ser Ile Gln Arg Gln His Tyr Val Leu Lys Arg Met 260 265 270
Leu Ile Glu Asp Gln Ile Thr Glu Lys Glu Tyr Asn Asp Ala Leu Lys 275
280 285 Tyr Asp Ile Lys Ser His Leu Leu Asn Arg Lys Lys Arg 290 295
300 15 999 DNA Staphylococcus aureus 15 tagtcaatga ataaagtaat
taaaatgctt gttgttacgc ttgctttcct acttgtttta 60 gcaggatgta
gtgggaattc aaataaacaa tcatctgata acaaagataa ggaaacaact 120
tcaattaaac atgcaatggg tacaactgaa attaaaggga aaccaaagcg tgttgttacg
180 ctatatcaag gtgccactga cgtcgctgta tctttaggtg ttaaacctgt
aggtgctgta 240 gaatcatgga cacaaaaacc gaaattcgaa tacataaaaa
atgatttaaa agatactaag 300 attgtaggtc aagaacctgc acctaactta
gaggaaatct ctaaattaaa accggactta 360 attgtcgcgt caaaagttag
aaatgaaaaa gtttacgatc aattatctaa aatcgcacca 420 acagtttcta
ctgatacagt tttcaaattc aaagatacaa ctaagttaat ggggaaagct 480
ttagggaaag aaaaagaagc tgaagattta cttaaaaagt acgatgataa agtagctgca
540 ttccaaaaag atgcaaaagc aaagtataaa gatgcatggc cattgaaagc
ttcagttgtt 600 aacttccgtg ctgatcatac aagaatttat gctggtggat
atgctggtga aatcttaaat 660 gatttaggat tcaaacgtaa taaagactta
caaaaacaag ttgataatgg taaagatatt 720 atccaactta catctaaaga
aagcattcca ttaatgaacg ctgatcatat ttttgtagta 780 aaatcagatc
caaatgcgaa agatgctgca ttagttaaaa agactgaaag cgaatggact 840
tcaagtaaag agtggaaaaa tttagacgca gttaaaaaca accaagtatc tgatgattta
900 gatgaaatca cttggaactt agctggcgga tataaatctt cattaaaact
tattgacgat 960 ttatatgaaa agttaaatat tgaaaaacaa tcaaaataa 999 16
330 PRT Staphylococcus aureus 16 Met Asn Lys Val Ile Lys Met Leu
Val Val Thr Leu Ala Phe Leu Leu 1 5 10 15 Val Leu Ala Gly Cys Ser
Gly Asn Ser Asn Lys Gln Ser Ser Asp Asn 20 25 30 Lys Asp Lys Glu
Thr Thr Ser Ile Lys His Ala Met Gly Thr Thr Glu 35 40 45 Ile Lys
Gly Lys Pro Lys Arg Val Val Thr Leu Tyr Gln Gly Ala Thr 50 55 60
Asp Val Ala Val Ser Leu Gly Val Lys Pro Val Gly Ala Val Glu Ser 65
70 75 80 Trp Thr Gln Lys Pro Lys Phe Glu Tyr Ile Lys Asn Asp Leu
Lys Asp 85 90 95 Thr Lys Ile Val Gly Gln Glu Pro Ala Pro Asn Leu
Glu Glu Ile Ser 100 105 110 Lys Leu Lys Pro Asp Leu Ile Val Ala Ser
Lys Val Arg Asn Glu Lys 115 120 125 Val Tyr Asp Gln Leu Ser Lys Ile
Ala Pro Thr Val Ser Thr Asp Thr 130 135 140 Val Phe Lys Phe Lys Asp
Thr Thr Lys Leu Met Gly Lys Ala Leu Gly 145 150 155 160 Lys Glu Lys
Glu Ala Glu Asp Leu Leu Lys Lys Tyr Asp Asp Lys Val 165 170 175 Ala
Ala Phe Gln Lys Asp Ala Lys Ala Lys Tyr Lys Asp Ala Trp Pro 180 185
190 Leu Lys Ala Ser Val Val Asn Phe Arg Ala Asp His Thr Arg Ile Tyr
195 200 205 Ala Gly Gly Tyr Ala Gly Glu Ile Leu Asn Asp Leu Gly Phe
Lys Arg 210 215 220 Asn Lys Asp Leu Gln Lys Gln Val Asp Asn Gly Lys
Asp Ile Ile Gln 225 230 235 240 Leu Thr Ser Lys Glu Ser Ile Pro Leu
Met Asn Ala Asp His Ile Phe 245 250 255 Val Val Lys Ser Asp Pro Asn
Ala Lys Asp Ala Ala Leu Val Lys Lys 260 265 270 Thr Glu Ser Glu Trp
Thr Ser Ser Lys Glu Trp Lys Asn Leu Asp Ala 275 280 285 Val Lys Asn
Asn Gln Val Ser Asp Asp Leu Asp Glu Ile Thr Trp Asn 290 295 300 Leu
Ala Gly Gly Tyr Lys Ser Ser Leu Lys Leu Ile Asp Asp Leu Tyr 305 310
315 320 Glu Lys Leu Asn Ile Glu Lys Gln Ser Lys 325 330 17 1014 DNA
Staphylococcus aureus 17 taattaagga gttttacgat gctacttaaa
ccaaaatacc aaatcgttat tgctggttta 60 tgtcttgcaa tagtagctat
cttaagttta atgattggaa atacgcttgt gtcaccaggt 120 acggtgatac
aggcgttatt caactttgat agtgaaaacg atttacatga tgttgtcact 180
ggtgcacggg cgtcgagaac aatcattgcg ttattgactg gtgctgccct tgctgtctca
240 ggtttgttga tgcaagcact tacacgaaac ccaatagcct caccagggct
tttcggtgtc 300 aatgcaggcg cagtattttt tgtcattttt agtattacat
ttatccaaat tcaatctttt 360 aaaatgattg tagttattgc atttttgggg
gctattgttg ttactgtatt agttgttgca 420 ctaggtatgt ttagacaaac
actattctca cctcaccgtg tcattttggc aggtgctgcg 480 attgcgatgc
tatttacagc ctttactcaa ggcatactta ttatgaacga aacagactta 540
caaggcctat tattttggtt aagtggctcc gtttcattac gtaatatttg ggatatccca
600 tggattattc cgcttgtatt gatacttatt ttaattgcat ttagcatggc
tgcacacatc 660 aacatcttga tgacaagtga cgacattgca accggcctcg
gtcaaaacat aaaattaatc 720 aaatggatga ttattatgct catcagtatg
ttagccggta tttcggtagc cgtagctgga 780 tcaatcgtct ttgtgggtct
tatcgtaccg aatattagca aacgattatt accaccaaac 840 tataagtatt
taattccttt tactgcatta gctggagcaa tcctaatgat catttcagac 900
attgttgctc gtataataat taagccacta gagttgccta tcggtgtcgt taccgctgtc
960 attggcgcta ttgtcttaat ctatattatg aagaaaggac gtcaacgctt atga
1014 18 331 PRT Staphylococcus aureus 18 Met Leu Leu Lys Pro Lys
Tyr Gln Ile Val Ile Ala Gly Leu Cys Leu 1 5 10 15 Ala Ile Val Ala
Ile Leu Ser Leu Met Ile Gly Asn Thr Leu Val Ser 20 25 30 Pro Gly
Thr Val Ile Gln Ala Leu Phe Asn Phe Asp Ser Glu Asn Asp 35 40 45
Leu His Asp Val Val Thr Gly Ala Arg Ala Ser Arg Thr Ile Ile Ala 50
55 60 Leu Leu Thr Gly Ala Ala Leu Ala Val Ser Gly Leu Leu Met Gln
Ala 65 70 75 80 Leu Thr Arg Asn Pro Ile Ala Ser Pro Gly Leu Phe Gly
Val Asn Ala 85 90 95 Gly Ala Val Phe Phe Val Ile Phe Ser Ile Thr
Phe Ile Gln Ile Gln 100 105 110 Ser Phe Lys Met Ile Val Val Ile Ala
Phe Leu Gly Ala Ile Val Val 115 120 125 Thr Val Leu Val Val Ala Leu
Gly Met Phe Arg Gln Thr Leu Phe Ser 130 135 140 Pro His Arg Val Ile
Leu Ala Gly Ala Ala Ile Ala Met Leu Phe Thr 145 150 155 160 Ala Phe
Thr Gln Gly Ile Leu Ile Met Asn Glu Thr Asp Leu Gln Gly 165 170 175
Leu Leu Phe Trp Leu Ser Gly Ser Val Ser Leu Arg Asn Ile Trp Asp 180
185 190 Ile Pro Trp Ile Ile Pro Leu Val Leu Ile Leu Ile Leu Ile Ala
Phe 195 200 205 Ser Met Ala Ala His Ile Asn Ile Leu Met Thr Ser Asp
Asp Ile Ala 210 215 220 Thr Gly Leu Gly Gln Asn Ile Lys Leu Ile Lys
Trp Met Ile Ile Met 225 230 235 240 Leu Ile Ser Met Leu Ala Gly Ile
Ser Val Ala Val Ala Gly Ser Ile 245 250 255 Val Phe Val Gly Leu Ile
Val Pro Asn Ile Ser Lys Arg Leu Leu Pro 260 265 270 Pro Asn Tyr Lys
Tyr Leu Ile Pro Phe Thr Ala Leu Ala Gly Ala Ile 275 280 285 Leu Met
Ile Ile Ser Asp Ile Val Ala Arg Ile Ile Ile Lys Pro Leu 290 295 300
Glu Leu Pro Ile Gly Val Val Thr Ala Val Ile Gly Ala Ile Val Leu 305
310 315 320 Ile Tyr Ile Met Lys Lys Gly Arg Gln Arg Leu 325 330 19
1089 DNA Staphylococcus aureus 19 taagccacta gagttgccta tcggtgtcgt
taccgctgtc attggcgcta ttgtcttaat 60 ctatattatg aagaaaggac
gtcaacgctt atgaccgaaa agattaataa aaaagacaat 120 taccatctca
tcttcgcgtt aatcttttta gccatcgttt cagtggtaag tatgatgatt 180
ggttcaagct ttataccatt acaacgcgta ctgatgtact ttataaatcc aaatgacagt
240 atggatcaat tcactttaga agtattacgc ttacctcgca ttacacttgc
gattttagca 300 ggtgccgcac taggaatgag tggtttaatg ttgcaaaatg
tattaaaaaa tccaattgcc 360 tcacctgata ttatcggtat cacaggtggt
gctagcttaa gtgctgttgt ctttattgca 420 tttttcagcc atttaacaat
acatttactt ccactatttg cagtattagg tggcgcagtt 480 gcaatgatga
tactattagt gtttcaaacg aaaggacaaa tacgcccgac aacactcata 540
atcatcggta tttcgatgca aacgttgttt attgcgcttg tccaaggatt actcattaca
600 acgaagcaat tatctgctgc caaagcttat acatggctag tcggaagtct
ttacggtgct 660 acgtttaaag atacaatcat tttgggtatg gttattttag
ctgttgtgcc gttgttattt 720 cttgttatac
caaaaatgaa aatatctata cttgatgacc ctgtagcgat tggcttaggc 780
ttacatgtac aacgtatgaa actaatccaa ttaatcactt ctactatact cgtatctatg
840 gcaatcagtt tagtaggtaa cattgggttt gtcggtttaa tcgcaccaca
tatcgcgaaa 900 acaatcgttc gcggaagtta tgctaaaaag ttactaatgt
cagcaatgat tggtgccata 960 tcaattgtta ttgcagactt aattgggcgt
accttattct tgcctaaaga agtgccagca 1020 ggtgtattta ttgctgcttt
tggtgcccca ttcttcatat acttattatt aaccgtgaaa 1080 aagttataa 1089 20
332 PRT Staphylococcus aureus 20 Met Thr Glu Lys Ile Asn Lys Lys
Asp Asn Tyr His Leu Ile Phe Ala 1 5 10 15 Leu Ile Phe Leu Ala Ile
Val Ser Val Val Ser Met Met Ile Gly Ser 20 25 30 Ser Phe Ile Pro
Leu Gln Arg Val Leu Met Tyr Phe Ile Asn Pro Asn 35 40 45 Asp Ser
Met Asp Gln Phe Thr Leu Glu Val Leu Arg Leu Pro Arg Ile 50 55 60
Thr Leu Ala Ile Leu Ala Gly Ala Ala Leu Gly Met Ser Gly Leu Met 65
70 75 80 Leu Gln Asn Val Leu Lys Asn Pro Ile Ala Ser Pro Asp Ile
Ile Gly 85 90 95 Ile Thr Gly Gly Ala Ser Leu Ser Ala Val Val Phe
Ile Ala Phe Phe 100 105 110 Ser His Leu Thr Ile His Leu Leu Pro Leu
Phe Ala Val Leu Gly Gly 115 120 125 Ala Val Ala Met Met Ile Leu Leu
Val Phe Gln Thr Lys Gly Gln Ile 130 135 140 Arg Pro Thr Thr Leu Ile
Ile Ile Gly Ile Ser Met Gln Thr Leu Phe 145 150 155 160 Ile Ala Leu
Val Gln Gly Leu Leu Ile Thr Thr Lys Gln Leu Ser Ala 165 170 175 Ala
Lys Ala Tyr Thr Trp Leu Val Gly Ser Leu Tyr Gly Ala Thr Phe 180 185
190 Lys Asp Thr Ile Ile Leu Gly Met Val Ile Leu Ala Val Val Pro Leu
195 200 205 Leu Phe Leu Val Ile Pro Lys Met Lys Ile Ser Ile Leu Asp
Asp Pro 210 215 220 Val Ala Ile Gly Leu Gly Leu His Val Gln Arg Met
Lys Leu Ile Gln 225 230 235 240 Leu Ile Thr Ser Thr Ile Leu Val Ser
Met Ala Ile Ser Leu Val Gly 245 250 255 Asn Ile Gly Phe Val Gly Leu
Ile Ala Pro His Ile Ala Lys Thr Ile 260 265 270 Val Arg Gly Ser Tyr
Ala Lys Lys Leu Leu Met Ser Ala Met Ile Gly 275 280 285 Ala Ile Ser
Ile Val Ile Ala Asp Leu Ile Gly Arg Thr Leu Phe Leu 290 295 300 Pro
Lys Glu Val Pro Ala Gly Val Phe Ile Ala Ala Phe Gly Ala Pro 305 310
315 320 Phe Phe Ile Tyr Leu Leu Leu Thr Val Lys Lys Leu 325 330 21
1460 DNA Staphylococcus aureus 21 taatgacact tattttttga aaataatagt
aatatcattt tgttaaatga aagaataaag 60 ctataataat tatagaataa
ctatttaaag gagattataa acatgccaat tattacagat 120 gtttacgctc
gcgaagtctt agactctcgt ggtaacccaa ctgttgaagt agaagtatta 180
actgaaagtg gcgcatttgg tcgtgcatta gtaccatcag gtgcttcaac tggtgaacac
240 gaagctgttg aattacgtga tggagacaaa tcacgttatt taggtaaagg
tgttactaaa 300 gcagttgaaa acgttaatga aatcatcgca ccagaaatta
ttgaaggtga attttcagta 360 ttagatcaag tatctattga taaaatgatg
atcgcattag acggtactcc aaacaaaggt 420 aaattaggtg caaatgctat
tttaggtgta tctatcgcag tagcacgtgc agcagctgac 480 ttattaggtc
aaccacttta caaatattta ggtggattta atggtaagca gttaccagta 540
ccaatgatga acatcgttaa tggtggttct cactcagatg ctccaattgc attccaagaa
600 ttcatgattt tacctgtagg tgctacaacg ttcaaagaat cattacgttg
gggtactgaa 660 attttccaca acttaaaatc aattttaagc caacgtggtt
tagaaactgc cgtaggtgac 720 gaaggtggtt tcgctcctaa atttgaaggt
actgaagatg ctgttgaaac aattatccaa 780 gcaatcgaag cagctggtta
caaaccaggt gaagaagtat tcttaggatt tgactgtgca 840 tcatcagaat
tctatgaaaa tggtgtatat gactacagta agttcgaagg cgaacacggt 900
gcaaaacgta cagctgcaga acaagttgac tacttagaac aattagtaga caaatatcct
960 atcattacaa ttgaagacgg tatggacgaa aacgactggg atggttggaa
acaacttaca 1020 gaacgtatcg gtgaccgtgt acaattagta ggtgacgatt
tattcgtaac aaacactgaa 1080 attttagcaa aaggtattga aaacggaatt
ggtaactcaa tcttaattaa agttaaccaa 1140 atcggtacat taactgaaac
atttgatgca atcgaaatgg ctcaaaaagc tggttacaca 1200 gcagtagttt
ctcaccgttc aggtgaaaca gaagatacaa caattgctga tattgctgtt 1260
gctacaaacg ctggtcaaat taaaactggt tcattatcac gtactgaccg tattgctaaa
1320 tacaatcaat tattacgtat cgaagatgaa ttatttgaaa ctgctaaata
tgacggtatc 1380 aaatcattct ataacttaga taaataattt tctttataat
caaatgctga cataatttta 1440 gttgaggatt attatgacgg 1460 22 434 PRT
Staphylococcus aureus 22 Met Pro Ile Ile Thr Asp Val Tyr Ala Arg
Glu Val Leu Asp Ser Arg 1 5 10 15 Gly Asn Pro Thr Val Glu Val Glu
Val Leu Thr Glu Ser Gly Ala Phe 20 25 30 Gly Arg Ala Leu Val Pro
Ser Gly Ala Ser Thr Gly Glu His Glu Ala 35 40 45 Val Glu Leu Arg
Asp Gly Asp Lys Ser Arg Tyr Leu Gly Lys Gly Val 50 55 60 Thr Lys
Ala Val Glu Asn Val Asn Glu Ile Ile Ala Pro Glu Ile Ile 65 70 75 80
Glu Gly Glu Phe Ser Val Leu Asp Gln Val Ser Ile Asp Lys Met Met 85
90 95 Ile Ala Leu Asp Gly Thr Pro Asn Lys Gly Lys Leu Gly Ala Asn
Ala 100 105 110 Ile Leu Gly Val Ser Ile Ala Val Ala Arg Ala Ala Ala
Asp Leu Leu 115 120 125 Gly Gln Pro Leu Tyr Lys Tyr Leu Gly Gly Phe
Asn Gly Lys Gln Leu 130 135 140 Pro Val Pro Met Met Asn Ile Val Asn
Gly Gly Ser His Ser Asp Ala 145 150 155 160 Pro Ile Ala Phe Gln Glu
Phe Met Ile Leu Pro Val Gly Ala Thr Thr 165 170 175 Phe Lys Glu Ser
Leu Arg Trp Gly Thr Glu Ile Phe His Asn Leu Lys 180 185 190 Ser Ile
Leu Ser Gln Arg Gly Leu Glu Thr Ala Val Gly Asp Glu Gly 195 200 205
Gly Phe Ala Pro Lys Phe Glu Gly Thr Glu Asp Ala Val Glu Thr Ile 210
215 220 Ile Gln Ala Ile Glu Ala Ala Gly Tyr Lys Pro Gly Glu Glu Val
Phe 225 230 235 240 Leu Gly Phe Asp Cys Ala Ser Ser Glu Phe Tyr Glu
Asn Gly Val Tyr 245 250 255 Asp Tyr Ser Lys Phe Glu Gly Glu His Gly
Ala Lys Arg Thr Ala Ala 260 265 270 Glu Gln Val Asp Tyr Leu Glu Gln
Leu Val Asp Lys Tyr Pro Ile Ile 275 280 285 Thr Ile Glu Asp Gly Met
Asp Glu Asn Asp Trp Asp Gly Trp Lys Gln 290 295 300 Leu Thr Glu Arg
Ile Gly Asp Arg Val Gln Leu Val Gly Asp Asp Leu 305 310 315 320 Phe
Val Thr Asn Thr Glu Ile Leu Ala Lys Gly Ile Glu Asn Gly Ile 325 330
335 Gly Asn Ser Ile Leu Ile Lys Val Asn Gln Ile Gly Thr Leu Thr Glu
340 345 350 Thr Phe Asp Ala Ile Glu Met Ala Gln Lys Ala Gly Tyr Thr
Ala Val 355 360 365 Val Ser His Arg Ser Gly Glu Thr Glu Asp Thr Thr
Ile Ala Asp Ile 370 375 380 Ala Val Ala Thr Asn Ala Gly Gln Ile Lys
Thr Gly Ser Leu Ser Arg 385 390 395 400 Thr Asp Arg Ile Ala Lys Tyr
Asn Gln Leu Leu Arg Ile Glu Asp Glu 405 410 415 Leu Phe Glu Thr Ala
Lys Tyr Asp Gly Ile Lys Ser Phe Tyr Asn Leu 420 425 430 Asp Lys
* * * * *