U.S. patent application number 10/239211 was filed with the patent office on 2005-01-27 for peptides blocking vascular endothelial growth factor(vegf)-mediated angiogenesis, polynucleotides encoding said pepetides and methods of use thereof.
Invention is credited to Demangel, Caroline, Derbin, Claude, Mazie, Jean-Claude, Perret, Gerard, Plouet, Jean, Tournaire, Roselyne, Vassy, Roger.
Application Number | 20050019826 10/239211 |
Document ID | / |
Family ID | 22713467 |
Filed Date | 2005-01-27 |
United States Patent
Application |
20050019826 |
Kind Code |
A1 |
Tournaire, Roselyne ; et
al. |
January 27, 2005 |
Peptides blocking vascular endothelial growth factor(vegf)-mediated
angiogenesis, polynucleotides encoding said pepetides and methods
of use thereof
Abstract
The present invention provides peptides which can interact with
VEGF and inhibit VEGF interaction with KDR or anti-VEGF antibody
thereby inhibiting VEGF mediated angiogenesis or angiogeneis
related diseases, polynucleotide encoding the peptides, vectors
containing the polynucleotides, pharmaceutical compositions
containing the peptides, and methods of inhibiting angiogenesis
with the peptides.
Inventors: |
Tournaire, Roselyne; (La
Gaude, FR) ; Demangel, Caroline; (Paris, FR) ;
Derbin, Claude; (Gif-Sur-Yvette, FR) ; Perret,
Gerard; (Montmorency, FR) ; Mazie, Jean-Claude;
(Asnieres-Sur-Seine, FR) ; Plouet, Jean;
(Toulouse, FR) ; Vassy, Roger; (Pantin,
FR) |
Correspondence
Address: |
OBLON, SPIVAK, MCCLELLAND, MAIER & NEUSTADT, P.C.
1940 DUKE STREET
ALEXANDRIA
VA
22314
US
|
Family ID: |
22713467 |
Appl. No.: |
10/239211 |
Filed: |
June 12, 2003 |
PCT Filed: |
March 29, 2001 |
PCT NO: |
PCT/IB01/00577 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
60193396 |
Mar 31, 2000 |
|
|
|
Current U.S.
Class: |
435/7.1 ;
435/183; 435/252.3; 435/320.1; 435/325; 435/456; 435/69.1; 436/518;
506/18; 506/9; 514/13.3; 514/8.1; 530/350; 536/23.1 |
Current CPC
Class: |
A61P 35/00 20180101;
C07K 14/71 20130101; G01N 33/74 20130101; C07K 5/0815 20130101;
G01N 2333/475 20130101; C07K 7/06 20130101; C07K 14/52 20130101;
A61P 17/00 20180101; G01N 33/6845 20130101; A61P 3/10 20180101;
A61P 9/00 20180101; A61K 38/00 20130101; A61P 17/06 20180101; A61P
27/02 20180101 |
Class at
Publication: |
435/007.1 ;
435/069.1; 435/320.1; 435/183; 435/325; 435/456; 435/252.3;
436/518; 530/350; 536/023.1; 514/012 |
International
Class: |
G01N 033/53; A61K
038/17; C07K 014/47; C07H 021/04; G01N 033/543 |
Claims
1. A method of screening for peptide molecules capable interacting
with VEGF comprising: generating a random peptide library;
contacting said library to a ligand capable of binding VEGF;
selecting the molecules from said library which bind to said
ligand.
2. The method of claim 1, wherein said ligand is KDR.
3. The method of claim 2, wherein said ligand is expressed on a
membrane of a cell.
4. The method of claim 1, wherein said ligand is an anti-VEGF
antibody.
5. The method of claim 1, wherein random peptide library comprises
peptides of seven amino acids.
6. A purified peptide selected from the group consisting of SEQ ID
NO:8, SEQ ID NO:9, SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, SEQ ID
NO:13, SEQ ID NO: 14; wherein said peptide inhibits the binding of
VEGF to KDR.
7. The peptide of claim 6, wherein said peptide is SEQ ID
NO:11.
8. An isolated polynucleotide which encodes the peptide of claim
6.
9. A recombinant vector comprising the polynucleotide of claim
8.
10. The vector of claim 9, wherein said vector is selected from the
group consisting of a bacterial expression vector, a yeast
expression vector and a mammalian expression vector.
11. The vector of claim 10, wherein said mammalian expression
vector is a viral vector.
12. A prokaryotic cell comprising the isolated polynucleotide of
claim 8.
13. A eukaryotic cell comprising the isolated polynucleotide of
claim 8.
14. A pharmaceutical composition comprising the peptide of claim 6
and a pharmaceutically acceptable carrier.
15. A purified peptide selected from the group consisting of SEQ ID
NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID
NO:6, SEQ ID NO:7; wherein said peptide inhibits the binding of
anti-VEGF antibody to VEGF.
16. The peptide of claim 15, wherein said peptide is SEQ ID
NO:1.
17. An isolated polynucleotide which encodes the peptide of claim
15.
18. A recombinant vector comprising the polynucleotide of claim
17.
19. The vector of claim 18, wherein said vector is selected from
the group consisting of a bacterial expression vector, a yeast
expression vector and a mammalian expression vector.
20. The vector of claim 19, wherein said mammalian expression
vector is a viral vector.
21. A prokaryotic cell comprising the isolated polynucleotide of
claim 17.
22. A eukaryotic cell comprising the isolated polynucleotide of
claim 17.
23. A pharmaceutical composition comprising the peptide of claim 15
and a pharmaceutically acceptable carrier.
24. A purified peptide of the sequence ATWLPPR (SEQ ID NO:1).
25. The peptide of claim 24, wherein said peptide is capable of
interacting with VEGF.
26. The peptide of claim 24, wherein said peptide is capable of
inhibiting the interaction between VEGF and KDR.
27. The peptide of claim 24, wherein said peptide is capable of
inhibiting the proliferation of vascular endothelial cells mediated
by VEGF.
28. The peptide of claim 24, wherein said peptide is capable of
inhibiting angiogensis mediated by VEGF.
29. Peptide according to claim 24, for use in inhibiting
angiogenesis.
30. Peptide according to claim 24, for use in treating a disease
selected in the group consisting of cancer, diabetic retinopathy,
psoriasis, hemangioblastoma, and Kaposi's sarcoma.
31. An isolated polynucleotide encoding the peptide of claim
24.
32. A recombinant vector comprising the polynucleotide of claim
31.
33. The vector of claim 32, wherein said vector is selected from
the group consisting of a bacterial expression vector, a yeast
expression vector, and a mammalian expression vector.
34. The vector of claim 33, wherein said mammalian expression
vector is a viral vector.
35. A prokaryotic cell comprising the isolated polynucleotide of
claim 31.
36. A eukaryotic cell comprising the vector of claim 31.
37. A pharmaceutical composition comprising the peptide of claim 24
and a pharmaceutically acceptable carrier.
Description
[0001] Angiogenesis, the formation of blood vessels by sprouting
from pre-existing ones, is essential for the growth of solid tumors
beyond 2-3 mm in diameter and for tumor metastasis (Follman, 1995;
reviewed in Bouck et al., 1996). The generation of new capillaries
involves a multistep process, which includes the dissolution of the
membrane of the originating vessel, the endothelial cell migration
and proliferation, and formation of a new vascular tube (Cliff,
1963; Schoefl, 1963; Ausprunck and Folkman, 1977). Suppression of
any one of these steps would inhibit the formation of new vessels
and therefore affect tumor growth and generation of metastases.
Indeed, it has been estimated that the elimination of a single
endothelial cell could inhibit the growth of 100 tumor cells
(Thorpe et al., 1995). Moreover, endothelial cells are genetically
stable and therefore unlikely to mutate into drug-resistant
variants (Young, 1989; Kerbel, 1991; Boehm et al., 1997). Since
they line the inside of blood vessels, they are easily accessible
to circulating drugs. This feature suggests that anti-angiogenic
therapies targeting endothelial cells may provide a promising
mechanism for cancer treatment.
[0002] So far, several angiogenic factors have been identified
(reviewed in Folkman, 1995; Hanahan et al., 1996), including the
particularly potent Vascular Endothelial Growth Factor (VEGF), also
known as VPF or vasculotropin (reviewed in Ferrara, 1993; Ferrara
and Davis-Smyth, 1997). Unlike other angiogenic factors, VEGF acts
as an endothelial cell-specific mitogen during angiogenesis (Terman
et al., 1992 and Ferrara, 1993). Antibodies raised against VEGF
have been shown to suppress tumor growth in vivo (Kim et al.,
1993), indicating that VEGF antagonists could have therapeutic
applications as inhibitors of tumor-induced angiogenesis.
[0003] VEGF was purified initially from the conditioned media of
folliculostellate cells and from a variety of tumor cell lines
(Ferrara et al., 1989; Plout et al., 1989; Myoken et al., 1991). It
is a member of the cystine-knot family of growth factors, which
also includes PDGF (Platelet Derived Growth Factor). Recently, a
number of VEGF structural homologs have been identified: VEGF-B,
VEGF-C, VEGF-D and Placenta Growth Factor (PlGF) (Klagsbrun and
D'Amore, 1996; reviewed in Ferrara, 1999). The human gene encoding
VEGF is organized into eight exons, separated by seven introns.
Alternative splicing of mRNAs for the VEGF gene results in the
generation of five different molecular species, having 121,145,
165, 189, or 206 amino acid residues in the mature monomer (Tisher
et al., 1991; Houck et al., 1991). Only VEGF.sub.165, which lacks
the residues encoded by exon 6, is the mature and active form of
VEGF. It binds to heparin and cell surface heparan sulfate
proteoglycans, and can be expressed as a free or as a cell membrane
bound form (Houck et al., 1992). Two tyrosine kinase receptors have
been identified for which VEGF acts as a high affinity ligand: a
fms-like tyrosine kinase-1 (Flt-1 or VEGFR-1) and a kinase domain
receptor (KDR/Flk-1 or VEGFR-2) (Matthews et al., 1991; Terman et
al., 1991; De Vries et al., 1992; Millauer et al., 1993). Although
Flt-1 binds VEGF with 50-fold higher affinity than KDR (De Vries et
al., 1992), most of the VEGF angiogenic properties (mitogenicity,
chemotaxis, and induction on morphological changes) are mediated by
interaction with KDR (Waltenberger et al., 1994). Therefore, the
interaction between VEGF and KDR is the most appropriate to
interrupt in order to inhibit angiogenesis.
[0004] The screening of phage-displayed libraries is a powerful
technique for identifying peptides mimicking protein surfaces
(Smith, 1985; Hoess, 1993; Felici et al., 1995). Since each peptide
is physically linked to a genetic particle, clones specifically
binding a target molecule can be selected by consecutive cycles of
in vitro biopanning and in vivo amplification. New agonists and
antagonists for cell membrane receptors have been successfully
identified using this process (Cwirla et al., 1990; Cortese et al.,
1996), for example, RGD containing peptides that bind either the
GPIIb/IIIa receptor on platelets (O'Neil et al., 1992) or the 51
integrin (Koivunen et al., 1993). The selected peptides were able
to antagonize integrin-mediated cell adhesion.
[0005] The present inventors have identified peptides blocking the
binding of VEGF to KDR. A random peptide library displayed on
filamentous phages (Cortese et al., 1996) was screened using two
parallel strategies. In the first, the peptide repertoire was
screened with cells expressing recombinant KDR (Plouet et al.,
1997) and in the second, with a monoclonal antibody raised against
VEGF. Since this antibody blocked VEGF-dependent endothelial cell
proliferation, we postulated that its antigen binding site mimics
all or part of the VEGF interaction surface with KDR. Both
strategies led to the isolation of peptides that compete with VEGF
binding to KDR, including a peptide, ATWLPPR (SEQ ID NO:1), which
specifically inhibited human endothelial cell proliferation in
vitro. S Moreover, it totally abolished VEGF-induced angiogenesis
in vivo. ATWLPPR (SEQ ID NO:1), as a specific antagonist of
VEGF-KDR interaction, may represent an effective anti-tumor
agent.
[0006] Accordingly, it is one object of the present invention to
provide a method for screening for peptides capable of interacting
with VEGF.
[0007] It is another object of the present invention to provide
novel peptides which inhibit the interaction of VEGF and KDR.
[0008] It is another object of the present invention to provide
novel polynucleotide sequences which encode such peptides.
[0009] It is another object of this invention to provide vectors
which comprise the polynucleotides encoding such peptides.
[0010] It is another object of this invention to provide methods of
inhibiting angiogenesis and diseases affected by angiogenesis using
such peptides.
[0011] It is another object of this invention to provide
pharmaceutical compositions containing such peptides.
[0012] These and other objects, which will become apparent during
the following detailed description, have been achieved by the
inventors' discovery of the novel peptides disclosed herein.
[0013] FIG. 1. CHO-KDR cells express a functional KDR. (A)
Scatchard analysis of VEGF binding. The ratio of bound to free VEGF
molecules (B/F) was plotted against bound VEGF concentration. (B)
Effect of heparin. VEGF binding to CHO-KDR cells was measured in
the presence of various amounts of heparin (C) Effect of PlGF. VEGF
(100 ng/ml) binding to CHO-KDR cells was tested in absence (white
bars) or presence (black bars) of heparin (1.8 .mu.g/ml), and
compared to PlGF (50 ng/ml) or to PBS (control). Data correspond to
the mean and standard deviations of triplicate samples. All binding
experiments were performed twice and gave similar results.
[0014] FIG. 2. Selected phage-displayed peptides bind to KDR
specifically in ELISA. Clones selected by KDR binding (10.sup.13
pfu/ml) (A) or by anti-VEGF antibody binding (10.sup.12 pfu/ml) (B)
were compared with M13 phage particles (control). Results are
representative of three independent assays.
[0015] FIG. 3. The anti-VEGF antibody blocks CPAE cell growth. CPAE
cell growth was measured in cultures supplemented with various
concentrations of anti-VEGF antibody and compared with untreated
cultures. Data represent means and standard deviations of
proliferation inhibition for triplicate samples and are
representative of two independent experiments.
[0016] FIG. 4. Synthetic peptides compete with VEGF for KDR
binding. Peptides selected by KDR binding (A) or by anti-VEGF
binding (B) were tested in competition with VEGF for binding to
CHO-KDR cells at the concentration of 2,1.times.10.sup.-4 M and in
the presence of heparin (1.8 .mu.g/ml). Data represent the means
and standard deviations of triplicate samples. Similar results were
obtained in three independent experiments.
[0017] FIG. 5. V1 can abolish VEGF binding to KDR. Various
concentrations of VEGF (A) or of V1 peptide (B) were tested in
competition with radioactive-labelled VEGF for binding to CHO-KDR
cells. As a uninhibitory control, V5 was tested in the same
conditions. Data represent the mean and standard deviations of
triplicate samples. Similar results were obtained in two different
experiments.
[0018] FIG. 6. V1 inhibits CPAE cell proliferation. CPAE cell
growth was measured after 24h of incubation in presence of
synthetic peptides selected by antibody binding (A) or by KDR
binding (B) and compared with untreated cultures. Data represent
means and standard deviations of proliferation inhibition for
triplicates and are representative of three independent
experiments.
[0019] FIG. 7. V1 inhibits the proliferation of human endothelial
cells induced by VEGF or by AIA in a dose dependent manner. HUAE
cell cultures were grown in presence of VEGF (A) or anti-idiotypic
antibodies (B), and were supplemented daily with various
concentrations of V1 or V5. Cells were counted after 5 days. Data
are means of proliferation inhibition percentages for triplicate
samples.
[0020] FIG. 8. V1 acts specifically on endothelial cells. CPAE and
NIH 3T3 fibroblasts were cultured with or without V1 peptide, and
the changes in cell proliferation were measured after 24 h. Data
represent the means and standard deviations of proliferation
inhibition percentages for triplicate samples, and similar results
were obtained in two independent experiments.
[0021] FIG. 9. V1 inhibits corneal angiogenesis in vivo. The
neovascularization in implants containing V1, V5, or PBS (vehicle),
in the presence or absence of VEGF was assessed 12 days after
insertion in rabbit corneal pockets: A) a representative picture of
each implant group, B) angiogenic score means and standard errors
measured for eight implant groups.
[0022] FIG. 10. Displacement curves of .sup.125I-VEGF 165 binding
to CHO-KDR transfected cells by the V1 derivatives. The experiment
was performed by incubating cells (500,000 cell/well) during 3
hours at +4.degree. C. with .sup.125I-VEGF (Amersham Fr) at a final
concentration of 7 pM and increasing concentration of the different
peptides analogues (0 to 500 .mu.g/ml) in a final volume of 0.3 ml
in the presence of heparin (1 .mu.g/ml). The non specific binding
was established in the presence of VEGF 165 (R&D system UK) at
a final concentration of 3 nM.
[0023] FIG. 11. Comparison of the displacement curves of
.sup.125-VEGF165 binding to CHO-KDR transfected cells by the
peptides V1, A9, A10 and A7. Experimental conditions are indicated
in the legend of FIG. 10.
[0024] FIG. 12. Displacement curves of .sup.125I-VEGF 165 binding
to CHO-KDR transfected cells by the peptides A11 obtained by the
substitution of the 6 amino acids upstream to arginine by alanine.
Experimental conditions are indicated in the legend of FIG. 10.
[0025] FIG. 13. Effect of V1 (400 .mu.g/ml) VEGF165 induced HUVEC
proliferation. Various concentrations of VEGF165 were added during
96 hours.
[0026] FIG. 14. Effect of V1 on the binding of .sup.125I VEGF 165
to VEGF R2 (KDR)/Fc Chimera (R&D UK). The disulfide linked
homodimeric protein were immobilized on the surface of Immulon
polystyrene well (Dynatech VA). VEGF was incubated overnight at
+4.degree. C. After 3 washings, the bound radio activity was
measured.
[0027] FIGS. 15A and B (A) Displacement curves of .sup.125I-VEGF
165 binding to CHO-KDR transfected cells by VEGF165 at increasing
concentrations, in the presence of either saline (open circles) or
50 .mu.g/ml V1 (closed circles). (B) Scatchard representation.
Experimental conditions are indicated in the legend of FIG. 10.
[0028] FIGS. 16A and B (A & B) Scatchard representation of
.sup.125I-VEGF165 to control HUV-EC cells. (C) Scatchard
representation of .sup.125I-VEGF165 to HUV-EC cells in the presence
of V1 40 .mu.g/ml. Experimental conditions are indicated in the
legend of FIG. 10.
[0029] FIG. 17. Heparin effect on binding of .sup.125VEGF 165 to
transfected CHO cell in the presence of either saline (open
circles) or V1 peptide (closed circles) at a final concentration of
50 .mu.g/ml. Experimental conditions are indicated in the legend of
FIG. 10.
[0030] FIG. 18. Displacement curves of .sup.125I-VEGF 165 binding
to MDA MB cells by increasing concentrations of V1. Experimental
conditions are indicated in the legend of FIG. 10.
[0031] FIG. 19. Cross linking of .sup.125I VEGF165 (160 pM) to
HUV-EC cells. 1: Total binding. 2: Non specific binding (VEGF 4.5
nM). 3: V1, (2.4.times.10.sup.-4M). 4: V1,
(4.8.times.10.sup.-4M).
[0032] All patent applications, patents and publications cited in
this specification are hereby incorporated by reference in their
entirety. In the case of inconsistencies, the present disclosure,
including definitions, will prevail.
[0033] By peptides capable of interacting with VEGF, the invention
covers any peptide or chemical product capable of inducing or
modulating the activity of VEGF. For example, the activity of
inhibiting VEGF properties involved in angiogenesis.
[0034] As used herein, "inhibit", "inhibiting" or "inhibition
includes any measurable reproducible reduction in the interaction
of VEGF and KDR or anti-VEGF; angiogenesis; symptoms of diseases
correlated to angiogenesis; or any other activities VEGF may
mediate.
[0035] As used herein, an effective amount of a compound for
treating a disorder is an amount that is sufficient to ameliorate,
or in some manner reduce a symptom or stop or reverse progression
of a condition. Such amount may be administered as a single dosage
or may be administered according to a regimen, whereby it is
effective.
[0036] As used herein, treatment means any manner in which the
symptoms or pathology of a condition, disorder or disease are
ameliorated or otherwise beneficially altered. Treatment also
encompasses any pharmaceutical use of the compositions herein.
[0037] As used herein, amelioration of the symptoms of a particular
disorder by administration of a particular pharmaceutical
composition refers to any lessening, whether permanent or
temporary, lasting or transient that can be attributed to or
associated with administration of the composition.
[0038] "consisting essentially of", in relation to amino acid
sequence of a protein or peptide, is a term used hereinafter for
the purposes of the specification and claims to refer to a
conservative substitution or modification of one or more amino
acids in that sequence such that the tertiary configuration of the
protein or peptide is substantially unchanged. "Conservative
substitutions" is defined by aforementioned function, and includes
substitutions of amino acids having substantially the same charge,
size, hydrophilicity, and/or aromaticity as the amino acid
replaced. Such substitutions, known to those of ordinary skill in
the art, include glycine-alanine-valine; isoleucine-leucine;
tryptophan-tyrosine; aspartic acid-glutamic acid; arginine-lysine;
asparagine-glutamine; and serine-threonine. "Modification", in
relation to amino acid sequence of a protein or peptide, is defined
functionally as a deletion of one or more amino acids which does
not impart a change in the conformation, and hence the biological
activity, of the protein or peptide sequence.
[0039] Conventional amino acids are: alanine (A), cysteine (C),
aspartic acid (D), glutamic acid (E), phenylalanine (F), glycine
(G), histidine (H), isoleucine (I), lysine (K), leucine (L),
methionine (M), asparagine (N), proline (P), glutamine (Q),
arginine (R), serine (S), threonine (T), valine (V), tryptophan
(W), and tyrosine.
[0040] Additional amino acids that may be included in the peptide
of the present invention include: Nle=L-norleucine;
Aabu=aminobutyric acid; Hphe=L-homophenylalanine; Nva=L-norvaline;
Dala=D-alanine; Dcys=D-cysteine; Dasp=D-aspartic acid;
Dglu=D-glutamic acid; Dphe=D-phenylalanine; Dhis=D-histidine;
Dile=D-isoleucine; Dlys=D-lysine; Dleu=D-leucine;
Dmet=D-methionine; Dasn=D-asparagine; Dpro=D-proline;
Dgln=D-glutamine; Darg=D-arginine; Dser=D-serine; Dthr=D-threonine;
Dval=D-valine; Dtrp=D-tryptophan; Dtyr=D-tyrosine; Dorn=D-omithine;
Aib=aminoisobutyric acid; Etg=L-ethylglycine;
Thug=L-t-butylglycine; Pen=penicillamine; Anap=1-naphthylalanine;
Chexa=cyclohexylalanine; Cpen=cyclopentylalanine;
Cpro=aminocyclopropane carboxylate; Norb=aminonorbornylcarboxylate;
Mala=L-.alpha.-methylalanine; Mcys=L-.alpha.-methylcysteine;
Masp=L-.alpha.-methylaspartic acid; Mglu=L-.alpha.-methylglutarnic
acid; Mphe=L-.alpha.-methylphenylalanine; Mhis=L
.alpha.-methylhistidine; Mile=L-.alpha.-methylisoleucine;
Mlys=L-.alpha.-methyllysine; Mleu=L-.alpha.-methylleucine;
Mmet=L-.alpha.-methylmethionine; Masn=L-.alpha.-methylasparagine;
Mpro=L-.alpha.-methylproline; Mgln=L-.alpha.-methylglutamine;
Marg=L-.alpha.-methylarginine; Mser=L-a-methylserine;
Mthr=L-.alpha.-methylthreonine; Mval=L-a-methylvaline;
Mtrp=L-.alpha.-methyltryptophan; Mtyr=L-.alpha.-methyltyrosine;
Morn=L-.alpha.-methylomithine; Mnle=L-a-methylnorleucine;
amino-.alpha.-methylbutyric acid;. Mnva=L-a-methylnorvaiine;
Mhphe=L-.alpha.-methylhomophenylalanine;
Metg=L-a-methylethylglycine; methyl-.gamma.-aminobutyric acid;.
methylaminoisobutyric acid; Mtbug=L-.alpha.-methyl-t-butylglycine;
methyl-penicillamine; methyl-.alpha.-naphthylalanine;
methylcyclohexylalanine; methylcyclopentylalanine;
Dmala=D-.alpha.-methylalanine; Dmorn=D-.alpha.-methylornithine;
Dmcys=D-.alpha..-methylcysteine; Dmasp=D-.alpha.-methylaspartic
acid; Dmglu=D-.alpha.-methylglutamic acid;
Dmphe=D-.alpha.-methylphenylalanine;
Dmhis=D-.alpha.-methylhistidine; Dmile=D-.alpha.-methylisoleucine;
Dmlys=D-.alpha.-methyllysine; Dmleu=D-.alpha.-methylleucine;
Dmmet=D-.alpha.-methylmethionine; Dmasn=D-.alpha.-methylasparagine;
Dmpro=D-.alpha.-methylproline; Dmgln=D-.alpha.-methylglutamine;
Dmarg=D-.alpha.-methylarginine; Dmser=D-.alpha.-methylserine;
Dmthr=D-.alpha.-methylthreopine; Dmvai=D-.alpha.-methylvaline;
Dmtrp=D-.alpha.-methyltryptophan; Dmtyr=D-.alpha.-methyltyrosine;
Nmala=L-N-methylalanine; Nmcys=L-N-methylcysteine;
Nmasp=L-N-methylaspartic acid; Nmglu=L-N-methylglutamic acid;
Nmphe=L-N-methylphenylalanine; Nmhis=L-N-methylhistidine;
Nmile=L-N-methylisoleucine; Nmlys=L-N-methyllysine;
Nmleu=L-N-methylleucine; Nmmet=L-N-methylmethioni- ne;
Nmasn=L-N-methylasparagine; Nmchexa=N-methylcyclohexylalanine;
Nmgln=L-N-methylglutamine; Nmarg=L-N-methylarginine;
Nmser=L-N-methylserine; Nmthr=L-N-methylthreonine;
Nmval=L-N-methylvaline; Nmtrp=L-N-methyltryptophan;
Nmtyr=L-N-methyltyrosine; Nmorn=L-N-methylomithine;
Nmnle=L-N-methylnorleucine; Nmaabu=N-amino-.alpha.-methylbutyric
acid; Nmnva=L-N-methylnorvaline;
Nmhphe=L-N-methylhomophenylalanine; Nmetg=L-N-methylethylglycine;
Nmgabu=N-methyl-y-aminobutyric acid;
Nmcpen=N-methylcyclopentylalanine;
Nmtbug=L-N-methyl-t-butylglycine; Nmpen=N-methylpenicillarnine;
Nmanap=N-methyl-a-naphthylalanine; Nmaib=N-methylaminoisobutyric
acid; Naeg=N-(2-aminoethyl)glycine; Dnmala=D-N-methylalanine;
Dnmorn=D-N-methylomithine; Dnmcys=D-N-methylcysteine;
Dnmasp=D-N-methylaspartic acid; Dmnglu=D-N-methylglutamic acid;
Dnmphe=D-N-methylphenylalanine; Dnmhis=D-N-methylhistidine;
Dnmile=D-N-methylisoleucine; Dnmlys=D-N-methyllysine;
Dnmleu=D-N-methylleucine; Dnmmet=D-N-methylmethionine;
Dnmasn=D-N-methylasparagine; Dnmpro=D-N-methylproline;
Dnmgln=D-N-methylglutamine; Dnmarg=D-N-methylarginine;
Dnmser=D-N-methylserine; Dnmthr=D-N-methylthreonine;
Dnmval=D-N-methylvaline; Dnmtrp=D-N-methyltryptophan;
Dnmtyr=D-N-methyltyrosine; Nala=N-methylglycine (sarcosine);
Nasp=N-(carboxymethyl)glycine; Nglu=N-(2-carboxyethyl)glycine;
Nphe=N-benzylglycine; Nhhis=N-(imidazolylethyl)glycine;
Nile=N-(1-methylpropyl)glycine; Nlys=N-(4aminobutyl)glycine;
Nleu=N-(2-methylpropyl)glycine; Nmet=N-(2-methyithioethyl)glycine;
Nhser=N-(hydroxyethyl)glycine; Nasn=N-(carbamylmethyl)glycine;
Ngln=N-(2-carbamylethyl)glycine; Nval=N-(1-methylethyl)glycine;
Narg=N-(3-guanidinopropyl)glycine; Nhtrp=N-(3-indolylethyl)glycine;
Nhtyr=N-(p-hydroxyphenethyl)glycine;
Nthr=N-(1-hydroxyethyl)glycine; Ncys=N-(thiomethyl)glycine;
Norn=N-(3-aminopropyl)glycine; Ncpro=N-cyclopropylglycine;
Ncbut=N-cyclobutyglycine; Nchex=N-cyclohexylglycine;
Nchep=N-cycloheptylglycine; Ncoct=N-cyclooctylglycine;
Ncdec=N-cyclodecylglycine; Ncund=N-cycloundecylglycine;
Ncdod=N-cyclododecylglycine; Nbhm=N-(2,2-diphenylethyl)glycine;
Nbhe=N-(3,3-diphenylpropyl)glycine;
Nnbhm=N-(N-(2,2-diphenylethyl)carbamy- l-methyl)glycine;
Nnbhe=N-(N-(3,3-diphenylpropyl)carbamylmethyl)glycine; and
Nbmc=1-carboxy-1-(2,2-diphenylethylamino)cyclopropane.
[0041] "consisting essentially of", in relation to a nucleic acid
sequence, is a term used hereinafter for the purposes of the
specification and claims to refer to substitution of nucleotides as
related to third base degeneracy. As appreciated by those skilled
in the art, because of third base degeneracy, almost every amino
acid can be represented by more than one triplet codon in a coding
nucleotide sequence. Further, minor base pair changes may result in
variation (conservative substitution) in the amino acid sequence
encoded, are not expected to substantially alter the biological
activity of the gene product. Thus, a nucleic acid sequencing
encoding a protein or peptide as disclosed herein, may be modified
slightly in sequence (e.g., substitution of a nucleotide in a
triplet codon), and yet still encode its respective gene product of
the same amino acid sequence.
[0042] The term "expression vector" refers to an oligonucleotide
which encodes the peptide of the invention and provides the
sequences necessary for its expression in the selected host cell.
Expression vectors will generally include a transcriptional
promoter and terminator, or will provide for incorporation adjacent
to an endogenous promoter. Expression vectors will usually be
plasmids, further comprising an origin of replication and one or
more selectable markers. However, expression vectors may
alternatively be viral recombinants designed to infect the host, or
integrating vectors designed to integrate at a preferred site
within the host's genome. Examples of viral recombinants are
Adeno-associated virus (AAV), Adenovirus, Herpesvirus, Poxvirus,
Retrovirus, and other RNA or DNA viral expression vectors known in
the art. Examples of other expression vectors are disclosed in
Molecular Cloning: A Laboratory Manual, Second Edition, Sambrook,
Fritsch, and Maniatis, Cold Spring Harbor Laboratory Press,
1989.
[0043] Since its amino acid sequence has been disclosed by the
present invention, the peptide of the present invention can be
produced by a known chemical synthesis method (see, for example, a
liquid phase synthesis method, a solid phase synthesis method,
etc.; Izumiya, N., Kato, T., Aoyagi, H., Waki, M., "Basis and
Experiments of Peptide Synthesis", 1985, Maruzen Co., Ltd.) based
on that sequence.
[0044] The peptide of the present invention may contain one or more
protected amino acid residues. The protected amino acid is an amino
acid whose functional group or groups is/are protected with a
protecting group or groups by a known method and various protected
amino acids are commercially available.
[0045] When the peptide of the present invention is synthesized, it
is preferred to select any of the protecting groups shown below.
First, the protecting group for the .alpha.-amino group of an amino
acid is Boc (t-butyloxycarbonyl) or Fmoc
(9-fluorenylmethyloxycarbonyl). The protecting group for the
guanidino group of arginine (Arg) is Tos (tosyl), NO.sub.2 (nitro),
Mtr (4-methoxy-2,3,6-trimethylbenzenesulfonyl) or Pmc
(2,2,5,7,8-pentamethyl-chroman-6-sulfonyl). The protecting group
for the s-amino group of lysine (Lys) is Z (benzyloxycarbonyl) or
Cl.Z (2-cholorobenzyloxycarbonyl), Boc, or Npys
(3-nitro-2-pyridinesulfenyl). The protecting group for the
imidazolyl group of histidine (His) is Tos, Z, Pac (phenacyl), Bom
(benzyloxymethyl), Dnp (dinitrophenyl), or Trt (trityl). The
protecting group for the mercapto group of cysteine (Cys) is Bzl
(benzyl), MBzl (4-methoxybenzyl), 4-MeBzl (4-methylbenzyl), Acm
(acetamidomethyl), Trt, Npys, t-Bu (t-butyl), or t-BuS
(t-butylthio). Preferred are MBzl, 4-MeBzl, Trt, Acm, and Npys. The
protecting group for the hydroxyl group of tyrosine (Tyr) is Bzl,
Cl.sub.2. Bzl (2,6-dichlorobenzyl), or t-Bu or the hydroxyl group
of Tyr may be non-protected. The protecting group for the indole
group of tryptophan (Trp) is CHO (formyl) or the indole group of
Trp may be non-protected. The protecting group for the thiomethyl
group of methionine (Met) is methyl sulfoxide or the thiomethyl
group of Met may be non-protected. The protecting group for the
hydroxyl group of serene (Ser) and threonine (Thr) is Bzl or t-Bu.
The protecting group for the carboxyl group of aspartic acid (Asp)
and glutamic acid (Glu) is OBzl (benzyl ester), OtBu (t-butyl
ester), OcHex (cyclohexyl ester), OPac (phenacyl ester), etc. The
protecting group for the carbamide group of asparagine (Asn) and
glutamine (Gln) is Trt or Xan (xanthyl).
[0046] It is preferred that each protective group be selected
appropriately from those known per se depending on the conditions
of peptide synthesis.
[0047] The binding of the protected amino acid is achieved by usual
condensation methods, for example, a DCC (dicyclohexylcarbodiimide)
method, a DIPCDI (diisopropylcarbodiimide) method (Tartar, A., et
al.; J. Org. Chem., 44, 5000 (1979)), an activated ester method, a
mixed or symmetric acid anhydride method, a carbonyldiimidazole
method, a DCC-HONSu (N-hydroxysuccinimide) method (Weygand, F., et
al., Z. Naturforsch., B, 21, 426 (1966)), a DCC-HOBt
(1-hydroxybenzotriazole) method (Koenig, W., et al.; Chem. Ber.,
103, 788, 2024, 2034 (1970)), a diphenylphosphorylazide method, a
BOP-HOBt method (Hudson, D., J. Org. Chem., 53, 617 (1988)) using a
BOP reagent (benzotriazolyl-N-hydroxy-tris-
dimethylaminophosphonium hexafluorophosphide), a HBTU
(2-(1H-benzotriazol-1-yl)-1,1,3,3-tetramethyluronium
hexafluorophosphate)-HOBt method (Knorr, R., et al., Tetrahedron
Lett., 30, 1927 (1989)), a TBTU
(2-(1H-benzotriazol-1-yl)-1,1,3,3-tetramethyluro- nium
tetrafluoroborate)-HOBt method (Knorr, R., et al., Tetrahedron
Lett., 30, 1927 (1989)), etc. However, among these methods,
preferred are the DCC method, the DCC-HOBt method, the BOP-HOBt
method, the HBTU-HOBt method, and the symmetric acid anhydride
method.
[0048] The condensation reaction is usually carried out in an
organic solvent such as dichloromethane, dimethylformamide (DMF),
N-methylpyrrolidone (NMP) and the like or a mixed solvent composed
of them.
[0049] As the eliminating reagent for the protective group of
.alpha.-amino group, there can be used trifluoroacetic
acid/dichloromethane, HCl/dioxane, piperidine/DMF or
piperidine/NMP, etc. and these are selected appropriately depending
on the kind of the protecting group.
[0050] The degree of progress of condensation reaction in each
stage of synthesis can be examined by the method of E. Kaiser, et
al. [Anal. Biochem., 34, 595 (1970)] (ninhydrin reaction).
[0051] As described above, a protected peptide resin having a
desired amino acid sequence can be obtained.
[0052] Treatment of the protected peptide resin with hydrogen
fluoride, TFMSA (trifluoromethanesulfonic acid) [E. Gross ed.,
Yajima, H., et al.; "The Peptide" 5, 65 (1983), Academic Press],
TMSOTf (trimethylsilyl triflate [Fujii, N., et al.; J. Chem. Soc.,
Chem. Commun., 274 (1987)], TMSBr (trimethylsilylbromide [Fujii,
N., et al.; Chem. Pharm. Bull., 35, 3880 (1987)], trifluoroacetic
acid, or the like can eliminate the resin and protecting group
simultaneously. The above-described eliminating reagent is selected
appropriately depending on the strategy used (Boc or Fmoc) and the
kinds of the resin and the protecting group. The peptide of the
present invention can be produced by a series of the methods
described above.
[0053] Alternatively, the peptide of the present invention can be
produced by producing a polynucleotide (DNA or RNA) which
corresponds to the amino acid sequence of the peptide of the
present invention and producing a peptide by a genetic engineering
technique using the polynucleotide. Polynucleotide coding sequences
for amino acid residues are known in the art and are disclosed for
example in Molecular Cloning: A Laboratory Manual, Second Edition,
Sambrook, Fritsch, and Maniatis, Cold Spring Harbor Laboratory
Press, 1989.
[0054] The peptide of the present invention thus produced can be
purified by isolation/purification methods for proteins generally
known in the field of protein chemistry. More particularly, there
can be mentioned, for example, extraction, recrystallization,
salting out with ammonium sulfate, sodium sulfate, etc.,
centrifugation, dialysis, ultrafiltration, adsorption
chromatography, ion exchange chromatography, hydrophobic
chromatography, normal phase chromatography, reversed-phase
chromatography, gel filtration method, gel permeation
chromatography, affinity chromatography, electrophoresis,
countercurrent distribution, etc. and combinations of these.
[0055] The peptide of the present invention which is produced can
be hydrolyzed with an acid, for example, hydrochloric acid,
methanesulfonic acid or the like and its amino acid composition can
be examined by a known method. By this, it can be presumed whether
or not the peptide of the present invention is produced
correctly.
[0056] More strictly, the amino acid sequence of the produced
peptide is determined by a known amino acid sequence determination
method (for example, Edman degradation technique, etc.) to confirm
whether the peptide of the present invention is produced
correctly.
[0057] The peptide of the present invention includes a form of a
salt thereof. As described later on, the peptide of the present
invention is particularly useful as a medicine and hence the salt
of the peptide is preferably a pharmaceutically acceptable
salt.
[0058] The peptide of the present invention may form a salt by
addition of an acid Examples of the acid include inorganic acids
(such as hydrochloric acid, hydrobromic acid, phosphoric acid,
nitric acid, and sulfuric acid) or organic carboxylic acids (such
as acetic acid, propionic acid, maleic acid, succinic acid, malic
acid, citric acid, tartaric acid, and salicylic acid ), acidic
sugars such as glucuronic acid, galacturonic acid, gluconic acid,
ascorbic acid, etc., acidic polysaccharides such as hyaluronic
acid, chondroitin sulfates, alginic acid, or organic sulfonic acids
(such as methanesulfonic acid, and p-toluenesulfonic acid), and the
like. Of these salts, preferred is a pharmaceutically acceptable
salt.
[0059] The peptide of the present invention may form a salt with a
basic substance. Examples of the salt include, for example,
pharmaceutically acceptable salts selected from salts with
inorganic bases such as alkali metal salts (sodium salt, lithium
salt, potassium salt, etc.), alkaline earth metal salts, ammonium
salts, and the like or salts with organic bases, such as
diethanolamine salts, cyclohexylamine salts, and the like.
[0060] The pharmaceutically acceptable carrier which can be used in
the present invention is not limited particularly and includes an
excipient, a binder, a lubricant, a colorant, a disintegrant, a
buffer, an isotonic agent, a preservative, an anesthetic, and the
like which can be used in a medical field.
[0061] The medicine of the present invention can be applied by any
suitable administration method depending on the purpose of
treatment and selected from injection (subcutaneous,
intracutaneous, intravenous, intraperitoneal, etc.), eye dropping,
instillation, percutaneous administration, oral administration,
inhalation, and the like.
[0062] Also, the dosage form such as injectable preparations
(solutions, suspensions, emulsions, solids to be dissolved when
used, etc.), tablets, capsules, granules, powders, liquids,
liposome inclusions, ointments, gels, external powders, sprays,
inhalating powders, eye drops, eye ointments, suppositories,
pessaries, and the like can be selected appropriately depending on
the administration method, and the peptide of the present invention
can be accordingly formulated. Formulation in general is described
in Chapter 25.2 of Comprehensive Medicinal Chemistry, Volume 5,
Editor Hansch et al, Pergamon Press 1990.
[0063] The dose of the medicine of the present invention should be
set up individually depending on the purpose of administration
(prevention, maintenance (prevention of aggravation), alleviation
(improvement of symptom) or cure); the kind of disease; the
symptom, sexuality and age of patient; the administration method
and the like and is not limited particularly.
[0064] Antibodies which react specifically with the inventive
peptides are also included in the present invention. Methods of
generating antibodies directed to a specific peptide fragment are
known in the art. Examples of such methods are disclosed in
Antibodies, A Laboratory Manual, Harlow and Lane, Cold Spring
Harbor Press, 1988, herein incorporated by reference.
[0065] Having generally described this invention, a further
understanding can be obtained by reference to certain specific
examples which are provided herein for purposes of illustration
only, and are not intended to be limiting unless otherwise
specified.
EXAMPLES
Materials and Methods
[0066] Cell lines. KDR-expressing cells (CHO-KDR) were obtained by
transfecting glycosaminoglycan-deficient pgsA 745 Chinese hamster
ovary (CHO) cells (Esko, 1991) with the psV-7d expression vector
(Plouet et al., 1997). CHO cells and CHO-KDR cell line were grown
routinely in Dulbecco's modified Eagle's medium (DMEM) supplemented
with 10% (v/v) fetal calf serum, 50 units/ml penicillin, 50
.mu.g/ml streptomycin, and 2 mM L-glutamine. Calf pulmonary artery
endothelial cells (CPAE) were kindly provided by Dr. Binetruy (CNRS
UPR 9079, Villejuif, France) and grown in minimum Eagle medium
(MEM) supplemented with 20% (v/v) fetal calf serum, 50 units/ml
penicillin, 50 .mu.g/ml streptomycin, and 2 mM L-glutamine. Human
Umbilical Artery Endothelial Cells (HUAE) were grown routinely on
gelatinized-dishes in EGM medium supplemented with antibiotics and
15% (v/v) fetal calf serum. Stock HUAE cultures were maintained by
addition of 1 ng/ml VEGF every other day. The NIH3T3 fibroblast
cell line was grown routinely in MEM medium supplemented with
antibiotics and 10% (v/v) fetal calf serum.
[0067] Library screening with anti-VEGF antibody. Biopanning was
adapted from the Ph.D.-7 kit standard procedure (New England
Biolabs, Beverly, Mass.). Anti-human VEGF monoclonal antibody
(V4758, Sigma, St Louis, Mo.) was used to coat microtiter plates at
10 .mu.g/ml. Three rounds of selection were performed with
non-specific elution of bound phages in pH 2.2 acidic buffer. To
analyze the selected clones, overnight cultures of E. coli (strain
ER2537) were diluted 1:100, infected with single clones, grown for
5 h with shaking at 37 C, and the culture supernatant containing
phage particles was harvested. This phage stock was used to perform
ELISA binding assays and to determine the peptide encoding sequence
as described in the Ph.D.-7 kit guidelines.
[0068] Library screening with CHO-KDR cells. The selection
procedure was adapted from Watters et al. (1997). Four rounds of
biopanning were performed by incubating 10.sup.11 phage particles
with 2.times.10.sup.6 CHO-KDR cells. The last amplified eluate was
then absorbed twice on 2.times.10.sup.6 non-recombinant CHO cells
to enrich for phage clones specifically binding KDR.
[0069] DNA and amino acid sequence analysis. Peptide sequences were
analyzed with the GCG software package (Wisconsin, USA). A multiple
sequence alignment performed by `Pileup` analysis was used to
determine the groups of related peptides. `Gap` analysis was used
to find an optimal alignment between the consensus motifs and the
VEGF primary sequence.
[0070] ELISA of the phage-displayed peptide binding to CHO-KDR
cells. Exponentially growing CHO-KDR cells were seeded in 96-well
microtiter plates at 7.times.10.sup.4 cells/well and left overnight
at 37.degree. C. Cells were fixed with paraformaldehyde (4% in PBS)
for 15 min at room temperature and washed with PBS. Wells were then
filled with PBS-Glycine 0.2%, kept for 15 min at room temperature
and then washed with PBS. Phage particles (10.sup.12 or
10.sup.13/ml) were added to each well and incubated 2 h at room
temperature. Wells were washed with PBS and the amount of bound
phage was detected with peroxidase-conjugated anti-M13 phage serum
(Pharmacia Biotech, Uppsala, Sweden).
[0071] Competition assay of binding to CHO-KDR cells. CHO-KDR cells
were seeded in 24-well plates at a density of 5.times.10.sup.5
cells/well. After 24 h, subconfluent plates were transferred at
4.degree. C., and all subsequent operations were done at 4.degree.
C. Cells were washed twice with PBS, and incubated with
.sup.125-VEGF (30 000 cpm, Amersham, Buckinghamshire, UK) in
binding buffer (DMEM medium supplemented with 20 mM Hepes, pH 7.4,
and 2 mg/ml gelatine). Various concentrations of unlabelled human
recombinant VEGF (Pharmingen, San Diego, Calif.), heparin (Sigma,
St Louis, Mo.), placenta growth factor (PlGF, R & D Systems,
Minneapolis, Minn.) or peptides (Neosystem, Strasbourg, France)
were added in a final volume of 0.3 ml. After 3 h, cells were
washed five times with binding buffer and solubilized by the
addition of 0.5 M NaOH. The amount of radioactivity bound to the
cells was counted in a gamma counter (LKB 1261 Multigamma). The
receptor affinity and the number of binding sites per cell were
determined by Scatchard's analysis (Scatchard, 1986).
[0072] Cell proliferation assay. To test the anti-VEGF antibody
neutralizing effect, CPAE cells were plated into 96-well tissue
culture plates at a density of 500 cells/well. After 24 h, various
concentrations of anti-VEGF antibody were added. The cells were
cultured for an additional day and cell proliferation was measured
using the Cell proliferation ELISA kit from Boerhinger
(Indianapolis, Ind.). Cells were incubated with BrdU for 4 h at
37.degree. C., and the incorporation of BrdU in newly synthetized
DNA was quantified by immunoassay as described by the manufacturer.
To investigate the peptide effect, after 24 h of CPAE cell growth,
2.1.times.10.sup.-4M synthetic peptides were added daily to the
culture medium. Cell proliferation was assessed after 24 h, 48 h or
72 h as described above. HUAE cells were seeded at 5,000 cells/well
in 12 well plates in medium containing 2 ng/ml VEGF or 100 ng/ml
immunopurified KDR anti-idiotypic antibodies (Ortega et al, 1997),
and supplemented daily with various concentrations of V1 or V5
peptide. Cells were trypsinized and counted after 5 days using a
Coulter counter.
[0073] Rabbit corneal pocket assay. Slow releasing implants of
hydrogel (2.times.1 mm) were rehydrated with 2 1 PBS containing 25
.mu.g of bovine serum albumin and 2 pmol VEGF in the presence or
absence of 30 nmol peptide. These implants were inserted in New
Zealand rabbit (Elevage du Trottis, Esperce, France) corneal stroma
2 mm away from the limbus (Favard et al, 1991). Neovascularization
was assessed on day 12 by direct examination with a slit lamp and
scored according to a 4 grade scale (grade 1: less than 1 mm long
neovessels, grade 2: 1 mm long neovessels, grade 3: 1 to 2 mm long
neovessels, grade 4: neovessels extending to the implant). Means
and standard deviations were determined on 8 implant groups for
each condition.
[0074] Results
[0075] CHO-KDR Cells Express a VEGF Binding KDR
[0076] In order to find peptides binding KDR, we first looked for a
receptor that we could use to perform panning techniques. CHO cells
expressing a recombinant KDR at their membrane surface were tested
for their ability to bind VEGF in a variety of conditions. FIG. 1A
shows that the dissociation constant of VEGF on CHO-KDR cells was
334 pM. Heparin was able to increase the binding of VEGF to CHO-KDR
cells, the optimal concentration being 1.8 .mu.g/ml (FIG. 1B) and
PlGF was not modifying VEGF binding to CHO-KDR cells (FIG. 1C).
Taken together, all these data suggested that the KDR expressed by
recombinant CHO cells exhibited the same characteristics as the
endothelial receptor for binding to VEGF.
[0077] Identification of Peptides Binding Specifically to KDR
[0078] Since this receptor was able to bind VEGF, we tried to find
peptides able to mimic this interaction and that bound KDR in the
same conditions. A random 7-mer library composed of
2.times.10.sup.9 independent clones was screened by binding to
CHO-KDR cells. At the end of the selection, 24 clones were isolated
and analyzed. DNA sequencing showed that seven independent peptides
had been selected (K1 to K7), with no sequence homology (Table
I).
[0079] The binding of each selected clone to KDR was tested by
ELISA on CHO-KDR cells. All the clones gave an ELISA signal
significantly higher than the control bacteriophage one (FIG. 2A).
However, ELISA signals were detectable only for phage
concentrations higher than 10.sup.13/ml, suggesting that the
selected peptides could bind KDR specifically, but with low
affinity.
1TABLE I DNA sequence of the peptides selected by binding to CHO-
KDR cells or to the anti-VEGF antibody. Selection on CHO-KDR cells
Selection on anti-VEGF antibody K1 YLTMPTP (SEQ ID NO:8) V1 ATWLPPR
(SEQ ID NO:1) K2 WPTPPYA (SEQ ID NO:9) V2 NPRALNY (SEQ ID NO:2) K3
TPHNTVS (SEQ ID NO:10) V3 ANLFKAK (SEQ ID NO:3) K4 SLPAHAR (SEQ ID
NO:11) V4 YHSSFQA (SEQ ID NO:4) K5 HSSLQTP (SEQ ID NO:12) V5
ILDNYKL (SEQ ID NO:5) K6 YSIPKSS (SEQ ID NO:13) V6 LPPNPTK (SEQ ID
NO:6) K7 ALQPRYL (SEQ ID NO:14) V7 YAIMPLV (SEQ ID NO:7)
[0080] An Anti-VEGF Antibody Blocking VEGF-KDR Interaction
[0081] In order to find peptides binding KDR with a higher
affinity, we decided to screen the peptide library using an
alternative strategy. Peptides mimicking the antigen binding site
of many monoclonal antibodies have been isolated successfully from
phage-displayed libraries (reviewed in Felici et al., 1995).
Screening our repertoire with an anti-VEGF antibody neutralizing
its biological activity on endothelial cells would allow us to
identify peptides mimicking the KDR binding site on VEGF, and
therefore able to block the VEGF-KDR interaction. We first checked
if the human anti-VEGF antibody V4758 could inhibit the
proliferation of endothelial cells. Calf Pulmonary Aortic
Endothelial cells (CPAE) were used as model cells for
VEGF-dependent proliferation. As shown in FIG. 3, the anti-VEGF
antibody exerted a dose-dependent inhibitory activity on the
proliferation on these cells, and a complete abolition of cell
division was achieved m presence of 30 .mu.g/ml of antibody. At the
same concentration, this antibody had no inhibitory effect on the
growth of NIH3T3 fibroblast cells (not shown). These results
confirmed that the anti-VEGF antibody could block VEGF-KDR
interaction by binding VEGF at the KDR binding site.
[0082] Identification of Peptides Specifically Binding the
Anti-VEGF Antibody
[0083] The peptide library was then screened by binding to the
anti-VEGF antibody. At the end of the selection, 24 clones were
isolated and analyzed. DNA sequencing showed that seven independent
peptides had been selected (V1 to V7) with no consensus motifs,
although a LPP motif was found in two of them (V1 and V6) (Table
I).
[0084] When tested for binding to KDR by ELISA on CHO-KDR cells,
all the selected clones gave strong ELISA signals, confirming that
they were able to bind the cell receptor (FIG. 2B). Further, they
showed higher reactivity than the peptides selected by KDR binding,
using phage concentrations ten times lower. This suggests that they
had a higher affinity for the receptor. Interestingly, the best
reactivities were observed for V1 and V6.
[0085] DNA Sequence Analysis of the Selected Clones Highlights a
Common LPP/A Motif
[0086] In order to identify the residues responsible for this
increased affinity for KDR, a multiple alignment analysis on all
selected sequences was performed. Table II shows that three
consensus groups, corresponding to the underlined residues, could
be identified. Group A was composed of four clones and was
characterized by the motif YX(I/T)(M/P)P (SEQ ID NO:15), the
tyrosine residue always occurring in the first position. Two
peptides of this group, K1 and V7, shared a strong sequence
homology, with three identical residues that are particularly
hydrophobic. Group B was characterized by a longer motif HSSLQPRXL
(SEQ ID NO:16). Interestingly, two pairs of two clones obtained
from different selection strategies show significant homologies, K5
and V4 containing HSSXQ, K7 and V2 with the PRXL motif. A shorter
consensus LP(A/P) was found in group C. Interestingly, this group
contained the two clones presenting the motif LPP, extended with
the K4 clone that has a similar motif LPA. The peptide sequences
were also compared to the primary sequence of VEGF (Table II).
Alignment of the individual selected clones or of the consensus
motifs with VEGF did not produce any significant homology,
suggesting that the selected peptides mimicked a discontinuous
binding site.
2TABLE II DNA sequence analysis of the selected clones. Multiple
alignment of the selected clones (A) (B) (C) K1 YLTMPTP K5 HSSLQTP
V1 ATWLPPR V7 YAIMPLV V4 YHSSFQA K4 SLPAHAR K6 YSIPKSS K7 ALQPRYL
V6 LPPNPTK K2 WPTPPYA V2 NPRALNY Alignment with the VEGF primary
sequence (SEQ ID NO:17) 10 20 30 40 50 60
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGC 70 80
90 100 110 CNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDR
[0087] V1 Inhibits the Binding of VEGF to KDR
[0088] Since the selected peptides were all able to bind KDR, we
examined whether they were able to block VEGF interaction with the
receptor. Synthetic peptides based on the amino acid sequence of
the selected clones were synthesized. They were then tested in
competition with VEGF for binding to CHO-KDR cells, using a fixed
peptide concentration (2.1.times.10.sup.-4M). Two peptides only, V1
and to a lesser extent K4, showed an inhibitory effect on VEGF
binding to KDR at this concentration (FIG. 4). FIG. 5 compares the
dose-dependent inhibition of VEGF binding to CHO-KDR cells by VEGF
itself (A) or by V1 (B). V1 could nearly block VEGF binding at a
320 M concentration, its IC.sub.50 being estimated estimated at
8.times.10.sup.-5 M. On the contrary, V5 tested in same conditions
did not modify VEGF binding. The other peptides binding the
anti-VEGF antibody did not show any inhibitory effect of VEGF
binding to KDR at this concentration (data not shown).
[0089] V1 Specifically Inhibits the Proliferation of Vascular
Endothelial Cells
[0090] Since the selected peptides could block VEGF binding to KDR,
and since endothelial cell proliferation is dependent of VEGF, we
tested whether they could inhibit proliferation of endothelial
cells in vitro. CPAE cell cultures supplemented with
2.1.times.10.sup.-4M synthetic peptides were compared with
untreated cultures for cell growth (FIG. 6). After 24 h of
incubation, CPAE cell proliferation in presence of V1 was reduced
by 60%. Surprisingly, the V6 peptide, which had no effect on VEGF
binding to KDR, showed a similar effect. The other peptides also
had an inhibitory effect on cell division, but exhibited lower
reactivity (about 15%). For all peptides, the inhibitory effects on
cell proliferation could be maintained at similar levels in 48 h
and 72 h cultures by daily supplementation of the peptides (data
not shown).
[0091] The ability of V1 to block VEGF-induced proliferation of
human is endothelial cells was also examined. As shown on FIG. 7A,
V1 suppressed the mitogenic activity of VEGF in a dose dependent
manner, whereas V5 had no inhibitory effect. To check the
specificity of the interaction between V1 and KDR, the same
experiment was repeated using KDR anti-idiotypic antibodies (AIA).
AIA were generated and found to be selective agonists for KDR,
since they promoted endothelial cell proliferation in vitro (data
not shown). FIG. 7B shows that unlike V5, V1 could suppress the
AIA-dependent cell proliferation, indicating that the V1 effect was
mediated by a direct interaction with KDR.
[0092] To see if this effect was specific of endothelial cells, we
tested the effect of V1 on NIH 3T3 fibroblast growth. V1 peptide
did not modify the proliferation of these cells, confirming that it
blocks VEGF-dependent cell growth only (FIG. 8).
[0093] V1 Inhibits Corneal Angiogenesis in vivo
[0094] A rabbit corneal pocket assay was used to determine whether
V1 could inhibit angiogenesis in vivo. The neovascularization in
corneal implants containing VEGF in the presence or absence of
peptides was measured (FIGS. 9A and 9B). When compared with the
vehicle alone, V1 and V5 did not improve the generation of new
blood vessels. VEGF induced a significant angiogenic response,
which was not modified by the addition of V5. This stimulatory
effect was totally abolished by V1, demonstrating that V1 could
inhibit VEGF-induced corneal angiogenesis.
[0095] Relationship Between Structure and Activity
[0096] A--Analogues from V1 Obtained by Systematic Replacement of
an Amino-Acid by Alanine (Ala Scan)
[0097] Each amino acid of the ATWLPPR (V1) peptide was replaced by
a L-alanine residue (AlaScan) as shown in Table III below:
3TABLE III Structure of peptides obtained by systematic replacement
of one amino-acid by alanine. Peptide V1 A T W L P P R A2 A A W L P
P R A3 A T A L P P R A4 A T W A P P R A5 A T W L A P R A6 A T W L P
A R A7 A T W L P P A
[0098] B--Study of the Efficiency of the V1 Analogues:
[0099] The effect of the replacement of each amino acid by a
L-alanine residue (AlaScan) on binding of .sup.125I-VEGF165 to
CHO-KDR transfected cells was investigated by measuring the binding
of .sup.125I-VEGF in displacement experiments with increasing
concentrations of ATWLPPR peptide analogues and analysed by the use
of curve fitting, (FIG. 10). The molecule was relatively tolerant
to alanine substitution (A2 to A6), except for the Ala7-substituted
analogue (A7) which was totally devoid of activity (Table IV).
4TABLE IV Effect (CI.sub.50) of the replacement of each amino acid
by a L-alanine residue (AlaScan) on binding of VEGF to CHO-KDR
transfected cells. CI50 Efficiency Analogue (.times.10-5 M) (%
Emax) V1 1.88 100 A6 2.24 84 A3 2.68 70 A5 2.91 65 A2 3.09 61 A4
6.07 31 A7 0
[0100] C--Specificity of C-Terminal Arginine:
[0101] To determine the specificity of the C-terminal arginine
residue its substitution by lysine (A9) and the suppression of this
residue (A10), (Table V), have been studied.
5TABLE V Structure of peptides used to study the function of the C-
terminal arginine Peptide 1 2 3 4 5 6 7 V1 A T W L P P R A9 A A W L
P P K A10 A T A L P P A7 A T W L P P A
[0102] Displacement curves of .sup.125I-VEGF 165 binding to CHO-KDR
transfected cells by the peptide analogues A10 showed that
C-terminal region arginine residue deletion significantly reduced
the peptide efficiency. The substitution of arginine by lysine (A9)
also reduced the peptide efficiency showing that the effect of this
arginine residue was not due only to its positive electric charge,
(FIG. 11).
[0103] D--Alanine Substitution of the 6 Amino Acids Positioned
Upstream the C-Terminal Arginine Residue
[0104] The substitution of the 6 amino acids upstream the
C-terminal arginine residue abolished the V1 peptide inhibitory
efficiency by a factor 10, (FIG. 12).
[0105] The above-results demonstrate that the inhibitory efficiency
of V1 is linked to the presence of a C-terminal basic amino-acid
(Arg being more potent than Lys) preceded by either aliphatic or
aromatic neutral amino acids (including proline).
[0106] Action Mechanisms
[0107] A--Inhibitory Effect of V1 on Endothelial Cell
Proliferation
[0108] The inhibitory effect of V1 on Human umbilical vein
endothelial cell (HUVEC) in primary culture. The VEGF-induced HUVEC
proliferation was inhibited by V1 in a non competitive manner (FIG.
13).
[0109] B--Effect of V1 on the Binding of .sup.125I VEGF165 to
Recombinant Human VEGFR2/Fc Chimera
[0110] V1 was not able to inhibit VEGF binding to VEGF R2 (KDR)/Fc
Chimera (FIG. 14).
[0111] C Characteristics of the Inhibitory Effect of V1 on the
Binding of .sup.125I VEGF 165 to VEGF-R2 Expressed by Transfected
CHO Cells:
[0112] V1 inhibited the binding of .sup.125I VEGF165 to VR2
expressed by transfected CHO cells. The scatchard binding analysis
showed the presence of high afinnity specific receptors. This
affinity is lowered in the presence of V1 (FIGS. 15A and B).
[0113] D Characteristics of the Inhibitory Effect of V1 on the
Binding of .sup.125I VEGF 165 to VEGF-R2 on HUV-EC Cells
[0114] For the analysis of displacement curves of .sup.125I-VEGF
165 binding to HUV-EC, the cells were incubated with VEGF at
increasing concentrations, in the presence of either saline or V1
peptide. Scatchard analysis of radioligand receptor binding showed
the presence of specific receptors for .sup.125I VEGF165 on the
surface of HUV-EC cell line with a Kd of 117 and 2300 pM. V1
inhibited only the VEGF binding to high affinity receptors. (see
FIGS. 16A, B and C).
[0115] E Interaction of V1 and Heparin on the Binding of .sup.125I
VEGF 165 to VEGF-R2 Transfected CHO Cells:
[0116] The binding of VEGF 165 to transfected CHO cell is agonized
heparin-dependent in a concentration range of 10 to 1000 ng/ml. V1
inhibited this heparin agonistic effect (see FIG. 17)
[0117] F Inhibitory Effect of V1 on .sup.125I VEGF165 Binding to
MDA-MB 231 Cells:
[0118] Breast tumoral cell line MDA-MB 131 has no VEGF-R2
receptors, however they expresses neuropilin 1 (NP1). The binding
of .sup.125I VEGP 165 to this cells was inhibited by the V1
peptide. (CI.sub.50=38 .mu.g/ml) (FIG. 18)
[0119] G Effect of the V1 Peptide on the Cross Linking of .sup.125I
VEGF165 to HUV-EC.
[0120] The cross-linking of .sup.125I VEGF165 to HUV-EC cells
showed two labeled .sup.125I-VEGF-receptor complexes. The 240-260
kDa complex could correspond to the VEGF-R2-2EGF165 complex and the
160-170 kDa complex could correspond to the NP1-VEGF 165 complex.
The labeling of the two complexes was decreased in the presence of
the V1 peptide. (FIG. 19)
[0121] The above-results demonstrate that the mechanism of V1
action involves not only a displacement of VEGF165 from the binding
ligand domain of VEGF-R2 but also possible interactions with
co-receptors including NP1 and heparan sulfate proteoglycans.
[0122] Previous studies have demonstrated that antiangiogenic
therapy is a promising approach for the treatment of cancer
(Folkman, 1995). Solid tumor growth and tumor metastasis are
dependent on tumor vascularization. Moreover, clinical studies of
patients with a variety of solid tumors have shown a direct
correlation between the density of tumour vessels and a adverse
prognosis (Weidner et al., 1991; Albo et al., 1994). VEGF and its
signal transducing tyrosine kinase receptor VEGFR-2 (KDR/flk-1) are
major mediators of tumor-induced angiogenesis (Terman et al., 1992;
Ferrara, 1993). Also, VEGF is different from other growth factors
because it acts as an endothelial cell specific mitogen during
angiogenesis (Plouet et al., 1989; Leung et al., 1989; Ferrara,
1993). Previous studies have shown that blocking the VEGF-VEGF
receptor pathway using antibodies results in murine and human tumor
regression (Kim et al., 1993; Cheng et al., 1996). We report here
the identification of peptides antagonist for VEGF by use of a
phage-displayed peptide library.
[0123] There are only limited examples of the direct screening of
peptide libraries with a cellular receptor, the main difficulty
being the removal of clones binding non-specific determinants. To
select peptides binding cell-displayed uPAR (urokinase plasminogen
activator receptor), Goodson et al. performed multiple rounds of
biopanning using either recombinant Sf9 insect cells or COS-7 cells
(1994). In this study, we performed two rounds of negative
selection against non recombinant cells at the end of the selection
process. This resulted in an efficient removal of non specific
clones since all the isolated phage clones could bind KDR
specifically on ELISA.
[0124] Another possible approach is to screen peptide libraries
using antibodies blocking the interaction between receptor and
ligand. This assumes that the antibody binding site on the ligand
contains residues interacting with the receptor. Using anti-basic
fibroblast factor (bFGF) antibodies blocking the binding to its
receptor, Yayon et al. (1993) successfully isolated peptides able
to inhibit bFGF-induced proliferation of vascular endothelial
cells. However, the use of bFGF as a therapeutic target is limited
-by the fact that it acts on a broad spectrum of cell types and
that the in vivo expression of its receptor by endothelial cells is
controversial. In contrast, VEGF is a secreted endothelial
cell-specific mitogen whose receptors are expressed almost
exclusively on vascular endothelial cells and is therefore of
greater therapeutic interest (Millauer et al., 1993; Peters et al.,
1993). To isolate VEGF antagonists, we used a 7-mer random peptide
library displayed on bacteriophage M13 and performed two
selections, one based on binding to KDR, and the other on binding
to an anti-VEGF blocking antibody. This allowed us to compare the
sequences selected by the two strategies, and to identify residues
responsible for the antagonist activity.
[0125] Library screening for binding to KDR was performed on CHO
cells expressing a recombinant receptor at the membrane surface,
and we demonstrated that this molecule could bind VEGF similarly to
the natural receptor. Indeed, the affinity of the recombinant
receptor was comparable to the constant measured on endothelial
cells (Terman et al., 1992; Klasgsbrun and D'Amore, 1996). Also,
heparin was able to increase VEGF binding to CHO-KDR cells. This
phenomenon was bimodal lower heparin concentration improving the
binding of VEGF and higher concentrations having an inhibitory
effect, and reproduces the effect of heparin on VEGF binding to
natural KDR (Gitay-Goren et al., 1992, 1993). In accordance with
previous work, PlGF did not modify VEGF binding to KDR expressing
cells (Terman et al., 1994). The reactivity of the peptides
selected for KDR binding was relatively low, and only one of them
could compete with VEGF for KDR binding at concentrations in the
10.sup.-4 M range. Furthermore, none were potent at suppressing the
growth of endothelial cells in vitro, suggesting that the selected
peptides bound KDR in regions distant from VEGF binding site and
therefore poorly interfered with the VEGF-KDR interaction.
[0126] Library screening for antibody binding was an indirect way
to isolate peptides antagonist of VEGF-KDR interactions, but
nevertheless led to the identification of the most potent peptide.
The V1 peptide (ATWLPPR) showed the highest reactivity in ELISA and
the highest inhibitory effect on endothelial cell growth.
Importantly, V1 inhibited VEGF-induced proliferation of human
endothelial cells without influencing the growth of non-endothelial
cells and was able to inhibit VEGF-induced angiogenesis in vivo in
a rabbit corneal model. This suggests that the effect of V1 was
mediated by the direct binding to KDR. Recently, Soker et al.
(1998) have identified a new receptor for VEGF which is expressed
by endothelial cells and tumor cells. This receptor is identical to
human NRP-1, a receptor for the collapsin/semaphorin family that
mediates neuronal cell guidance. When co-expressed in cells with
KDR, NRP-1 enhanced the binding of VEGF to KDR. Conversely,
inhibition of VEGF binding to NRP-1 inhibited its binding to KDR
and its subsequent mitogenic activity on endothelial cells. In
fact, NRP-1 might be acting as a co-receptor that enhances the
VEGF-induced activities mediated by KDR. To see whether V1 reacts
specifically with KDR, we tested the binding of V1 to KDR in
competition with KDR anti-idiotypic antibodies. We found that V1
was able to block the proliferation of endothelial cells induced by
these antibodies, showing that its inhibitory effect was due to a
specific interaction with KDR.
[0127] Interestingly, V6, which shared the LPP motif in common with
V1, significantly inhibited the proliferation of endothelial cells
but it did not affect the binding of VEGF to KDR. In contrast, the
K4 peptide contained a motif LPA and could partially inhibit VEGF
binding to KDR, but had a minor effect on endothelial growth. This
suggests that the presence of an alanine residue instead of a
proline may account for its lack of reactivity, and that the LPP
motif is essential for peptide antagonist activity.
[0128] Alignment of the individual selected clones with the primary
sequence of the VEGF did not produce any homology. In particular,
no LPP motif could be found. This suggests that the KDR binding
site on VEGF is discontinuous and that the selected peptides may
contain residues distant in the VEGF primary sequence, but in close
proximity in the folded molecule. This in accordance with the
crystal structure of VEGF which has been recently resolved (Muller
et al., 1997). Mutational analysis revealed that two spots of
residues involved in KDR binding are located at each pole of the
VEGF monomer, that may constitue a functional binding site in the
dimer (Muller et al., 1997). We are currently investigating whether
residues corresponding to the selected motifs are accessible at the
surface of the VEGF dimer and in close proximity in the folded
molecule.
[0129] Angiogenesis is involved in a variety of human diseases. The
VEGF/KDR interaction has been shown to play a role in cancer, but
also in diabetic retinopathy (Pierce et al., 1995), psoriasis
(Detmar et al., 1994), hemangioblastoma (Wizigmann-Voos et al.,
1995), and Kaposi's sarcomas in AIDS patients (Albini et al.,
1996). Thus, identification of VEGF antagonists may have potential
applications in the treatment of a variety of human diseases.
Moreover for therapeutic use, small molecules are preferred since
reduced size make them more amenable to translation into organic
molecules. Peptides provide leading molecules for the design of
unexpensive drugs that can be administered orally.
[0130] Our results demonstrate that the ATWLPPR peptide is an
effective antagonist of VEGF and an inhibitor of angiogenesis. This
peptide could be a potent inhibitor of tumor angiogenesis, and
could have a more general interest in diseases in which
angiogenesis is involved. In this context, in vivo anti-tumor
chemotherapy assays using this peptide must be investigated.
[0131] In this context, the invention also relates to the ATWLPPR
peptide for use in inhibiting angiogenesis and/or in treating a
disease selected in the group consisting of cancer, diabetic
retinopathy, psoriasis, hemangioblastoma, and Kaposi's sarcoma.
[0132] Obviously, numerous modifications and variations on the
present invention are possible in light of the above teachings. It
is therefore to be understood that within the scope of the appended
claims, the invention may be practiced otherwise than as
specifically described herein.
[0133] References
[0134] Albini, A., Soldi, R., Giunciuglio, D., Benelli, R., Primo,
L., Noonan, D., Salio, M., Camussi, G., Rockl, W. and Bussolino, F.
(1996) The angiogenesis induced by HIV-1 tat protein is mediated by
the Flk-1/KDR on endothelial cells. Nat. Med., 2, 1371-1375.
[0135] Albo, D., Granick, M. S., Jhala, N., Atkinson, B. and
Solomon, M. P. (1994) The relationship of angiogenesis biological
activity in human squamous cell carcinomas of the head and neck
Ann. Plastic Surg., 32, 588-594.
[0136] Ausprunk, D. H. and Folkman, J. (1977) Migration and
proliferation of endothelial cells in preformed and newly formed
blood vessels during angiogenesis. Microvasc. Res., 14, 53-65.
[0137] Boehm, T., Fokman, J., Browder, T. and O'Reilly, M. S.
(1997) Antiangiogenic therapy of experimental cancer does not
induce acquired drug resistance. Nature, 390, 404-407.
[0138] Bouck, N., Stellmach, V. and Hsu, S. C. (1996) How tumors
become angiogenic. Adv. in Cancer Res., 69, 135-174.
[0139] Cheng, S. Y., Huang, H. J. S., Nagane, M., Ji, X. D., Wang,
D., Shih, C. C. Y, Arap, W., Huang, C. M. and Cavenee, W. K. (1996)
Suppression of glioblastoma angiogenicity and tumorigenicity by
inhibition of endogenous expression of vascular endothelial growth
factor. Proc. Natl. Acad. Sci. USA, 93, 8502-8507.
[0140] Cliff, W. J. (1963) Observations on healing tissues: a
combined light and electron microscopic investigation.
Philosophical Transactions of the Royal Society, 246, 305-325.
[0141] Cortese, R., Monaci, P., Luzzago, A., Santini, C., Bartoli,
F., Cortese, I., Fortugno, P., Galfre, G., Nicosia, A, and Felici,
F. (1996) Selection of biologically active peptides by phage
display of random peptides libraries. Curr. Opin. Biotechnol., 7,
616-621.
[0142] Cwirla, S. E., Peters, E. A., Barrett, R. W. and Dower, W.
J. (1990) Peptides of phage: a vast library of peptides for
identifying ligands. Proc. Natl. Acad. Sci., USA, 87,
6378-6382.
[0143] Detmar, M., Brown, L. F., Claffey, K. P., Yeo, K. T.,
Kocher, O., Jackman, R. W., Berse, B. and Dvorak, H. F. (1994)
Overexpression of vascular permeability factor/vascular endothelial
growth factor and its receptor in psoriasis. J. Exp. Med., 180,
1141-1146.
[0144] De Vries, C., Escobedo, J. A., Ueno, H., Houck, K., Ferrara,
N. and Williams, L. T. (1992) The fms-like tyrosine kinase, a
receptor for vascular endothelial growth factor. Science, 255,
989-991.
[0145] Esko, J. D. (1991) Genetic analysis of proteoglycan
structure, function and metabolism. Curr. Opin. Cell Biol., 3,
805-816.
[0146] Favard, C., Moukadiri, H., Dorey, C., Praloran, V. and
Plouet, J. (1991) Purification and biological properties of
vasculotropin, a new angiogenic cytokine. Biol. Cell., 73, 1-6.
[0147] Felici, F., Luzzago, A., Monaci, P., Nicosia, A., Sollazo,
M. and Traboni, C. (1995) Peptide and protein display on the
surface of filamentous bacteriophage. In Raafat El-Gewely, M.
(ed.), Biotechnology Annual Review. Amsterdam, The Nederlands:
Elsevier, pp.149-183.
[0148] Ferrara, N. and Henzel, W. J. (1989) Pituitary follicular
cells secrete a novel heparin-binding growth factor specific for
vascular endothelial cells. Biochem. Biophys. Res. Commun., 161,
851-858.
[0149] Ferrara, N. (1993) Vascular endothelial growth factor.
Trends Cardiovasc. Med., 3, 244-250.
[0150] Ferrara, N. and Davis-Smyth T. (1997) The biology of
vascular endothelial growth factor. Endocrine Rev., 18, 4-25.
[0151] Ferrara, N. (1999) Molecular and biological properties of
vascular endothelial growth factor. J. Mol. Med., 77, 527-543.
[0152] Folkman, J. (1995) Angiogenesis in cancer, vascular
rheumatoid and other diseases. Nat. Med., 1, 27-30.
[0153] Folkman, J. (1995) Clinical applications of research on
angiogenesis. N. Engl. J. Med., 333, 1757-1763.
[0154] Gita-Goren, H., Soker, S., Vlodavsky, I. and Neufeld, G.
(1992) The binding of vascular endothelial growth factor to its
receptor is dependent on cell surface-associated heparin-like
molecules. J. Biol. Chem., 267, 6093-6098.
[0155] Gita-Goren, H., Halaban, R. and Neufeld, G. (1993) Human
melanoma cells but not normal melanocytes express vascular
endothelial growth factor receptors. Biochem. Biophys. Res.
Commun., 190, 702-709.
[0156] Goodson, R. J., Doyle, M. V., Kaufman, S. E. and Rosenberg,
S. (1994) High-affinity urokinase receptor antagonists identified
with bacteriophage peptide display. Proc. Natl. Acad. Sci. USA, 91,
7129-7133.
[0157] Hanahan, D. and Folkman, J. (1996) Patterns and emerging
mechanisms of the angiogenic switch during tumorigenesis cell.
Cell, 86, 353-364.
[0158] Hoess, R. H. (1993) Phage display of peptide and protein
domains. Curr. Opin. Stuct. Biol., 3, 572-579.
[0159] Houck K, Ferrara N, Winer J., Cachianes, G., Li, B. and
Leung D. W (1991) The vascular endothelial growth factor family:
identification of a fourth molecular species and characterization
of alternative splicing of RNA. Molecular Endocrinol., 5,
1806-1814.
[0160] Houck K., Leung D. W., Rowland A. M., Winer J. and Ferrara
N. (1992) Dual regulation of vascular endothelial growth factor
biovailability by genetic and proteolytic mechanisms. J. Biol.
Chem., 267, 26031-26036.
[0161] Kerbel R. S. (1991) Inhibition of tumor angiogenesis as a
strategy to circumvent acquired resistance to anti-cancer
therapeutic agents. Bioassays, 13, 31-36.
[0162] Kim, K. J., Li, B., Winer, J., Armanini, M., Gillett N.,
Philips, H. S. and Ferrara, N. (1993) Inhibition of vascular
endothelial growth factor-induced angiogenesis suppresses tumor
growth in vivo. Nature, 362, 841-844.
[0163] Klagsbrun, M. and D'Amore, P. A. (1996) Vascular endothelial
growth factor and its receptors. Cytokine Growth Factor Rev., 7,
259-270.
[0164] Koivunen, E., Gay, D. A. and Ruoslahti, E. (1993) Selection
of peptides binding to the 5 1 integrin from phage display library.
J. Biol. Chem., 268, 20205-20210.
[0165] Leung, D. L., Cachianes, G., Kuang, W.6J., Goeddel, D. V.
anf Ferrara, N. (1989) Vascular endothelial growth factor is a
secreted angiogenic mitogen. Science, 246, 1306-1309.
[0166] Matthews, W., Jordan, C. T., Gavin, M., Jenkins, N. A.,
Copeland, N. G. and Lemischka, I. R. (1991) A receptor tyrosine
kinase, cDNA isolated from a population of enriched primitive
hematopoietic cells and exhibiting close genetic linkase to c-kit.
Proc. Natl. Acad. Sci. USA, 88, 9026-9030.
[0167] Milauer, B., Wizigmann-Voos, S., Schnurch, H., Martinez, R.,
Moller, N. P. H., Risau, W. and Ullrich, A. (1993) High affinity
VEGF binding and developmental expression suggest Flk-1 as a major
regulator of vasculogenesis and angiogenesis. Cell, 72,
835-846.
[0168] Muller, Y. A., Christinger, H. W., Bruce, A. K. and De Vos,
A. M. (1997) The crystal structure of vascular endothelial growth
factor (VEGF) refined to 1.93 A resolution: multiple copy
flexibility and receptor binding. Stucture, 5, 1325-1338.
[0169] Muller, Y. A., Li, B., Christinger, H. W., Wells, J. A.,
Cunningham, B. C. and De Vos, A. M. (1996) Vascular endothelial
growth factor: crystal structure and functional mapping of the
kinase domain receptor binding site. Proc. Natl. Acad. Sci. USA,
94, 7192-7197.
[0170] Myoken, Y., Kayada, Y., Okamoto, T., Kan, M., Sato, G. H.
and Sato, J. D. (1991) Vascular endothelial cell growth factor
(VEGF) produced by A-431 human eperdimoid carcinoma cells and
identification of VEGF membrane binding sites. Proc. Natl. Acad.
Sci. USA, 88, 5819-5823.
[0171] O'Neil, K. T., Hoess, R. H., Jackson, S. A., Ramachandran,
N. S., Mousa, S. A. and Degrado W. F. (1992) Identification of
novel peptide antagonists for gpIIB/IIIa from a conformationnnaly
constrained phage peptide library. Proteins, 14, 509-515.
[0172] Ortga N., Jonca F., Vincent S., Favard C., Malavaud B.,
Ruchoux M-M, Plout J. (1997) Systemic activation of the vascular
endothelial growth factor receptor flk-1 selectively triggers
angiogenic endothelial cells. Am. J. Pathol., 151, 1215-1224.
[0173] Peters, K. G., De Vries, C. and Williams, L. T. (1993)
Vascular endothelial growth factor receptor expression during
embryogenesis and tissue repair suggests a role in endothelial
differentiation and blood vessel growth. Proc. Natl. Acad. Sci.
USA, 90, 8915-8919.
[0174] Pierce, E. A., Avery, R. L., Foley, E. D., Aiello, L. P. and
Smith, L. R. H. (1995) Vascular endothelial growth factor/vascular
permeability factor expression in a mouse model of retinal
neovascularization. Proc. Natl. Acad. Sci. USA, 92, 905-909.
[0175] Plout, J., Schilling, J. and Gospodarowicz, D. (1989)
Isolation and characterization of newly identified endothelial cell
mitogen produced by AtT-20 cells. EMBO J., 8, 3801-3806.
[0176] Plout, J., Moro, F., Bertagnolli, S., Coldeboeuf, N.,
Mazarguil, H., Clamens, S. and Bayard, F. (1997) Extracellular
cleavage of the vascular endothelial growth factor 189-amino acid
form by urokinase is required for its mitogenic effect. J. Biol.
Chem., 272, 13390-13396.
[0177] Scatchard, G. (1986) The attraction of proteins for small
molecules and ions. Ann. NY Acad. Sci., 261, 4660-4662.
[0178] Schoefl, G. I. (1963) Studies on inflammation. III. Growing
capillaries: their structure and permeability. Virchows Arch.
Pathol. Anat., 337, 97-141.
[0179] Smith, G. P. (1985) Filamentous fusion phage: novel
expression vectors that display cloned antigens on the virion
surface. Science, 228, 1315-1317.
[0180] Soker, S., Takashima, S., Miao, H. Q., Neufeld, G. and
Klagsbrun, M. (1998) Neuropilin-1 is expressed by endothelial and
tumor cells as an isoform-specific receptor for vascular
endothelial growth factor. Cell, 92, 735-745.
[0181] Terman, B. I., Carrion, M. E., Kovacs, E., Rasmussen, B. A.,
Eddy, R. L. and Shows, T. B. (1991) Identification of a new
endothelial growth factor receptor tyrosine kinase. Oncogene, 6,
1677-1683.
[0182] Terman, B., Dougher-Vermazen, M., Carrion, M., Dimitrov, D.,
Armellino, D., Gospodarowicz, D., and Bohlen, P. (1992)
Identification on the KDR tyrosine kinase as a receptor for
vascular endothelial growth factor Biochem. Biophys. Res. Commun.,
187, 1579-1586.
[0183] Terman, B. I., Khandke, L., Dougher-Vermazan, M., Maglione,
D., Lassam, N. J., Gospodarowicz, D., Persico, M. G., Bohlen, P.
and Eisenger M. (1994) VEGF receptor subtypes KDR and FLT1 show
different sensitivities to heparin and placenta growth factor.
Growth factor, 11, 187-195.
[0184] Tisher, E., Mitchell, R., Hartman, T., Silva, M.,
Gospodarowicz, D., Fiddes, J. C. and Abraham, J. A. (1991) The
human gene for vascular endothelial growth factor. Multiple protein
forms are encoded through alternative exon splicing. J. Biol.
Chem., 266, 11947-11954.
[0185] Thorpe, P. E and Burrows, F. J. (1995) Antibody-directed
targeting of the vasculature of solid tumors. Breast Cancer
Research and Treatments, 36, 237-251.
[0186] Waltenberger, J., Claesson-Welsh, L., Siegbahn, M. and
Heldin, C. H. (1994) Different signal transduction properties of
KDR and FLT-1, two receptors for vascular endothelial growth
factor. J. Biol. Chem., 269, 26988-26995.
[0187] Watters, J. M., Telleman, P. and Junghans R. P. (1997) An
optimized method for cell-based phage displayed panning.
Immunotechnol., 3, 21-29.
[0188] Weidner, N., Semple, J. P., Welch, W. R. and Folkman, J.
(1991) Tumor angiogenesis and metastasis-correlation in invasive
breast carcinoma. N. Engl. J. Med., 324, 1-8.
[0189] Wizigmann-Voos, S., Breier, G., Risau, W. and Plate, K. H.
(1995) Up-regulation of vascular endothelial growth factor and its
receptor in von Hippel-Lindau disease-associated and sporadic
hemangioblastomas. Cancer Res., 55, 1358-1364.
[0190] Yayon, A., Aviezer, D., Safran, M., Gross, J. L., Heldman,
Y., Cabilly, S., Givol, D. and Katchalski-Katzir, E. (1993)
Isolation of peptides that inhibit binding of basic fibroblast
growth factor to its receptor from a random phage-epitope library.
Proc. Natl. Acad. Sci. USA, 90, 10643-10647.
[0191] Young, R. C. (1989) Drug resistance: the clinical problem.
Cancer treat. Res., 48, 1-12.
* * * * *