U.S. patent application number 10/407481 was filed with the patent office on 2004-07-15 for vaccines.
Invention is credited to Bassols, Carlota Vinals Y De, Cassart, Jean-Pol, Coche, Thierry, Palmantier, Remi M..
Application Number | 20040138112 10/407481 |
Document ID | / |
Family ID | 9898284 |
Filed Date | 2004-07-15 |
United States Patent
Application |
20040138112 |
Kind Code |
A1 |
Cassart, Jean-Pol ; et
al. |
July 15, 2004 |
Vaccines
Abstract
Compositions and methods for the therapy and diagnosis of
cancer, particularly lung, colon, colorectal and breast cancer, are
disclosed. Illustrative compositions comprise one or more Cripto
tumor polypeptides, immunogenic portions thereof, polynucleotides
that encode such polypeptides, antigen presenting cell that
expresses such polypeptides, and T cells that are specific for
cells expressing such polypeptides. The disclosed compositions are
useful, for example, in the diagnosis, prevention and/or treatment
of diseases, particularly lung, colon, colorectal and breast
cancer.
Inventors: |
Cassart, Jean-Pol;
(Rixensart, BE) ; Coche, Thierry; (Rixensart,
BE) ; Palmantier, Remi M.; (Rixensart, BE) ;
Bassols, Carlota Vinals Y De; (Rixensart, BE) |
Correspondence
Address: |
SMITHKLINE BEECHAM CORPORATION
CORPORATE INTELLECTUAL PROPERTY-US, UW2220
P. O. BOX 1539
KING OF PRUSSIA
PA
19406-0939
US
|
Family ID: |
9898284 |
Appl. No.: |
10/407481 |
Filed: |
April 4, 2003 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
10407481 |
Apr 4, 2003 |
|
|
|
10362597 |
Aug 4, 2003 |
|
|
|
10362597 |
Aug 4, 2003 |
|
|
|
PCT/EP01/09646 |
Aug 20, 2001 |
|
|
|
Current U.S.
Class: |
435/7.23 ;
514/19.3; 514/44R |
Current CPC
Class: |
A61K 2039/53 20130101;
A61K 2039/80 20180801; A61K 2039/812 20180801; A61K 39/00 20130101;
A61P 35/00 20180101; A61P 37/00 20180101; A61P 37/04 20180101; A61K
38/00 20130101; C07K 14/475 20130101; A61K 2039/5158 20130101; A61P
43/00 20180101; A61K 2039/82 20180801; C07K 2319/00 20130101; A61K
2039/86 20180801 |
Class at
Publication: |
514/012 ;
514/044 |
International
Class: |
A61K 048/00; A61K
038/17 |
Claims
1. A method for inhibiting development of a cancer in a patient,
comprising the steps of: (e) incubating CD4+ and/or CD8+T cells
isolated from a patient with at least one component selected from
the group consisting of SEQ ID NO:11 or SEQ ID NO:12; and (f)
administering to the patient an effective amount of the T cells,
and thereby inhibiting development of a cancer in the patient.
2. The method of claim 1, further comprising allowing the T cells
to proliferate.
3. A method for producing an immunogenic response to a
tumor-associated antigen in an animal comprising administering a
first component comprising a polynucleotide encoding a fragment of
the tumor-associated antigen to the animal.
4. The method of claim 3, wherein the tumor-associated antigen is
Cripto.
5. The method of claim 3, wherein the polynucleotide encodes SEQ ID
NO:11 and does not encode SEQ ID NO:3 or SEQ ID NO:4.
6. The method of claim 3, wherein the polynucleotide encodes SEQ ID
NO:12 and does not encode SEQ ID NO:3 or SEQ ID NO:4.
7. The method of claim 3, wherein the polynucleotide is recombinant
DNA.
8. The method of claim 3, further comprising admixing the
polynucleotide and a second component comprising an
immunostimulant, adjuvant and physiologically acceptable
carrier.
9. A method of inducing an immunoresponse to Cripto in an animal
comprising repeatedly administering a composition comprising a
first component comprising SEQ ID NO:11 or SEQ ID NO:12.
10. The method of claim 9 further comprising admixing the first
component and a second component comprising a physiologically
acceptable carrier, adjuvant and immunostimulant prior to
administering the first component to the animal.
Description
CROSS REFERENCES
[0001] This application is a continuation-in-part of international
application PCT/EP01/09646, filed 20 Aug. 2000, and filed in the
United States on 20 Aug. 2000, application Ser. No. 10/362,597, the
entirety of which is incorporated herein by reference.
TECHNICAL FIELD OF THE INVENTION
[0002] The present invention relates generally to therapy of
cancer, such as colon, colorectal, breast, bladder, lung and
endometrial cancer. The invention is more specifically related to
polypeptides, comprising at least a portion of a cripto protein
tumor protein, and to polynucleotides encoding such polypeptides,
in particular pharmaceutical compositions, e.g., vaccines, and
other compositions for the treatment of cancer that are
cripto-expressing carcinomas such as certain non-small long cell
carcinoma, breast, colon, colorectal cancer.
BACKGROUND OF THE INVENTION
[0003] CRIPTO is a 188 amino acid protein shares homologies with
the epidermal growth factor (EGF) family (EMBO Journal (1989) Vol 8
(7) pp1987-1991).
[0004] huCRIPTO mRNA is detected only in undifferentiated cells and
disappear after cell differentiation mCRIPTO is expressed during
pregnancy and lactation (induces branching morphogenesis in mammary
epithelial cells) and is suspected to be an autocrine growth factor
for normal breast cells. CRIPTO is required for correct orientation
of the anterior-posterior axis in the mouse embryo.
[0005] Human cripto gene has been expressed U.S. Pat. No. 5,654,140
herein incorporated by reference in its entirety.
[0006] Cancer is a significant health problem throughout the world.
Although advances have been made in detection and therapy of
cancer, no vaccine or other universally successful method for
prevention and/or treatment is currently available. Current
therapies, which are generally based on a combination of
chemotherapy or surgery and radiation, continue to prove inadequate
in many patients.
[0007] Colon cancer is the second most frequently diagnosed
malignancy in the United Sates as well as the second most common
cause of cancer death. An estimated 95,600 new cases of colon
cancer will have been diagnosed in 1998, with an estimated 47,700
deaths. The five-year survival rate for patients with colorectal
cancer detected in an early-localised stage is 92%, unfortunately,
only 37% of colorectal cancer is diagnosed at this stage, the
survival stage. The survival rate drops to 64% if the cancer is
allowed to spread to adjacent organs or lymph nodes, and to 7% in
patients with distant metastases.
[0008] The prognosis of colon cancer is directly related to the
degree of penetration of the tumour through the bowel wall, to the
level of metastasis, to the presence or absence of nodal
involvement, consequently, early detection and treatment are
especially important. Currently, diagnosis is aided by the use of
screening assays for fecal occult blood, sigmoidoscopy, colonoscopy
and double contrast barium enemas. Treatment regimens are
determined by the type and stage of the cancer, and include
surgery, radiation therapy and/or chemotherapy. Recurrence
following surgery (the most common form of therapy) is a major
problem and is often the ultimate cause of death. In spite of
considerable research into therapies for the disease, colon cancer
remains difficult to diagnose and treat. Accordingly, there is a
need in the art for improved methods for treating such cancers. The
present invention fulfils these needs and further provides other
related advantages.
[0009] Breast cancer is a significant health problem for women in
the United States and throughout the world. Although advances have
been made in detection and treatment of the disease, breast cancer
remains the second leading cause of cancer-related deaths in women,
affecting more than 180,000 women in the United States each year.
For women in North America, the lifetime odds of getting breast
cancer are now one in eight.
[0010] No vaccine or other universally successful method for the
prevention or treatment of breast cancer is currently available.
Management of the disease currently relies on a combination of
early diagnosis (through routine breast screening procedures) and
aggressive treatment which may including one or more of a variety
of treatments such as surgery, radiotherapy, chemotherapy and
hormone therapy. The course of treatment for a particular breast
cancer is often selected based on a variety of prognostic
parameters, including an analysis of specific tumour markers. See,
eg Porter-Jordan and Lippman, Breast Cancer 8:73-100 (1994).
However, the use of established markers often leads to a result
that this is difficult to interpret, and the high mortality
observed in breast cancer patients indicates that improvements are
needed in the treatment and prevention of the disease.
[0011] Lung cancer is the primary cause of cancer death among both
men and women in the US, with an estimated 172,000 new cases being
reported in 1994. The five-year survival rate among all lung cancer
patients, regardless of the state of disease at diagnosis is only
13%. This contrasts with a five-year survival rate of 46% among
cases detected while the disease is still localised. However, only
16% of lung cancers are discovered before the disease has
spread.
[0012] In spite of considerable research into therapies for these
and other cancers, breast, colon and colorectal remains difficult
to diagnose and treat effectively. Accordingly, there is a need in
the art for improved methods for treating and preventing such
cancers. The present invention fulfills these needs and further
provides other related advantages.
SUMMARY OF THE INVENTION
[0013] In one aspect, the present invention provides a method for
inhibiting the development of a cancer in a patient, comprising the
steps of:
[0014] (a) incubating CD4+ and/or CD8+ T cells isolated from a
patient with at least one component selected from the group
consisting of SEQ ID NO:11 or SEQ ID NO:12; and
[0015] (b) administering to the patient an effective amount of the
T cells, and thereby inhibiting the development of a cancer in the
patient.
[0016] In another aspect, the invention provides a method for
producing an immunogenic response to a tumor-associated antigen in
an animal comprising administering a first component comprising a
polynucleotide encoding a fragment of the tumor-associated antigen
to the animal.
[0017] In another aspect, the invention provides a method of
inducing an immunoresponse to Cripto in an animal comprising
repeatedly administering a composition comprising a first component
comprising SEQ ID NO:11 or SEQ ID NO:12.
[0018] The present invention, in another aspect, provides
polypeptide compositions comprising an amino acid sequence that is
encoded by a polynucleotide sequence described above.
[0019] The polypeptides and/or polynucleotides of the present
invention are immunogenic, i.e., they are capable of eliciting an
immune response, particularly a humoral and/or cellular immune
response, when if necessary, they are conjugated to a suitable
carrier and/or adjuvanted.
[0020] The present invention further provides fragments, variants
and/or derivatives of the disclosed polypeptide and/or
polynucleotide sequences, wherein the fragments, variants and/or
derivatives preferably have a level of immunogenic activity of at
least about 50%, preferably at least about 70% and more preferably
at least about 90% of the level of immunogenic activity of a
polypeptide sequence set forth in SEQ ID No: 2 or 4 or a
polypeptide sequence encoded by a polynucleotide sequence set forth
in SEQ ID NO: 1 or 3.
[0021] The present invention further provides polynucleotides that
encode a polypeptide described above, expression vectors comprising
such polynucleotides and host cells transformed or transfected with
such expression vectors.
[0022] Within other aspects, the present invention provides
pharmaceutical compositions comprising a polypeptide or
polynucleotide as described above and a physiologically acceptable
carrier.
[0023] Within a related aspect of the present invention, the
pharmaceutical compositions, e.g., vaccine compositions, are
provided for prophylactic or therapeutic applications. Such
compositions generally comprise an immunogenic polypeptide or
polynucleotide of the invention and an immunostimulant, such as an
adjuvant.
[0024] Within further aspects, the present invention provides
pharmaceutical compositions comprising: (a) an antigen presenting
cell that expresses a polypeptide as described above and (b) a
pharmaceutically acceptable carrier or excipient. Illustrative
antigen presenting cells include dendritic cells, macrophages,
monocytes, fibroblasts and B cells.
[0025] Within related aspects, pharmaceutical compositions are
provided that comprise: (a) an antigen presenting cell that
expresses a polypeptide as described above and (b) an
immunostimulant.
[0026] The present invention further provides, in other aspects,
fusion proteins that comprise at least one polypeptide as described
above, as well as polynucleotides encoding such fusion proteins,
typically in the form of pharmaceutical compositions, e.g., vaccine
compositions, comprising a physiologically acceptable carrier
and/or an immunostimulant. The fusion proteins may comprise
multiple immunogenic polypeptides or portions/variants thereof, as
described herein, and may further comprise one or more polypeptide
segments for facilitating the expression, purification and/or
immunogenicity of the polypeptide(s).
[0027] Within further aspects, the present invention provides
methods for stimulating an immune response in a patient, preferably
a T cell response in a human patient, comprising administering a
pharmaceutical composition described herein. The patient may be
afflicted with lung or colon cancer or colorectal cancer or breast
cancer, in which case the methods provide treatment for the
disease, or patient considered at risk for such a disease may be
treated prophylactically. In particular the patient will be
afflicted with a tumour expressing cripto antigens.
[0028] Within further aspects, the present invention provides
methods for inhibiting the development of a cancer in a patient,
comprising administering to a patient a pharmaceutical composition
as recited above. The patient may be afflicted with lung, colon,
colorectal or breast cancer, in which case the methods provide
treatment for the disease, or patient considered at risk for such a
disease may be treated prophylactically.
[0029] The present invention further provides, within other
aspects, methods for removing tumor cells from a biological sample,
comprising contacting a biological sample with T cells that
specifically react with a polypeptide of the present invention,
wherein the step of contacting is performed under conditions and
for a time sufficient to permit the removal of cells expressing the
protein from the sample.
[0030] Within related aspects, methods are provided for inhibiting
the development of a cancer in a patient, comprising administering
to a patient a biological sample treated as described above.
[0031] Methods are further provided, within other aspects, for
stimulating and/or expanding T cells specific for a polypeptide of
the present invention, comprising contacting T cells with one or
more of: (i) a polypeptide as described above; (ii) a
polynucleotide encoding such a polypeptide; and/or (iii) an antigen
presenting cell that expresses such a polypeptide; under conditions
and for a time sufficient to permit the stimulation and/or
expansion of T cells. Isolated T cell populations comprising T
cells prepared as described above are also provided.
[0032] Within further aspects, the present invention provides
methods for inhibiting the development of a cancer in a patient,
comprising administering to a patient an effective amount of a T
cell population as described above.
[0033] The present invention further provides methods for
inhibiting the development of a cancer in a patient, comprising the
steps of: (a) incubating CD4+ and/or CD8+ T cells isolated from a
patient with one or more of: (i) a polypeptide comprising at least
an immunogenic portion of a cripto polypeptide disclosed herein;
(ii) a polynucleotide encoding such a polypeptide; and (iii) an
antigen-presenting cell that expressed such a polypeptide; and (b)
administering to the patient an effective amount of the
proliferated T cells, and thereby inhibiting the development of a
cancer in the patient. Proliferated cells may, but need not, be
cloned prior to administration to the patient.
[0034] These and other aspects of the present invention will become
apparent upon reference to the following detailed description. All
references disclosed herein are hereby incorporated by reference in
their entirety as if each was incorporated individually.
BRIEF DESCRIPTION OF THE DRAWINGS AND SEQUENCE IDENTIFIERS
[0035] SEQ ID NO: 1 Cripto 1 Polynucleotide
[0036] SEQ ID NO: 2 Cripto 3 Polynucleotide
[0037] SEQ ID NO: 2 Cripto 3 Polypeptide1
[0038] SEQ ID NO: 3 Cripto 1 Polypeptide
[0039] SEQ ID NO: 4 Cripto 3 Polypeptide
[0040] SEQ ID NO: 5 Cripto Polynucleotide as described in U.S. Pat.
No. 5,654,140
[0041] SEQ ID NO: 6 Cripto Polynucleotide as described in U.S. Pat.
No. 5,654,140
[0042] SEQ ID NOS: 7-10 PCR primers
[0043] SEQ ID NOS: 11 & 12 synthetic Cripto 1 peptides
[0044] SEQ ID NOS: 13-94 Epitopes from Cripto 1 and 3
[0045] SEQ ID NO: 95 Cripto 1 variant Polynucleotide
[0046] SEQ ID NO: 96 Cripto 1 variant Polypeptide
DETAILED DESCRIPTION OF THE INVENTION
[0047] The present invention is directed generally to compositions
and their use in the therapy and diagnosis of cancer, particularly
cripto expressing cancer and metastases including Cripto expressing
lung, colon, colorectal and breast cancers. As described further
below, illustrative compositions of the present invention include,
but are not restricted to, polypeptides, particularly immunogenic
polypeptides, polynucleotides encoding such polypeptides,
antibodies and other binding agents, antigen presenting cells
(APCs) and immune system cells (e.g., T cells).
[0048] The present invention provides a method for inhibiting the
development of a cancer in a patient, comprising the steps of:
[0049] (c) incubating CD4+ and/or CD8+ T cells isolated from a
patient with at least one component selected from the group
consisting of SEQ ID NO:11 or SEQ ID NO:12; and
[0050] (d) administering to the patient an effective amount of the
T cells, and thereby inhibiting the development of a cancer in the
patient.
[0051] In one aspect of the invention, the T cells are proliferated
prior to being administered ot the patient.
[0052] In another embodiment, a method is provided for producing an
immunogenic response to a tumor-associated antigen in an animal
comprising administering a first component comprising a
polynucleotide encoding a fragment of the tumor-associated antigen
to the animal. In one aspect of the invention, the tumor-associated
antigen is Cripto. In another aspect, the polynucleotide encodes
SEQ ID NO:11 and does not encode SEQ ID NO:3 or SEQ ID NO:4. In
another aspect, the polynucleotide encodes SEQ ID NO:12 and does
not encode SEQ ID NO:3 or SEQ ID NO:4. In yet another aspect of the
invention, the polynucleotide is recombinant DNA. In yet another
aspect, the polynucleotide is admixed with a second component
comprising an immunostimulant, adjuvant and physiologically
acceptable carrier.
[0053] In another embodiment, a method is provided for inducing an
immunoresponse to Cripto in an animal comprising repeatedly
administering a composition comprising a first component comprising
SEQ ID NO:11 or SEQ ID NO:12. In yet another aspect, the first
component is admixed with a second component comprising a
physiologically acceptable carrier, adjuvant and immunostimulant
prior to administering the first component to the animal.
[0054] The practice of the present invention will employ, unless
indicated specifically to the contrary, conventional methods of
virology, immunology, microbiology, molecular biology and
recombinant DNA techniques within the skill of the art, many of
which are described below for the purpose of illustration. Such
techniques are explained fully in the literature. See, e.g.,
Sambrook, et al. Molecular Cloning: A Laboratory Manual (2nd
Edition, 1989); Maniatis et al. Molecular Cloning: A Laboratory
Manual (1982); DNA Cloning: A Practical Approach, vol. I & II
(D. Glover, ed.); Oligonucleotide Synthesis (N. Gait, ed., 1984);
Nucleic Acid Hybridization (B. Hames & S. Higgins, eds., 1985);
Transcription and Translation (B. Hames & S. Higgins, eds.,
1984); Animal Cell Culture (R. Freshney, ed., 1986); Perbal, A
Practical Guide to Molecular Cloning (1984).
[0055] All publications, patents and patent applications cited
herein, whether supra or infra, are hereby incorporated by
reference in their entirety.
[0056] As used in this specification and the appended claims, the
singular forms "a," "an" and "the" include plural references unless
the content clearly dictates otherwise.
[0057] Polypeptide Compositions
[0058] "Polypeptide(s)" refers to any peptide or protein comprising
two or more amino acids joined to each other by peptide bonds or
modified peptide bonds. "Polypeptide(s)" refers to both short
chains, commonly referred to as peptides, oligopeptides and
oligomers and to longer chains generally referred to as proteins.
Polypeptides may comprise amino acids other than the 20 gene
encoded amino acids. "Polypeptide(s)" include those modified either
by natural processes, such as processing and other
post-translational modifications, but also by chemical modification
techniques. Such modifications are well described in basic texts
and in more detailed monographs, as well as in a voluminous
research literature, and they are well known to those of skill in
the art. It will be appreciated that the same type of modification
may be present in the same or varying degree at several sites in a
given polypeptide. Also, a given polypeptide may comprise many
types of modifications. Modifications can occur anywhere in a
polypeptide, including the peptide backbone, the amino acid
side-chains, and the amino or carboxyl termini. Modifications
include, for example, acetylation, acylation, ADP-ribosylation,
amidation, covalent attachment of flavin, covalent attachment of a
heme moiety, covalent attachment of a nucleotide or nucleotide
derivative, covalent attachment of a lipid or lipid derivative,
covalent attachment of phosphotidylinositol, cross-linking,
cyclization, disulfide bond formation, demethylation, formation of
covalent cross-links, formation of cysteine, formation of
pyroglutamate, formylation, gamma-carboxylation, GPI anchor
formation, hydroxylation, iodination, methylation, myristoylation,
oxidation, proteolytic processing, phosphorylation, prenylation,
racemization, glycosylation, lipid attachment, sulfation,
gamma-carboxylation of glutamic acid residues, hydroxylation and
ADP-ribosylation, selenoylation, sulfation, transfer-RNA mediated
addition of amino acids to proteins, such as arginylation, and
ubiquitination. See, for instance, PROTEINS--STRUCTURE AND
MOLECULAR PROPERTIES, 2nd Ed., T. E. Creighton, W. H. Freeman and
Company, New York (1993) and Wold, F., Posttranslational Protein
Modifications: Perspectives and Prospects, pgs. 1-12 in
POSTTRANSLATIONAL COVALENT MODIFICATION OF PROTEINS, B. C. Johnson,
Ed., Academic Press, New York (1983); Seifter et al., Meth.
Enzymol. 182:626-646 (1990) and Rattan et al., Protein Synthesis:
Posttranslational Modifications and Aging, Ann. N.Y. Acad. Sci.
663: 48-62 (1992). Polypeptides may be branched or cyclic, with or
without branching. Cyclic, branched and branched circular
polypeptides may result from post-translational natural processes
and may be made by entirely synthetic methods, as well.
[0059] Particularly illustrative polypeptides of the present
invention comprise a sequence of at least 10 contiguous amino
acids, preferably 20, more preferably 30, 40, 50, 60, 70, 80, 90,
100, 110, 120, 130, 140, 150, 160, 170, 180 amino acids of the
cirpto protein of ID NO: 2 or 4.
[0060] In certain preferred embodiments, the polypeptides of the
invention are immunogenic, i.e., they react detectably within an
immunoassay (such as an ELISA or T-cell stimulation assay) with
antisera and/or T-cells from a patient with cripto expressing
cancer. Screening for immunogenic activity can be performed using
techniques well known to the skilled artisan. For example, such
screens can be performed using methods such as those described in
Harlow and Lane, Antibodies: A Laboratory Manual, Cold Spring
Harbor Laboratory, 1988. In one illustrative example, a polypeptide
may be immobilized on a solid support and contacted with patient
sera to allow binding of antibodies within the sera to the
immobilized polypeptide. Unbound sera may then be removed and bound
antibodies detected using, for example, .sup.125I-labeled Protein
A.
[0061] As would be recognized by the skilled artisan, immunogenic
portions of the polypeptides disclosed herein are also encompassed
by the present invention. An "immunogenic portion," as used herein,
is a fragment of an immunogenic polypeptide of the invention that
itself is immunologically reactive (i.e., specifically binds) with
the B-cells and/or T-cell surface antigen receptors that recognize
the polypeptide. Immunogenic portions may generally be identified
using well known techniques, such as those summarized in Paul,
Fundamental Immunology, 3rd ed., 243247 (Raven Press, 1993) and
references cited therein. Such techniques include screening
polypeptides for the ability to react with antigen-specific
antibodies, antisera and/or T-cell lines or clones. As used herein,
antisera and antibodies are "antigen-specific" if they specifically
bind to an antigen (i.e., they react with the protein in an ELISA
or other immunoassay, and do not react detectably with unrelated
proteins). Such antisera and antibodies may be prepared as
described herein, and using well-known techniques.
[0062] In one preferred embodiment, an immunogenic portion of a
polypeptide of the present invention is a portion that reacts with
antisera and/or T-cells at a level that is not substantially less
than the reactivity of the full-length polypeptide (e.g., in an
ELISA and/or T-cell reactivity assay). Preferably, the level of
immunogenic activity of the immunogenic portion is at least about
50%, preferably at least about 70% and most preferably greater than
about 90% of the immunogenicity for the full-length polypeptide. In
some instances, preferred immunogenic portions will be identified
that have a level of immunogenic activity greater than that of the
corresponding full-length polypeptide, e.g., having greater than
about 100% or 150% or more immunogenic activity.
[0063] In certain other embodiments, illustrative immunogenic
portions may include peptides in which an N-terminal leader
sequence and/or transmembrane domain have been deleted. Other
illustrative immunogenic portions will contain a small N- and/or
C-terminal deletion (e.g., 1-30 amino acids, preferably 5-15 amino
acids), relative to the mature protein.
[0064] In another embodiment, a polypeptide composition of the
invention may also comprise one or more polypeptides that are
immunologically reactive with T cells and/or antibodies generated
against a polypeptide of the invention, particularly a polypeptide
having an amino acid sequence disclosed herein, or to an
immunogenic fragment or variant thereof.
[0065] In another embodiment of the invention, polypeptides are
provided that comprise one or more polypeptides that are capable of
eliciting T cells and/or antibodies that are immunologically
reactive with one or more polypeptides described herein, or one or
more polypeptides encoded by contiguous nucleic acid sequences
contained in the polynucleotide sequences disclosed herein, or
immunogenic fragments or variants thereof, or to one or more
nucleic acid sequences which hybridize to one or more of these
sequences under conditions of moderate to high stringency.
[0066] The present invention, in another aspect, provides
polypeptide fragments comprising at least about 5, 10, 15, 20, 25,
50, 100, or 150 contiguous amino acids, or more, including all
intermediate lengths, of a polypeptide compositions set forth
herein, such as those set forth in SEQ ID NO: 2 or 4 or those
encoded by a polynucleotide sequence set forth in a sequence of SEQ
ID NO:1 or 3. It is preferred that the polypeptides comprise at
least one preferably a pluarality of epitopes as set forth in
sequence ID no 13 to 94. Optionally the frgaments are fused or
otherwise conjugated to a heterologous carrier.
[0067] In another aspect, the present invention provides variants
of the polypeptide compositions described herein. Polypeptide
variants generally encompassed by the present invention will
typically exhibit at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%,
93%, 94%, 95%, 96%, 97%, 98%, or 99% or more identity (determined
as described below), along its length, to a polypeptide sequences
set forth herein.
[0068] In one preferred embodiment, the polypeptide fragments and
variants provide by the present invention are immunologically
reactive with an antibody and/or T-cell that reacts with a
full-length polypeptide specifically set for the herein.
[0069] In another preferred embodiment, the polypeptide fragments
and variants provided by the present invention exhibit a level of
immunogenic activity of at least about 50%, preferably at least
about 70%, and most preferably at least about 90% or more of that
exhibited by a full-length polypeptide sequence specifically set
forth herein.
[0070] A polypeptide "variant," as the term is used herein, is a
polypeptide that typically differs from a polypeptide specifically
disclosed herein in one or more substitutions, deletions, additions
and/or insertions. Such variants may be naturally occurring or may
be synthetically generated, for example, by modifying one or more
of the above polypeptide sequences of the invention and evaluating
their immunogenic activity as described herein and/or using any of
a number of techniques well known in the art.
[0071] For example, certain illustrative variants of the
polypeptides of the invention include those in which one or more
portions, such as an N-terminal leader sequence or transmembrane
domain, have been removed. Other illustrative variants include
variants in which a small portion (e.g., 1-30 amino acids,
preferably 5-15 amino acids) has been removed from the N- and/or
C-terminal of the mature protein.
[0072] In many instances, a variant will contain conservative
substitutions. A "conservative substitution" is one in which an
amino acid is substituted for another amino acid that has similar
properties, such that one skilled in the art of peptide chemistry
would expect the secondary structure and hydropathic nature of the
polypeptide to be substantially unchanged. As described above,
modifications may be made in the structure of the polynucleotides
and polypeptides of the present invention and still obtain a
functional molecule that encodes a variant or derivative
polypeptide with desirable characteristics, e.g., with immunogenic
characteristics. When it is desired to alter the amino acid
sequence of a polypeptide to create an equivalent, or even an
improved, immunogenic variant or portion of a polypeptide of the
invention, one skilled in the art will typically change one or more
of the codons of the encoding DNA sequence according to Table
1.
[0073] For example, certain amino acids may be substituted for
other amino acids in a protein structure without appreciable loss
of interactive binding capacity with structures such as, for
example, antigen-binding regions of antibodies or binding sites on
substrate molecules. Since it is the interactive capacity and
nature of a protein that defines that protein's biological
functional activity, certain amino acid sequence substitutions can
be made in a protein sequence, and, of course, its underlying DNA
coding sequence, and nevertheless obtain a protein with like
properties. It is thus contemplated that various changes may be
made in the peptide sequences of the disclosed compositions, or
corresponding DNA sequences which encode said peptides without
appreciable loss of their biological utility or activity.
1TABLE 1 Amino Acid Codons Alanine Ala A GCA GCC GCG GCU Cysteine
Cys C UGC UGU Aspartic acid Asp D GAC GAU Glutamic acid Glu E GAA
GAG Phenylalanine Phe F UUC UUU Glycine Gly G GGA GGC GGG GGU
Histidine His H CAC CAU Isoleucine Ile I AUA AUC AUU Lysine Lys K
AAA AAG Leucine Leu L UUA UUG CUA CUC CUG CUU Methionine Met M AUG
Asparagine Asn N AAC AAU Proline Pro P CCA CCC CCG CCU Glutamine
Gln Q CAA CAG Arginine Arg R AGA AGG CGA CGC CGG CGU Serine Ser S
AGC AGU UCA UCC UCG UCU Threonine Thr T ACA ACC ACG ACU Valine Val
V GUA GUC GUG GUU Tryptophan Trp W UGG Tyrosine Tyr Y UAC UAU
[0074] In making such changes, the hydropathic index of amino acids
may be considered. The importance of the hydropathic amino acid
index in conferring interactive biologic function on a protein is
generally understood in the art (Kyte and Doolittle, 1982,
incorporated herein by reference). It is accepted that the relative
hydropathic character of the amino acid contributes to the
secondary structure of the resultant protein, which in turn defines
the interaction of the protein with other molecules, for example,
enzymes, substrates, receptors, DNA, antibodies, antigens, and the
like. Each amino acid has been assigned a hydropathic index on the
basis of its hydrophobicity and charge characteristics (Kyte and
Doolittle, 1982). These values are: isoleucine (+4.5); valine
(+4.2); leucine (+3.8); phenylalanine (+2.8); cysteine/cystine
(+2.5); methionine (+1.9); alanine (+1.8); glycine (-0.4);
threonine (-0.7); serine (-0.8); tryptophan (-0.9); tyrosine
(-1.3); proline (-1.6); histidine (-3.2); glutamate (-3.5);
glutamine (-3.5); aspartate (-3.5); asparagine (-3.5); lysine
(-3.9); and arginine (-4.5).
[0075] It is known in the art that certain amino acids may be
substituted by other amino acids having a similar hydropathic index
or score and still result in a protein with similar biological
activity, i.e. still obtain a biological functionally equivalent
protein. In making such changes, the substitution of amino acids
whose hydropathic indices are within .+-.2 is preferred, those
within +1 are particularly preferred, and those within .+-.0.5 are
even more particularly preferred. It is also understood in the art
that the substitution of like amino acids can be made effectively
on the basis of hydrophilicity. U.S. Pat. No. 4,554,101
(specifically incorporated herein by reference in its entirety),
states that the greatest local average hydrophilicity of a protein,
as governed by the hydrophilicity of its adjacent amino acids,
correlates with a biological property of the protein.
[0076] As detailed in U.S. Pat. No. 4,554,101, the following
hydrophilicity values have been assigned to amino acid residues:
arginine (+3.0); lysine (+3.0); aspartate (+3.0.+-.1); glutamate
(+3.0.+-.1); serine (+0.3); asparagine (+0.2); glutamine (+0.2);
glycine (0); threonine (-0.4); proline (-0.5.+-.1); alanine (-0.5);
histidine (-0.5); cysteine (-1.0); methionine (-1.3); valine
(-1.5); leucine (-1.8); isoleucine (-1.8); tyrosine (-2.3);
phenylalanine (-2.5); tryptophan (-3.4). It is understood that an
amino acid can be substituted for another having a similar
hydrophilicity value and still obtain a biologically equivalent,
and in particular, an immunologically equivalent protein. In such
changes, the substitution of amino acids whose hydrophilicity
values are within .+-.2 is preferred, those within .+-.1 are
particularly preferred, and those within .+-.0.5 are even more
particularly preferred.
[0077] As outlined above, amino acid substitutions are generally
therefore based on the relative similarity of the amino acid
side-chain substituents, for example, their hydrophobicity,
hydrophilicity, charge, size, and the like. Exemplary substitutions
that take various of the foregoing characteristics into
consideration are well known to those of skill in the art and
include: arginine and lysine; glutamate and aspartate; serine and
threonine; glutamine and asparagine; and valine, leucine and
isoleucine.
[0078] In addition, any polynucleotide may be further modified to
increase stability in vivo. Possible modifications include, but are
not limited to, the addition of flanking sequences at the 5' and/or
3' ends; the use of phosphorothioate or 2' O-methyl rather than
phosphodiesterase linkages in the backbone; and/or the inclusion of
nontraditional bases such as inosine, queosine and wybutosine, as
well as acetyl-methyl-, thio- and other modified forms of adenine,
cytidine, guanine, thymine and uridine.
[0079] Amino acid substitutions may further be made on the basis of
similarity in polarity, charge, solubility, hydrophobicity,
hydrophilicity and/or the amphipathic nature of the residues. For
example, negatively charged amino acids include aspartic acid and
glutamic acid; positively charged amino acids include lysine and
arginine; and amino acids with uncharged polar head groups having
similar hydrophilicity values include leucine, isoleucine and
valine; glycine and alanine; asparagine and glutamine; and serine,
threonine, phenylalanine and tyrosine. Other groups of amino acids
that may represent conservative changes include: (1) ala, pro, gly,
glu, asp, gln, asn, ser, thr; (2) cys, ser, tyr, thr; (3) val, ile,
leu, met, ala, phe; (4) lys, arg, his; and (5) phe, tyr, trp, his.
A variant may also, or alternatively, contain nonconservative
changes. In a preferred embodiment, variant polypeptides differ
from a native sequence by substitution, deletion or addition of
five amino acids or fewer. Variants may also (or alternatively) be
modified by, for example, the deletion or addition of amino acids
that have minimal influence on the immunogenicity, secondary
structure and hydropathic nature of the polypeptide.
[0080] As noted above, polypeptides may comprise a signal (or
leader) sequence at the N-terminal end of the protein, which
co-translationally or post-translationally directs transfer of the
protein. The polypeptide may also be conjugated to a linker or
other sequence for ease of synthesis, purification or
identification of the polypeptide (e.g., poly-His), or to enhance
binding of the polypeptide to a solid support. For example, a
polypeptide may be conjugated to an immunoglobulin Fc region.
[0081] When comparing polypeptide sequences, two sequences are said
to be "identical" if the sequence of amino acids in the two
sequences is the same when aligned for maximum correspondence, as
described below. Comparisons between two sequences are typically
performed by comparing the sequences over a comparison window to
identify and compare local regions of sequence similarity. A
"comparison window" as used herein, refers to a segment of at least
about 20 contiguous positions, usually 30 to about 75, 40 to about
50, in which a sequence may be compared to a reference sequence of
the same number of contiguous positions after the two sequences are
optimally aligned.
[0082] Optimal alignment of sequences for comparison may be
conducted using the Megalign program in the Lasergene suite of
bioinformatics software (DNASTAR, Inc., Madison, Wis.), using
default parameters. This program embodies several alignment schemes
described in the following references: Dayhoff, M. O. (1978) A
model of evolutionary change in proteins--Matrices for detecting
distant relationships. In Dayhoff, M. O. (ed.) Atlas of Protein
Sequence and Structure, National Biomedical Research Foundation,
Washington D.C. Vol. 5, Suppl. 3, pp. 345-358; Hein J. (1990)
Unified Approach to Alignment and Phylogenes pp. 626-645 Methods in
Enzymology vol. 183, Academic Press, Inc., San Diego, Calif.;
Higgins, D. G. and Sharp, P. M. (1989) CABIOS 5:151-153; Myers, E.
W. and Muller W. (1988) CABIOS 4:11-17; Robinson, E. D. (1971)
Comb. Theor 11:105; Santou, N. Nes, M. (1987) Mol. Biol. Evol.
4:406-425; Sneath, P. H. A. and Sokal, R. R. (1973) Numerical
Taxonomy--the Principles and Practice of Numerical Taxonomy,
Freeman Press, San Francisco, Calif.; Wilbur, W. J. and Lipman, D.
J. (1983) Proc. Natl. Acad., Sci. USA 80:726-730.
[0083] Alternatively, optimal alignment of sequences for comparison
may be conducted by the local identity algorithm of Smith and
Waterman (1981) Add. APL. Math 2:482, by the identity alignment
algorithm of Needleman and Wunsch (1970) J. Mol. Biol. 48:443, by
the search for similarity methods of Pearson and Lipman (1988)
Proc. Natl. Acad. Sci. USA 85: 2444, by computerized
implementations of these algorithms (GAP, BESTFIT, BLAST, FASTA,
and TFASTA in the Wisconsin Genetics Software Package, Genetics
Computer Group (GCG), 575 Science Dr., Madison, Wis.), or by
inspection.
[0084] One preferred example of algorithms that are suitable for
determining percent sequence identity and sequence similarity are
the BLAST and BLAST 2.0 algorithms, which are described in Altschul
et al. (1977) Nucl. Acids Res. 25:3389-3402 and Altschul et al.
(1990) J. Mol. Biol. 215:403-410, respectively. BLAST and BLAST 2.0
can be used, for example with the parameters described herein, to
determine percent sequence identity for the polynucleotides and
polypeptides of the invention. Software for performing BLAST
analyses is publicly available through the National Center for
Biotechnology Information. For amino acid sequences, a scoring
matrix can be used to calculate the cumulative score. Extension of
the word hits in each direction are halted when: the cumulative
alignment score falls off by the quantity X from its maximum
achieved value; the cumulative score goes to zero or below, due to
the accumulation of one or more negative-scoring residue
alignments; or the end of either sequence is reached. The BLAST
algorithm parameters W, T and X determine the sensitivity and speed
of the alignment.
[0085] In one preferred approach, the "percentage of sequence
identity" is determined by comparing two optimally aligned
sequences over a window of comparison of at least 20 positions,
wherein the portion of the polypeptide sequence in the comparison
window may comprise additions or deletions (i.e., gaps) of 20
percent or less, usually 5 to 15 percent, or 10 to 12 percent, as
compared to the reference sequences (which does not comprise
additions or deletions) for optimal alignment of the two sequences.
The percentage is calculated by determining the number of positions
at which the identical amino acid residue occurs in both sequences
to yield the number of matched positions, dividing the number of
matched positions by the total number of positions in the reference
sequence (i.e., the window size) and multiplying the results by 100
to yield the percentage of sequence identity.
[0086] Within other illustrative embodiments, a polypeptide may be
a fusion polypeptide that comprises multiple polypeptides as
described herein, or that comprises at least one polypeptide as
described herein and an unrelated sequence, such as a known tumor
protein. A fusion partner may, for example, assist in providing T
helper epitopes (an immunological fusion partner), preferably T
helper epitopes recognized by humans, or may assist in expressing
the protein (an expression enhancer) at higher yields than the
native recombinant protein. Certain preferred fusion partners are
both immunological and expression enhancing fusion partners. Other
fusion partners may be selected so as to increase the solubility of
the polypeptide or to enable the polypeptide to be targeted to
desired intracellular compartments. Still further fusion partners
include affinity tags, which facilitate purification of the
polypeptide.
[0087] Fusion polypeptides may generally be prepared using standard
techniques, including chemical conjugation. Preferably, a fusion
polypeptide is expressed as a recombinant polypeptide, allowing the
production of increased levels, relative to a non-fused
polypeptide, in an expression system. Briefly, DNA sequences
encoding the polypeptide components may be assembled separately,
and ligated into an appropriate expression vector. The 3' end of
the DNA sequence encoding one polypeptide component is ligated,
with or without a peptide linker, to the 5' end of a DNA sequence
encoding the second polypeptide component so that the reading
frames of the sequences are in phase. This permits translation into
a single fusion polypeptide that retains the biological activity of
both component polypeptides.
[0088] A peptide linker sequence may be employed to separate the
first and second polypeptide components by a distance sufficient to
ensure that each polypeptide folds into its secondary and tertiary
structures. Such a peptide linker sequence is incorporated into the
fusion polypeptide using standard techniques well known in the art.
Suitable peptide linker sequences may be chosen based on the
following factors: (1) their ability to adopt a flexible extended
conformation; (2) their inability to adopt a secondary structure
that could interact with functional epitopes on the first and
second polypeptides; and (3) the lack of hydrophobic or charged
residues that might react with the polypeptide functional epitopes.
Preferred peptide linker sequences contain Gly, Asn and Ser
residues. Other near neutral amino acids, such as Thr and Ala may
also be used in the linker sequence. Amino acid sequences which may
be usefully employed as linkers include those disclosed in Maratea
et al., Gene 40:39-46, 1985; Murphy et al., Proc. Natl. Acad. Sci.
USA 83:8258-8262, 1986; U.S. Pat. No. 4,935,233 and U.S. Pat. No.
4,751,180. The linker sequence may generally be from 1 to about 50
amino acids in length. Linker sequences are not required when the
first and second polypeptides have non-essential N-terminal amino
acid regions that can be used to separate the functional domains
and prevent steric interference.
[0089] The ligated DNA sequences are operably linked to suitable
transcriptional or translational regulatory elements. The
regulatory elements responsible for expression of DNA are located
only 5' to the DNA sequence encoding the first polypeptides.
Similarly, stop codons required to end translation and
transcription termination signals are only present 3' to the DNA
sequence encoding the second polypeptide.
[0090] The fusion polypeptide can comprise a polypeptide as
described herein together with an unrelated immunogenic protein,
such as an immunogenic protein capable of eliciting a recall
response. Examples of such proteins include tetanus, tuberculosis
and hepatitis proteins (see, for example, Stoute et al. New Engl.
J. Med., 336:86-91, 1997).
[0091] In one preferred embodiment, the immunological fusion
partner is derived from a Mycobacterium sp., such as a
Mycobacterium tuberculosis-derived Ra12 fragment. Ra12 compositions
and methods for their use in enhancing the expression and/or
immunogenicity of heterologous polynucleotide/polypeptide sequences
is described in U.S. Patent Application 60/158,585, the disclosure
of which is incorporated herein by reference in its entirety.
Briefly, Ra12 refers to a polynucleotide region that is a
subsequence of a Mycobacterium tuberculosis MTB32A nucleic acid.
MTB32A is a serine protease of 32 KD molecular weight encoded by a
gene in virulent and avirulent strains of M. tuberculosis. The
nucleotide sequence and amino acid sequence of MTB32A have been
described (for example, U.S. Patent Application 60/158,585; see
also, Skeiky et al., Infection and Immun. (1999) 67:3998-4007,
incorporated herein by reference). C-terminal fragments of the
MTB32A coding sequence express at high levels and remain as a
soluble polypeptides throughout the purification process. Moreover,
Ra12 may enhance the immunogenicity of heterologous immunogenic
polypeptides with which it is fused. One preferred Ra12 fusion
polypeptide comprises a 14 KD C-terminal fragment corresponding to
amino acid residues 192 to 323 of MTB32A. Other preferred Ra12
polynucleotides generally comprise at least about 15 consecutive
nucleotides, at least about 30 nucleotides, at least about 60
nucleotides, at least about 100 nucleotides, at least about 200
nucleotides, or at least about 300 nucleotides that encode a
portion of a Ra12 polypeptide. Ra12 polynucleotides may comprise a
native sequence (i.e., an endogenous sequence that encodes a Ra12
polypeptide or a portion thereof) or may comprise a variant of such
a sequence. Ra12 polynucleotide variants may contain one or more
substitutions, additions, deletions and/or insertions such that the
biological activity of the encoded fusion polypeptide is not
substantially diminished, relative to a fusion polypeptide
comprising a native Ra12 polypeptide. Variants preferably exhibit
at least about 70% identity, more preferably at least about 80%
identity and most preferably at least about 90% identity to a
polynucleotide sequence that encodes a native Ra12 polypeptide or a
portion thereof.
[0092] Within other preferred embodiments, an immunological fusion
partner is derived from protein D, a surface protein of the
gram-negative bacterium Haemophilus influenza B (WO 91/18926).
Preferably, a protein D derivative comprises approximately the
first third of the protein (e.g., the first N-terminal 100-110
amino acids), and a protein D derivative may be lipidated. Within
certain preferred embodiments, the first 109 residues of a
Lipoprotein D fusion partner is included on the N-terminus to
provide the polypeptide with additional exogenous T-cell epitopes
and to increase the expression level in E. coli (thus functioning
as an expression enhancer). The lipid tail ensures optimal
presentation of the antigen to antigen presenting cells. Other
fusion partners include the non-structural protein from influenzae
virus, NS1 (hemaglutinin). Typically, the N-terminal 81 amino acids
are used, although different fragments that include T-helper
epitopes may be used.
[0093] In another embodiment, the immunological fusion partner is
the protein known as LYTA, or a portion thereof (preferably a
C-terminal portion). LYTA is derived from Streptococcus pneumoniae,
which synthesizes an N-acetyl-L-alanine amidase known as amidase
LYTA (encoded by the LytA gene; Gene 43:265-292, 1986). LYTA is an
autolysin that specifically degrades certain bonds in the
peptidoglycan backbone. The C-terminal domain of the LYTA protein
is responsible for the affinity to the choline or to some choline
analogues such as DEAE. This property has been exploited for the
development of E. coli C-LYTA expressing plasmids useful for
expression of fusion proteins. Purification of hybrid proteins
containing the C-LYTA fragment at the amino terminus has been
described (see Biotechnology 10:795-798, 1992). Within a preferred
embodiment, a repeat portion of LYTA may be incorporated into a
fusion polypeptide. A repeat portion is found in the C-terminal
region starting at residue 178. A particularly preferred repeat
portion incorporates residues 188-305.
[0094] Yet another illustrative embodiment involves fusion
polypeptides, and the polynucleotides encoding them, wherein the
fusion partner comprises a targeting signal capable of directing a
polypeptide to the endosomal/lysosomal compartment, as described in
U.S. Pat. No. 5,633,234. An immunogenic polypeptide of the
invention, when fused with this targeting signal, will associate
more efficiently with MHC class II molecules and thereby provide
enhanced in vivo stimulation of CD4+ T-cells specific for the
polypeptide.
[0095] The cripto part of the fusion molecule may prefreably be the
whole length 188 aa protein of Cripto 1 or Cripto 3 or a fragment
thereof as described herein.
[0096] Polypeptides of the invention are prepared using any of a
variety of well known synthetic and/or recombinant techniques, the
latter of which are further described below. Polypeptides, portions
and other variants generally less than about 150 amino acids can be
generated by synthetic means, using techniques well known to those
of ordinary skill in the art. In one illustrative example, such
polypeptides are synthesized using any of the commercially
available solid-phase techniques, such as the Merrifield
solid-phase synthesis method, where amino acids are sequentially
added to a growing amino acid chain. See Merrifield, J. Am. Chem.
Soc. 85:2149-2146, 1963. Equipment for automated synthesis of
polypeptides is commercially available from suppliers such as
Perkin Elmer/Applied BioSystems Division (Foster City, Calif.), and
may be operated according to the manufacturer's instructions.
[0097] In general, polypeptide compositions (including fusion
polypeptides) of the invention are isolated. An "isolated"
polypeptide is one that is removed from its original environment.
For example, a naturally-occurring protein or polypeptide is
isolated if it is separated from some or all of the coexisting
materials in the natural system. Preferably, such polypeptides are
also purified, e.g., are at least about 90% pure, more preferably
at least about 95% pure and most preferably at least about 99%
pure.
[0098] Polynucleotide Compositions
[0099] "Polynucleotide(s)" generally refers to any
polyribonucleotide or polydeoxyribonucleotide, that may be
unmodified RNA or DNA or modified RNA or DNA. "Polynucleotide(s)"
include, without limitation, single- and double-stranded DNA, DNA
that is a mixture of single- and double-stranded regions or
single-, double- and triple-stranded regions, single- and
double-stranded RNA, and RNA that is mixture of single- and
double-stranded regions, hybrid molecules comprising DNA and RNA
that may be single-stranded or, more typically, double-stranded, or
triple-stranded regions, or a mixture of single- and
double-stranded regions. In addition, "polynucleotide" as used
herein refers to triple-stranded regions comprising RNA or DNA or
both RNA and DNA. The strands in such regions may be from the same
molecule or from different molecules. The regions may include all
of one or more of the molecules, but more typically involve only a
region of some of the molecules. One of the molecules of a
triple-helical region often is an oligonucleotide. As used herein,
the term "polynucleotide(s)" also includes DNAs or RNAs as
described above that comprise one or more modified bases. Thus,
DNAs or RNAs with backbones modified for stability or for other
reasons are "polynucleotide(s)" as that term is intended herein.
Moreover, DNAs or RNAs comprising unusual bases, such as inosine,
or modified bases, such as tritylated bases, to name just two
examples, are polynucleotides as the term is used herein. It will
be appreciated that a great variety of modifications have been made
to DNA and RNA that serve many useful purposes known to those of
skill in the art. The term "polynucleotide(s)" as it is employed
herein embraces such chemically, enzymatically or metabolically
modified forms of polynucleotides, as well as the chemical forms of
DNA and RNA characteristic of viruses and cells, including, for
example, simple and complex cells. "Polynucleotide(s)" also
embraces short polynucleotides often referred to as
oligonucleotide(s).
[0100] The present invention, in other aspects, provides
polynucleotide compositions that encode for the polypeptides of the
invention. The terms "DNA" and "polynucleotide" are used
essentially interchangeably herein to refer to a DNA molecule that
has been isolated free of total genomic DNA of a particular
species. "Isolated," as used herein, means that a polynucleotide is
substantially away from other coding sequences, and that the DNA
molecule does not contain large portions of unrelated coding DNA,
such as large chromosomal fragments or other functional genes or
polypeptide coding regions. Of course, this refers to the DNA
molecule as originally isolated, and does not exclude genes or
coding regions later added to the segment by the hand of man.
[0101] As will be understood by those skilled in the art, the
polynucleotide compositions of this invention can include genomic
sequences, extra-genomic and plasmid-encoded sequences and smaller
engineered gene segments that express, or may be adapted to
express, proteins, polypeptides, peptides and the like. Such
segments may be naturally isolated, or modified synthetically by
the hand of man.
[0102] As will be also recognized by the skilled artisan,
polynucleotides of the invention may be single-stranded (coding or
antisense) or double-stranded, and may be DNA (genomic, cDNA or
synthetic) or RNA molecules. RNA molecules may include HnRNA
molecules, which contain introns and correspond to a DNA molecule
in a one-to-one manner, and mRNA molecules, which do not contain
introns. Additional coding or non-coding sequences may, but need
not, be present within a polynucleotide of the present invention,
and a polynucleotide may, but need not, be linked to other
molecules and/or support materials.
[0103] Polynucleotides may comprise a native sequence (i.e., an
endogenous sequence that encodes a polypeptide/protein of the
invention or a portion thereof) or may comprise a sequence that
encodes a variant or derivative, preferably and immunogenic variant
or derivative, of such a sequence.
[0104] Typically, polynucleotide variants will contain one or more
substitutions, additions, deletions and/or insertions, preferably
such that the immunogenicity of the polypeptide encoded by the
variant polynucleotide is not substantially diminished relative to
a polypeptide encoded by a polynucleotide sequence specifically set
forth herein). The term "variants" should also be understood to
encompasses homologous genes of xenogenic origin.
[0105] In additional embodiments, the present invention provides
polynucleotide fragments comprising various lengths of contiguous
stretches of sequence identical to or complementary to one or more
of the SEQ ID NO:1 or 3. For example, polynucleotides are provided
by this invention that comprise at least about 10, 15, 20, 30, 40,
50, 75, 100, 150, 200, 300, 400, the SEQ ID NO: 1 as well as all
intermediate lengths there between. It will be readily understood
that "intermediate lengths", in this context, means any length
between the quoted values, such as 16, 17, 18, 19, etc.; 21, 22,
23, etc.; 30, 31, 32, etc.; 50, 51, 52, 53, etc.; 100, 101, 102,
103, etc.; 150, 151, 152, 153, etc.; including all integers through
200-500; 500-1,000, and the like. Particularly preferred
polynucleotides are those which encode the epitopes as set forth in
SEQ ID NOS: 13-94.
[0106] In another embodiment of the invention, polynucleotide
compositions are provided that are capable of hybridizing under
moderate to high stringency conditions to a polynucleotide sequence
provided herein, or a fragment thereof, or a complementary sequence
thereof. Hybridization techniques are well known in the art of
molecular biology. For purposes of illustration, suitable
moderately stringent conditions for testing the hybridization of a
polynucleotide of this invention with other polynucleotides include
prewashing in a solution of 5.times.SSC, 0.5% SDS, 1.0 mM EDTA (pH
8.0); hybridizing at 50.degree. C.-60.degree. C., 5.times.SSC,
overnight; followed by washing twice at 65.degree. C. for 20
minutes with each of 2.times., 0.5.times. and 0.2.times.SSC
containing 0.1% SDS. One skilled in the art will understand that
the stringency of hybridization can be readily manipulated, such as
by altering the salt content of the hybridization solution and/or
the temperature at which the hybridization is performed. For
example, in another embodiment, suitable highly stringent
hybridization conditions include those described above, with the
exception that the temperature of hybridization is increased, e.g.,
to 60-65.degree. C. or 65-70.degree. C.
[0107] In certain preferred embodiments, the polynucleotides
described above, e.g., polynucleotide variants, fragments and
hybridizing sequences, encode polypeptides that are immunologically
cross-reactive with a polypeptide sequence specifically set forth
in SEQ ID NO:1 or SEQ ID NO:3. In other preferred embodiments, such
polynucleotides encode polypeptides that have a level of
immunogenic activity of at least about 50%, preferably at least
about 70%, and more preferably at least about 90% of that for a
polypeptide sequence specifically set forth herein.
[0108] The polynucleotides of the present invention, or fragments
thereof, regardless of the length of the coding sequence itself,
may be combined with other DNA sequences, such as promoters,
polyadenylation signals, additional restriction enzyme sites,
multiple cloning sites, other coding segments, and the like, such
that their overall length may vary considerably. It is therefore
contemplated that a nucleic acid fragment of almost any length may
be employed, with the total length preferably being limited by the
ease of preparation and use in the intended recombinant DNA
protocol. For example, illustrative polynucleotide segments with
total lengths of about 10,000, about 5000, about 3000, about 2,000,
about 1,000, about 500, about 200, about 100, about 50 base pairs
in length, and the like, (including all intermediate lengths) are
contemplated to be useful in many implementations of this
invention.
[0109] When comparing polynucleotide sequences, two sequences are
said to be "identical" if the sequence of nucleotides in the two
sequences is the same when aligned for maximum correspondence, as
described below. Comparisons between two sequences are typically
performed by comparing the sequences over a comparison window to
identify and compare local regions of sequence similarity. A
"comparison window" as used herein, refers to a segment of at least
about 20 contiguous positions, usually 30 to about 75, 40 to about
50, in which a sequence may be compared to a reference sequence of
the same number of contiguous positions after the two sequences are
optimally aligned.
[0110] Optimal alignment of sequences for comparison may be
conducted using the Megalign program in the Lasergene suite of
bioinformatics software (DNASTAR, Inc., Madison, Wis.), using
default parameters. This program embodies several alignment schemes
described in the following references: Dayhoff, M. O. (1978) A
model of evolutionary change in proteins--Matrices for detecting
distant relationships. In Dayhoff, M. O. (ed.) Atlas of Protein
Sequence and Structure, National Biomedical Research Foundation,
Washington D.C. Vol. 5, Suppl. 3, pp. 345-358; Hein J. (1990)
Unified Approach to Alignment and Phylogenes pp. 626-645 Methods in
Enzymology vol. 183, Academic Press, Inc., San Diego, Calif.;
Higgins, D. G. and Sharp, P. M. (1989) CABIOS 5:151-153; Myers, E.
W. and Muller W. (1988) CABIOS 4:11-17; Robinson, E. D. (1971)
Comb. Theor 11:105; Santou, N. Nes, M. (1987) Mol. Biol. Evol.
4:406-425; Sneath, P. H. A. and Sokal, R. R. (1973) Numerical
Taxonomy--the Principles and Practice of Numerical Taxonomy,
Freeman Press, San Francisco, Calif.; Wilbur, W. J. and Lipman, D.
J. (1983) Proc. Natl. Acad., Sci. USA 80:726-730.
[0111] Alternatively, optimal alignment of sequences for comparison
may be conducted by the local identity algorithm of Smith and
Waterman (1981) Add. APL. Math 2:482, by the identity alignment
algorithm of Needleman and Wunsch (1970) J. Mol. Biol. 48:443, by
the search for similarity methods of Pearson and Lipman (1988)
Proc. Natl. Acad. Sci. USA 85: 2444, by computerized
implementations of these algorithms (GAP, BESTFIT, BLAST, FASTA,
and TFASTA in the Wisconsin Genetics Software Package, Genetics
Computer Group (GCG), 575 Science Dr., Madison, Wis.), or by
inspection.
[0112] One preferred example of algorithms that are suitable for
determining percent sequence identity and sequence similarity are
the BLAST and BLAST 2.0 algorithms, which are described in Altschul
et al. (1977) Nucl. Acids Res. 25:3389-3402 and Altschul et al.
(1990) J. Mol. Biol. 215:403-410, respectively. BLAST and BLAST 2.0
can be used, for example with the parameters described herein, to
determine percent sequence identity for the polynucleotides of the
invention. Software for performing BLAST analyses is publicly
available through the National Center for Biotechnology
Information. In one illustrative example, cumulative scores can be
calculated using, for nucleotide sequences, the parameters M
(reward score for a pair of matching residues; always >0) and N
(penalty score for mismatching residues; always <0). Extension
of the word hits in each direction are halted when: the cumulative
alignment score falls off by the quantity X from its maximum
achieved value; the cumulative score goes to zero or below, due to
the accumulation of one or more negative-scoring residue
alignments; or the end of either sequence is reached. The BLAST
algorithm parameters W, T and X determine the sensitivity and speed
of the alignment. The BLASTN program (for nucleotide sequences)
uses as defaults a wordlength (W) of 11, and expectation (E) of 10,
and the BLOSUM62 scoring matrix (see Henikoff and Henikoff (1989)
Proc. Natl. Acad. Sci. USA 89:10915) alignments, (B) of 50,
expectation (E) of 10, M=5, N=-4 and a comparison of both
strands.
[0113] Preferably, the "percentage of sequence identity" is
determined by comparing two optimally aligned sequences over a
window of comparison of at least 20 positions, wherein the portion
of the polynucleotide sequence in the comparison window may
comprise additions or deletions (i.e., gaps) of 20 percent or less,
usually 5 to 15 percent, or 10 to 12 percent, as compared to the
reference sequences (which does not comprise additions or
deletions) for optimal alignment of the two sequences. The
percentage is calculated by determining the number of positions at
which the identical nucleic acid bases occurs in both sequences to
yield the number of matched positions, dividing the number of
matched positions by the total number of positions in the reference
sequence (i.e., the window size) and multiplying the results by 100
to yield the percentage of sequence identity.
[0114] It will be appreciated by those of ordinary skill in the art
that, as a result of the degeneracy of the genetic code, there are
many nucleotide sequences that encode a polypeptide as described
herein. Some of these polynucleotides bear minimal homology to the
nucleotide sequence of any native gene. Nonetheless,
polynucleotides that vary due to differences in codon usage are
specifically contemplated by the present invention. Further,
alleles of the genes comprising the polynucleotide sequences
provided herein are within the scope of the present invention.
Alleles are endogenous genes that are altered as a result of one or
more mutations, such as deletions, additions and/or substitutions
of nucleotides. The resulting mRNA and protein may, but need not,
have an altered structure or function. Alleles may be identified
using standard techniques (such as hybridization, amplification
and/or database sequence comparison).
[0115] Therefore, in another embodiment of the invention, a
mutagenesis approach, such as site-specific mutagenesis, is
employed for the preparation of immunogenic variants and/or
derivatives of the polypeptides described herein. By this approach,
specific modifications in a polypeptide sequence can be made
through mutagenesis of the underlying polynucleotides that encode
them. These techniques provides a straightforward approach to
prepare and test sequence variants, for example, incorporating one
or more of the foregoing considerations, by introducing one or more
nucleotide sequence changes into the polynucleotide.
[0116] Site-specific mutagenesis allows the production of mutants
through the use of specific oligonucleotide sequences which encode
the DNA sequence of the desired mutation, as well as a sufficient
number of adjacent nucleotides, to provide a primer sequence of
sufficient size and sequence complexity to form a stable duplex on
both sides of the deletion junction being traversed. Mutations may
be employed in a selected polynucleotide sequence to improve,
alter, decrease, modify, or otherwise change the properties of the
polynucleotide itself, and/or alter the properties, activity,
composition, stability, or primary sequence of the encoded
polypeptide.
[0117] In certain embodiments of the present invention, the
inventors contemplate the mutagenesis of the disclosed
polynucleotide sequences to alter one or more properties of the
encoded polypeptide, such as the immunogenicity of a polypeptide
vaccine. The techniques of site-specific mutagenesis are well-known
in the art, and are widely used to create variants of both
polypeptides and polynucleotides. For example, site-specific
mutagenesis is often used to alter a specific portion of a DNA
molecule. In such embodiments, a primer comprising typically about
14 to about 25 nucleotides or so in length is employed, with about
5 to about 10 residues on both sides of the junction of the
sequence being altered.
[0118] As will be appreciated by those of skill in the art,
site-specific mutagenesis techniques have often employed a phage
vector that exists in both a single stranded and double stranded
form. Typical vectors useful in site-directed mutagenesis include
vectors such as the M13 phage. These phage are readily
commercially-available and their use is generally well-known to
those skilled in the art. Double-stranded plasmids are also
routinely employed in site directed mutagenesis that eliminates the
step of transferring the gene of interest from a plasmid to a
phage.
[0119] In general, site-directed mutagenesis in accordance herewith
is performed by first obtaining a single-stranded vector or melting
apart of two strands of a double-stranded vector that includes
within its sequence a DNA sequence that encodes the desired
peptide. An oligonucleotide primer bearing the desired mutated
sequence is prepared, generally synthetically. This primer is then
annealed with the single-stranded vector, and subjected to DNA
polymerizing enzymes such as E. coli polymerase I Klenow fragment,
in order to complete the synthesis of the mutation-bearing strand.
Thus, a heteroduplex is formed wherein one strand encodes the
original non-mutated sequence and the second strand bears the
desired mutation. This heteroduplex vector is then used to
transform appropriate cells, such as E. coli cells, and clones are
selected which include recombinant vectors bearing the mutated
sequence arrangement.
[0120] The preparation of sequence variants of the selected
peptide-encoding DNA segments using site-directed mutagenesis
provides a means of producing potentially useful species and is not
meant to be limiting as there are other ways in which sequence
variants of peptides and the DNA sequences encoding them may be
obtained. For example, recombinant vectors encoding the desired
peptide sequence may be treated with mutagenic agents, such as
hydroxylamine, to obtain sequence variants. Specific details
regarding these methods and protocols are found in the teachings of
Maloy et al., 1994; Segal, 1976; Prokop and Bajpai, 1991; Kuby,
1994; and Maniatis et al., 1982, each incorporated herein by
reference, for that purpose.
[0121] As used herein, the term "oligonucleotide directed
mutagenesis procedure" refers to template-dependent processes and
vector-mediated propagation which result in an increase in the
concentration of a specific nucleic acid molecule relative to its
initial concentration, or in an increase in the concentration of a
detectable signal, such as amplification. As used herein, the term
"oligonucleotide directed mutagenesis procedure" is intended to
refer to a process that involves the template-dependent extension
of a primer molecule. The term template dependent process refers to
nucleic acid synthesis of an RNA or a DNA molecule wherein the
sequence of the newly synthesized strand of nucleic acid is
dictated by the well-known rules of complementary base pairing
(see, for example, Watson, 1987). Typically, vector mediated
methodologies involve the introduction of the nucleic acid fragment
into a DNA or RNA vector, the clonal amplification of the vector,
and the recovery of the amplified nucleic acid fragment. Examples
of such methodologies are provided by U.S. Pat. No. 4,237,224,
specifically incorporated herein by reference in its entirety.
[0122] In another approach for the production of polypeptide
variants of the present invention, recursive sequence
recombination, as described in U.S. Pat. No. 5,837,458, may be
employed. In this approach, iterative cycles of recombination and
screening or selection are performed to "evolve" individual
polynucleotide variants of the invention having, for example,
enhanced immunogenic activity.
[0123] According to another embodiment of the present invention,
polynucleotide compositions comprising antisense oligonucleotides
are provided. Antisense oligonucleotides have been demonstrated to
be effective and targeted inhibitors of protein synthesis, and,
consequently, provide a therapeutic approach by which a disease can
be treated by inhibiting the synthesis of proteins that contribute
to the disease. The efficacy of antisense oligonucleotides for
inhibiting protein synthesis is well established. For example, the
synthesis of polygalactauronase and the muscarine type 2
acetylcholine receptor are inhibited by antisense oligonucleotides
directed to their respective mRNA sequences (U.S. Pat. No.
5,739,119 and U.S. Pat. No. 5,759,829). Further, examples of
antisense inhibition have been demonstrated with the nuclear
protein cyclin, the multiple drug resistance gene (MDG1), ICAM-1,
E-selectin, STK-1, striatal GABAA receptor and human EGF (Jaskulski
et al., Science. 1988 Jun. 10;240(4858):1544-6; Vasanthakumar and
Ahmed, Cancer Commun. 1989;1(4):225-32; Peris et al., Brain Res Mol
Brain Res. 1998 Jun. 15;57(2):310-20; U.S. Pat. No. 5,801,154; U.S.
Pat. No. 5,789,573; U.S. Pat. No. 5,718,709 and U.S. Pat. No.
5,610,288). Antisense constructs have also been described that
inhibit and can be used to treat a variety of abnormal cellular
proliferations, e.g. cancer (U.S. Pat. No. 5,747,470; U.S. Pat. No.
5,591,317 and U.S. Pat. No. 5,783,683).
[0124] Therefore, in certain embodiments, the present invention
provides oligonucleotide sequences that comprise all, or a portion
of, any sequence that is capable of specifically binding to
polynucleotide sequence described herein, or a complement thereof.
In one embodiment, the antisense oligonucleotides comprise DNA or
derivatives thereof. In another embodiment, the oligonucleotides
comprise RNA or derivatives thereof. In a third embodiment, the
oligonucleotides are modified DNAs comprising a phosphorothioated
modified backbone. In a fourth embodiment, the oligonucleotide
sequences comprise peptide nucleic acids or derivatives thereof. In
each case, preferred compositions comprise a sequence region that
is complementary, and more preferably substantially-complementary,
and even more preferably, completely complementary to one or more
portions of polynucleotides disclosed herein.
[0125] Selection of antisense compositions specific for a given
gene sequence is based upon analysis of the chosen target sequence
(i.e. in these illustrative examples the rat and human sequences)
and determination of secondary structure, Tm, binding energy,
relative stability, and antisense compositions were selected based
upon their relative inability to form dimers, hairpins, or other
secondary structures that would reduce or prohibit specific binding
to the target mRNA in a host cell.
[0126] Highly preferred target regions of the mRNA, are those which
are at or near the AUG translation initiation codon, and those
sequences which are substantially complementary to 5' regions of
the mRNA. These secondary structure analyses and target site
selection considerations can be performed, for example, using v.4
of the OLIGO primer analysis software and/or the BLASTN 2.0.5
algorithm software (Altschul et al., Nucleic Acids Res. 1997 Sep.
1;25(17):3389-402).
[0127] The use of an antisense delivery method employing a short
peptide vector, termed MPG (27 residues), is also contemplated. The
MPG peptide contains a hydrophobic domain derived from the fusion
sequence of HIV gp41 and a hydrophilic domain from the nuclear
localization sequence of SV40 T-antigen (Morris et al., Nucleic
Acids Res. 1997 Jul. 15;25(14):2730-6). It has been demonstrated
that several molecules of the MPG peptide coat the antisense
oligonucleotides and can be delivered into cultured mammalian cells
in less than 1 hour with relatively high efficiency (90%). Further,
the interaction with MPG strongly increases both the stability of
the oligonucleotide to nuclease and the ability to cross the plasma
membrane.
[0128] According to another embodiment of the invention, the
polynucleotide compositions described herein are used in the design
and preparation of ribozyme molecules for inhibiting expression of
the tumor polypeptides and proteins of the present invention in
tumor cells. Ribozymes are RNA-protein complexes that cleave
nucleic acids in a site-specific fashion. Ribozymes have specific
catalytic domains that possess endonuclease activity (Kim and Cech,
Proc Natl Acad Sci USA. 1987 December;84(24):8788-92; Forster and
Symons, Cell. 1987 Apr. 24;49(2):211-20). For example, a large
number of ribozymes accelerate phosphoester transfer reactions with
a high degree of specificity, often cleaving only one of several
phosphoesters in an oligonucleotide substrate (Cech et al., Cell.
1981 December;27(3 Pt 2):487-96; Michel and Westhof, J Mol Biol.
1990 Dec. 5;216(3):585-610; Reinhold-Hurek and Shub, Nature. 1992
May 14;357(6374):173-6). This specificity has been attributed to
the requirement that the substrate bind via specific base-pairing
interactions to the internal guide sequence ("IGS") of the ribozyme
prior to chemical reaction.
[0129] Six basic varieties of naturally-occurring enzymatic RNAs
are known presently. Each can catalyze the hydrolysis of RNA
phosphodiester bonds in trans (and thus can cleave other RNA
molecules) under physiological conditions. In general, enzymatic
nucleic acids act by first binding to a target RNA. Such binding
occurs through the target binding portion of a enzymatic nucleic
acid which is held in close proximity to an enzymatic portion of
the molecule that acts to cleave the target RNA. Thus, the
enzymatic nucleic acid first recognizes and then binds a target RNA
through complementary base-pairing, and once bound to the correct
site, acts enzymatically to cut the target RNA. Strategic cleavage
of such a target RNA will destroy its ability to direct synthesis
of an encoded protein. After an enzymatic nucleic acid has bound
and cleaved its RNA target, it is released from that RNA to search
for another target and can repeatedly bind and cleave new
targets.
[0130] The enzymatic nature of a ribozyme is advantageous over many
technologies, such as antisense technology (where a nucleic acid
molecule simply binds to a nucleic acid target to block its
translation) since the concentration of ribozyme necessary to
affect a therapeutic treatment is lower than that of an antisense
oligonucleotide. This advantage reflects the ability of the
ribozyme to act enzymatically. Thus, a single ribozyme molecule is
able to cleave many molecules of target RNA. In addition, the
ribozyme is a highly specific inhibitor, with the specificity of
inhibition depending not only on the base pairing mechanism of
binding to the target RNA, but also on the mechanism of target RNA
cleavage. Single mismatches, or base-substitutions, near the site
of cleavage can completely eliminate catalytic activity of a
ribozyme. Similar mismatches in antisense molecules do not prevent
their action (Woolf et al., Proc Natl Acad Sci USA. 1992 Aug.
15;89(16):7305-9). Thus, the specificity of action of a ribozyme is
greater than that of an antisense oligonucleotide binding the same
RNA site.
[0131] The enzymatic nucleic acid molecule may be formed in a
hammerhead, hairpin, a hepatitis .delta. virus, group I intron or
RNaseP RNA (in association with an RNA guide sequence) or
Neurospora VS RNA motif. Examples of hammerhead motifs are
described by Rossi et al. Nucleic Acids Res. 1992 Sep.
11;20(17):4559-65. Examples of hairpin motifs are described by
Hampel et al. (Eur. Pat. Appl. Publ. No. EP 0360257), Hampel and
Tritz, Biochemistry 1989 Jun. 13;28(12):4929-33; Hampel et al.,
Nucleic Acids Res. 1990 Jan. 25;18(2):299-304 and U.S. Pat. No.
5,631,359. An example of the hepatitis 6 virus motif is described
by Perrotta and Been, Biochemistry. 1992 Dec. 1;31(47):11843-52; an
example of the RNaseP motif is described by Guerrier-Takada et al.,
Cell. 1983 December;35(3 Pt 2):849-57; Neurospora VS RNA ribozyme
motif is described by Collins (Saville and Collins, Cell. 1990 May
18;61(4):685-96; Saville and Collins, Proc Natl Acad Sci USA. 1991
Oct. 1;88(19):8826-30; Collins and Olive, Biochemistry. 1993 Mar.
23;32(11):2795-9); and an example of the Group I intron is
described in (U.S. Pat. No. 4,987,071). All that is important in an
enzymatic nucleic acid molecule of this invention is that it has a
specific substrate binding site which is complementary to one or
more of the target gene RNA regions, and that it have nucleotide
sequences within or surrounding that substrate binding site which
impart an RNA cleaving activity to the molecule. Thus the ribozyme
constructs need not be limited to specific motifs mentioned
herein.
[0132] Ribozymes may be designed as described in Int. Pat. Appl.
Publ. No. WO 93/23569 and Int. Pat. Appl. Publ. No. WO 94/02595,
each specifically incorporated herein by reference) and synthesized
to be tested in vitro and in vivo, as described. Such ribozymes can
also be optimized for delivery. While specific examples are
provided, those in the art will recognize that equivalent RNA
targets in other species can be utilized when necessary.
[0133] Ribozyme activity can be optimized by altering the length of
the ribozyme binding arms, or chemically synthesizing ribozymes
with modifications that prevent their degradation by serum
ribonucleases (see e.g., Int. Pat. Appl. Publ. No. WO 92/07065;
Int. Pat. Appl. Publ. No. WO 93/15187; Int. Pat. Appl. Publ. No. WO
91/03162; Eur. Pat. Appl. Publ. No. 92110298.4; U.S. Pat. No.
5,334,711; and Int. Pat. Appl. Publ. No. WO 94/13688, which
describe various chemical modifications that can be made to the
sugar moieties of enzymatic RNA molecules), modifications which
enhance their efficacy in cells, and removal of stem II bases to
shorten RNA synthesis times and reduce chemical requirements.
[0134] Sullivan et al. (Int. Pat. Appl. Publ. No. WO 94/02595)
describes the general methods for delivery of enzymatic RNA
molecules. Ribozymes may be administered to cells by a variety of
methods known to those familiar to the art, including, but not
restricted to, encapsulation in liposomes, by iontophoresis, or by
incorporation into other vehicles, such as hydrogels,
cyclodextrins, biodegradable nanocapsules, and bioadhesive
microspheres. For some indications, ribozymes may be directly
delivered ex vivo to cells or tissues with or without the
aforementioned vehicles. Alternatively, the RNA/vehicle combination
may be locally delivered by direct inhalation, by direct injection
or by use of a catheter, infusion pump or stent. Other routes of
delivery include, but are not limited to, intravascular,
intramuscular, subcutaneous or joint injection, aerosol inhalation,
oral (tablet or pill form), topical, systemic, ocular,
intraperitoneal and/or intrathecal delivery. More detailed
descriptions of ribozyme delivery and administration are provided
in Int. Pat. Appl. Publ. No. WO 94/02595 and Int. Pat. Appl. Publ.
No. WO 93/23569, each specifically incorporated herein by
reference.
[0135] Another means of accumulating high concentrations of a
ribozyme(s) within cells is to incorporate the ribozyme-encoding
sequences into a DNA expression vector. Transcription of the
ribozyme sequences are driven from a promoter for eukaryotic RNA
polymerase I (pol I), RNA polymerase II (pol II), or RNA polymerase
III (pol III). Transcripts from pol II or pol III promoters will be
expressed at high levels in all cells; the levels of a given pol II
promoter in a given cell type will depend on the nature of the gene
regulatory sequences (enhancers, silencers, etc.) present nearby.
Prokaryotic RNA polymerase promoters may also be used, providing
that the prokaryotic RNA polymerase enzyme is expressed in the
appropriate cells Ribozymes expressed from such promoters have been
shown to function in mammalian cells. Such transcription units can
be incorporated into a variety of vectors for introduction into
mammalian cells, including but not restricted to, plasmid DNA
vectors, viral DNA vectors (such as adenovirus or adeno-associated
vectors), or viral RNA vectors (such as retroviral, semliki forest
virus, sindbis virus vectors).
[0136] In another embodiment of the invention, peptide nucleic
acids (PNAs) compositions are provided. PNA is a DNA mimic in which
the nucleobases are attached to a pseudopeptide backbone (Good and
Nielsen, Antisense Nucleic Acid Drug Dev. 1997 7(4) 431-37). PNA is
able to be utilized in a number methods that traditionally have
used RNA or DNA. Often PNA sequences perform better in techniques
than the corresponding RNA or DNA sequences and have utilities that
are not inherent to RNA or DNA. A review of PNA including methods
of making, characteristics of, and methods of using, is provided by
Corey (Trends Biotechnol 1997 June;15(6):224-9). As such, in
certain embodiments, one may prepare PNA sequences that are
complementary to one or more portions of the ACE mRNA sequence, and
such PNA compositions may be used to regulate, alter, decrease, or
reduce the translation of ACE-specific mRNA, and thereby alter the
level of ACE activity in a host cell to which such PNA compositions
have been administered.
[0137] PNAs have 2-aminoethyl-glycine linkages replacing the normal
phosphodiester backbone of DNA (Nielsen et al., Science 1991 Dec.
6;254(5037):1497-500; Hanvey et al., Science. 1992 Nov.
27;258(5087):1481-5; Hyrup and Nielsen, Bioorg Med Chem. 1996
January;4(1):5-23). This chemistry has three important
consequences: firstly, in contrast to DNA or phosphorothioate
oligonucleotides, PNAs are neutral molecules; secondly, PNAs are
achiral, which avoids the need to develop a stereoselective
synthesis; and thirdly, PNA synthesis uses standard Boc or Fmoc
protocols for solid-phase peptide synthesis, although other
methods, including a modified Merrifield method, have been
used.
[0138] PNA monomers or ready-made oligomers are commercially
available from PerSeptive Biosystems (Framingham, Mass.). PNA
syntheses by either Boc or Fmoc protocols are straightforward using
manual or automated protocols (Norton et al., Bioorg Med Chem. 1995
April;3(4):437-45). The manual protocol lends itself to the
production of chemically modified PNAs or the simultaneous
synthesis of families of closely related PNAs.
[0139] As with peptide synthesis, the success of a particular PNA
synthesis will depend on the properties of the chosen sequence. For
example, while in theory PNAs can incorporate any combination of
nucleotide bases, the presence of adjacent purines can lead to
deletions of one or more residues in the product. In expectation of
this difficulty, it is suggested that, in producing PNAs with
adjacent purines, one should repeat the coupling of residues likely
to be added inefficiently. This should be followed by the
purification of PNAs by reverse-phase high-pressure liquid
chromatography, providing yields and purity of product similar to
those observed during the synthesis of peptides.
[0140] Modifications of PNAs for a given application may be
accomplished by coupling amino acids during solid-phase synthesis
or by attaching compounds that contain a carboxylic acid group to
the exposed N-terminal amine. Alternatively, PNAs can be modified
after synthesis by coupling to an introduced lysine or cysteine.
The ease with which PNAs can be modified facilitates optimization
for better solubility or for specific functional requirements. Once
synthesized, the identity of PNAs and their derivatives can be
confirmed by mass spectrometry. Several studies have made and
utilized modifications of PNAs (for example, Norton et al., Bioorg
Med Chem. 1995 April;3(4):437-45; Petersen et al., J Pept Sci. 1995
May-Jun;1(3):175-83; Orum et al., Biotechniques. 1995
September;19(3):472-80; Footer et al., Biochemistry. 1996 Aug.
20;35(33):10673-9; Griffith et al., Nucleic Acids Res. 1995 Aug.
11;23(15):3003-8; Pardridge et al., Proc Natl Acad Sci USA. 1995
Jun. 6;92(12):5592-6; Boffa et al., Proc Natl Acad Sci USA. 1995
Mar. 14;92(6):1901-5; Gambacorti-Passerini et al., Blood. 1996 Aug.
15;88(4):1411-7; Armitage et al., Proc Natl Acad Sci USA. 1997 Nov.
11;94(23):12320-5; Seeger et al., Biotechniques. 1997
September;23(3):512-7). U.S. Pat. No. 5,700,922 discusses
PNA-DNA-PNA chimeric molecules and their uses in diagnostics,
modulating protein in organisms, and treatment of conditions
susceptible to therapeutics.
[0141] Methods of characterizing the antisense binding properties
of PNAs are discussed in Rose (Anal Chem. 1993 Dec.
15;65(24):3545-9) and Jensen et al. (Biochemistry. 1997 Apr.
22;36(16):5072-7). Rose uses capillary gel electrophoresis to
determine binding of PNAs to their complementary oligonucleotide,
measuring the relative binding kinetics and stoichiometry. Similar
types of measurements were made by Jensen et al. using BIAcore.TM.
technology.
[0142] Other applications of PNAs that have been described and will
be apparent to the skilled artisan include use in DNA strand
invasion, antisense inhibition, mutational analysis, enhancers of
transcription, nucleic acid purification, isolation of
transcriptionally active genes, blocking of transcription factor
binding, genome cleavage, biosensors, in situ hybridization, and
the like.
[0143] Polynucleotide Characterization and Expression
[0144] Polynucleotides compositions of the present invention may be
prepared and/or manipulated using any of a variety of well
established techniques (see generally, Sambrook et al., Molecular
Cloning: A Laboratory Manual, Cold Spring Harbor Laboratories, Cold
Spring Harbor, N.Y., 1989, and other like references).
[0145] In other embodiments of the invention, polynucleotide
sequences or fragments thereof which encode polypeptides of the
invention, or fusion proteins or functional equivalents thereof,
may be used in recombinant DNA molecules to direct expression of a
polypeptide in appropriate host cells. Due to the inherent
degeneracy of the genetic code, other DNA sequences that encode
substantially the same or a functionally equivalent amino acid
sequence may be produced and these sequences may be used to clone
and express a given polypeptide.
[0146] As will be understood by those of skill in the art, it may
be advantageous in some instances to produce polypeptide-encoding
nucleotide sequences possessing non-naturally occurring codons. For
example, codons preferred by a particular prokaryotic or eukaryotic
host can be selected to increase the rate of protein expression or
to produce a recombinant RNA transcript having desirable
properties, such as a half-life which is longer than that of a
transcript generated from the naturally occurring sequence.
[0147] Moreover, the polynucleotide sequences of the present
invention can be engineered using methods generally known in the
art in order to alter polypeptide encoding sequences for a variety
of reasons, including but not limited to, alterations which modify
the cloning, processing, and/or expression of the gene product. For
example, DNA shuffling by random fragmentation and PCR reassembly
of gene fragments and synthetic oligonucleotides may be used to
engineer the nucleotide sequences. In addition, site-directed
mutagenesis may be used to insert new restriction sites, alter
glycosylation patterns, change codon preference, produce splice
variants, or introduce mutations, and so forth.
[0148] In another embodiment of the invention, natural, modified,
or recombinant nucleic acid sequences may be ligated to a
heterologous sequence to encode a fusion protein. For example, to
screen peptide libraries for inhibitors of polypeptide activity, it
may be useful to encode a chimeric protein that can be recognized
by a commercially available antibody. A fusion protein may also be
engineered to contain a cleavage site located between the
polypeptide-encoding sequence and the heterologous protein
sequence, so that the polypeptide may be cleaved and purified away
from the heterologous moiety.
[0149] Sequences encoding a desired polypeptide may be synthesized,
in whole or in part, using chemical methods well known in the art
(see Caruthers, M. H. et al. (1980) Nucl. Acids Res. Symp. Ser.
215-223, Horn, T. et al. (1980) Nucl. Acids Res. Symp. Ser.
225-232). Alternatively, the protein itself may be produced using
chemical methods to synthesize the amino acid sequence of a
polypeptide, or a portion thereof. For example, peptide synthesis
can be performed using various solid-phase techniques (Roberge, J.
Y. et al. (1995) Science 269:202-204) and automated synthesis may
be achieved, for example, using the ABI 431A Peptide Synthesizer
(Perkin Elmer, Palo Alto, Calif.).
[0150] A newly synthesized peptide may be substantially purified by
preparative high performance liquid chromatography (e.g.,
Creighton, T. (1983) Proteins, Structures and Molecular Principles,
WH Freeman and Co., New York, N.Y.) or other comparable techniques
available in the art. The composition of the synthetic peptides may
be confirmed by amino acid analysis or sequencing (e.g., the Edman
degradation procedure). Additionally, the amino acid sequence of a
polypeptide, or any part thereof, may be altered during direct
synthesis and/or combined using chemical methods with sequences
from other proteins, or any part thereof, to produce a variant
polypeptide.
[0151] In order to express a desired polypeptide, the nucleotide
sequences encoding the polypeptide, or functional equivalents, may
be inserted into appropriate expression vector, i.e., a vector
which contains the necessary elements for the transcription and
translation of the inserted coding sequence. Methods which are well
known to those skilled in the art may be used to construct
expression vectors containing sequences encoding a polypeptide of
interest and appropriate transcriptional and translational control
elements. These methods include in vitro recombinant DNA
techniques, synthetic techniques, and in vivo genetic
recombination. Such techniques are described, for example, in
Sambrook, J. et al. (1989) Molecular Cloning, A Laboratory Manual,
Cold Spring Harbor Press, Plainview, N.Y., and Ausubel, F. M. et
al. (1989) Current Protocols in Molecular Biology, John Wiley &
Sons, New York. N.Y.
[0152] A variety of expression vector/host systems may be utilized
to contain and express polynucleotide sequences. These include, but
are not limited to, microorganisms such as bacteria transformed
with recombinant bacteriophage, plasmid, or cosmid DNA expression
vectors; yeast transformed with yeast expression vectors; insect
cell systems infected with virus expression vectors (e.g.,
baculovirus); plant cell systems transformed with virus expression
vectors (e.g., cauliflower mosaic virus, CaMV; tobacco mosaic
virus, TMV) or with bacterial expression vectors (e.g., Ti or
pBR322 plasmids); or animal cell systems.
[0153] The "control elements" or "regulatory sequences" present in
an expression vector are those non-translated regions of the
vector--enhancers, promoters, 5' and 3' untranslated regions--which
interact with host cellular proteins to carry out transcription and
translation. Such elements may vary in their strength and
specificity. Depending on the vector system and host utilized, any
number of suitable transcription and translation elements,
including constitutive and inducible promoters, may be used. For
example, when cloning in bacterial systems, inducible promoters
such as the hybrid lacZ promoter of the PBLUESCRIPT phagemid
(Stratagene, La Jolla, Calif.) or PSPORT1 plasmid (Gibco BRL,
Gaithersburg, Md.) and the like may be used. In mammalian cell
systems, promoters from mammalian genes or from mammalian viruses
are generally preferred. If it is necessary to generate a cell line
that contains multiple copies of the sequence encoding a
polypeptide, vectors based on SV40 or EBV may be advantageously
used with an appropriate selectable marker.
[0154] In bacterial systems, any of a number of expression vectors
may be selected depending upon the use intended for the expressed
polypeptide. For example, when large quantities are needed, for
example for the induction of antibodies, vectors which direct high
level expression of fusion proteins that are readily purified may
be used. Such vectors include, but are not limited to, the
multifunctional E. coli cloning and expression vectors such as
BLUESCRIPT (Stratagene), in which the sequence encoding the
polypeptide of interest may be ligated into the vector in frame
with sequences for the amino-terminal Met and the subsequent 7
residues of .beta.galactosidase so that a hybrid protein is
produced; pIN vectors (Van Heeke, G. and S. M. Schuster (1989) J.
Biol. Chem. 264:5503-5509); and the like. pGEX Vectors (Promega,
Madison, Wis.) may also be used to express foreign polypeptides as
fusion proteins with glutathione S-transferase (GST). In general,
such fusion proteins are soluble and can easily be purified from
lysed cells by adsorption to glutathione-agarose beads followed by
elution in the presence of free glutathione. Proteins made in such
systems may be designed to include heparin, thrombin, or factor XA
protease cleavage sites so that the cloned polypeptide of interest
can be released from the GST moiety at will.
[0155] In the yeast, Saccharomyces cerevisiae, a number of vectors
containing constitutive or inducible promoters such as alpha
factor, alcohol oxidase, and PGH may be used. For reviews, see
Ausubel et al. (supra) and Grant et al. (1987) Methods Enzymol
153:516-544.
[0156] In cases where plant expression vectors are used, the
expression of sequences encoding polypeptides may be driven by any
of a number of promoters. For example, viral promoters such as the
35S and 19S promoters of CaMV may be used alone or in combination
with the omega leader sequence from TMV (Takamatsu, N. (1987) EMBO
J. 6:307-311. Alternatively, plant promoters such as the small
subunit of RUBISCO or heat shock promoters may be used (Coruzzi, G.
et al. (1984) EMBO J. 3:1671-1680; Broglie, R. et al. (1984)
Science 224:838-843; and Winter, J. et al. (1991) Results Probl.
Cell Differ. 17:85-105). These constructs can be introduced into
plant cells by direct DNA transformation or pathogen-mediated
transfection. Such techniques are described in a number of
generally available reviews (see, for example, Hobbs, S. or Murry,
L. E. in McGraw Hill Yearbook of Science and Technology (1992)
McGraw Hill, New York, N.Y.; pp. 191-196).
[0157] An insect system may also be used to express a polypeptide
of interest. For example, in one such system, Autographa
californica nuclear polyhedrosis virus (AcNPV) is used as a vector
to express foreign genes in Spodoptera frugiperda cells or in
Trichoplusia larvae. The sequences encoding the polypeptide may be
cloned into a non-essential region of the virus, such as the
polyhedrin gene, and placed under control of the polyhedrin
promoter. Successful insertion of the polypeptide-encoding sequence
will render the polyhedrin gene inactive and produce recombinant
virus lacking coat protein. The recombinant viruses may then be
used to infect, for example, S. frugiperda cells or Trichoplusia
larvae in which the polypeptide of interest may be expressed
(Engelhard, E. K. et al. (1994) Proc. Natl. Acad. Sci.
91:3224-3227).
[0158] In mammalian host cells, a number of viral-based expression
systems are generally available. For example, in cases where an
adenovirus is used as an expression vector, sequences encoding a
polypeptide of interest may be ligated into an adenovirus
transcription/translation complex consisting of the late promoter
and tripartite leader sequence. Insertion in a non-essential E1 or
E3 region of the viral genome may be used to obtain a viable virus
which is capable of expressing the polypeptide in infected host
cells (Logan, J. and Shenk, T. (1984) Proc. Natl. Acad. Sci.
81:3655-3659). In addition, transcription enhancers, such as the
Rous sarcoma virus (RSV) enhancer, may be used to increase
expression in mammalian host cells.
[0159] Specific initiation signals may also be used to achieve more
efficient translation of sequences encoding a polypeptide of
interest. Such signals include the ATG initiation codon and
adjacent sequences. In cases where sequences encoding the
polypeptide, its initiation codon, and upstream sequences are
inserted into the appropriate expression vector, no additional
transcriptional or translational control signals may be needed.
However, in cases where only coding sequence, or a portion thereof,
is inserted, exogenous translational control signals including the
ATG initiation codon should be provided. Furthermore, the
initiation codon should be in the correct reading frame to ensure
translation of the entire insert. Exogenous translational elements
and initiation codons may be of various origins, both natural and
synthetic. The efficiency of expression may be enhanced by the
inclusion of enhancers which are appropriate for the particular
cell system which is used, such as those described in the
literature (Scharf, D. et al. (1994) Results Probl. Cell Differ.
20:125-162).
[0160] In addition, a host cell strain may be chosen for its
ability to modulate the expression of the inserted sequences or to
process the expressed protein in the desired fashion. Such
modifications of the polypeptide include, but are not limited to,
acetylation, carboxylation, glycosylation, phosphorylation,
lipidation, and acylation. Post-translational processing which
cleaves a "prepro" form of the protein may also be used to
facilitate correct insertion, folding and/or function. Different
host cells such as CHO, COS, HeLa, MDCK, HEK293, and WI38, which
have specific cellular machinery and characteristic mechanisms for
such post-translational activities, may be chosen to ensure the
correct modification and processing of the foreign protein.
[0161] For long-term, high-yield production of recombinant
proteins, stable expression is generally preferred. For example,
cell lines which stably express a polynucleotide of interest may be
transformed using expression vectors which may contain viral
origins of replication and/or endogenous expression elements and a
selectable marker gene on the same or on a separate vector.
Following the introduction of the vector, cells may be allowed to
grow for 1-2 days in an enriched media before they are switched to
selective media. The purpose of the selectable marker is to confer
resistance to selection, and its presence allows growth and
recovery of cells which successfully express the introduced
sequences. Resistant clones of stably transformed cells may be
proliferated using tissue culture techniques appropriate to the
cell type.
[0162] Any number of selection systems may be used to recover
transformed cell lines. These include, but are not limited to, the
herpes simplex virus thymidine kinase (Wigler, M. et al. (1977)
Cell 11:223-32) and adenine phosphoribosyltransferase (Lowy, I. et
al. (1990) Cell 22:817-23) genes which can be employed in tk.sup.-
or aprt.sup.-cells, respectively. Also, antimetabolite, antibiotic
or herbicide resistance can be used as the basis for selection; for
example, dhfr which confers resistance to methotrexate (Wigler, M.
et al. (1980) Proc. Natl. Acad. Sci. 77:3567-70); npt, which
confers resistance to the aminoglycosides, neomycin and G-418
(Colbere-Garapin, F. et al (1981) J. Mol. Biol. 150:1-14); and als
or pat, which confer resistance to chlorsulfuron and
phosphinotricin acetyltransferase, respectively (Murry, supra).
Additional selectable genes have been described, for example, trpB,
which allows cells to utilize indole in place of tryptophan, or
hisD, which allows cells to utilize histinol in place of histidine
(Hartman, S. C. and R. C. Mulligan (1988) Proc. Natl. Acad. Sci.
85:8047-51). The use of visible markers has gained popularity with
such markers as anthocyanins, beta-glucuronidase and its substrate
GUS, and luciferase and its substrate luciferin, being widely used
not only to identify transformants, but also to quantify the amount
of transient or stable protein expression attributable to a
specific vector system (Rhodes, C. A. et al. (1995) Method Mol.
Biol. 55:121-131).
[0163] Although the presence/absence of marker gene expression
suggests that the gene of interest is also present, its presence
and expression may need to be confirmed. For example, if the
sequence encoding a polypeptide is inserted within a marker gene
sequence, recombinant cells containing sequences can be identified
by the absence of marker gene function. Alternatively, a marker
gene can be placed in tandem with a polypeptide-encoding sequence
under the control of a single promoter. Expression of the marker
gene in response to induction or selection usually indicates
expression of the tandem gene as well.
[0164] Alternatively, host cells that contain and express a desired
polynucleotide sequence may be identified by a variety of
procedures known to those of skill in the art. These procedures
include, but are not limited to, DNA-DNA or DNA-RNA hybridizations
and protein bioassay or immunoassay techniques which include, for
example, membrane, solution, or chip based technologies for the
detection and/or quantification of nucleic acid or protein.
[0165] Host cells transformed with a polynucleotide sequence of
interest may be cultured under conditions suitable for the
expression and recovery of the protein from cell culture. The
protein produced by a recombinant cell may be secreted or contained
intracellularly depending on the sequence and/or the vector used.
As will be understood by those of skill in the art, expression
vectors containing polynucleotides of the invention may be designed
to contain signal sequences which direct secretion of the encoded
polypeptide through a prokaryotic or eukaryotic cell membrane.
Other recombinant constructions may be used to join sequences
encoding a polypeptide of interest to nucleotide sequence encoding
a polypeptide domain which will facilitate purification of soluble
proteins. Such purification facilitating domains include, but are
not limited to, metal chelating peptides such as
histidine-tryptophan modules that allow purification on immobilized
metals, protein A domains that allow purification on immobilized
immunoglobulin, and the domain utilized in the FLAGS
extension/affinity purification system (Immunex Corp., Seattle,
Wash.). The inclusion of cleavable linker sequences such as those
specific for Factor XA or enterokinase (Invitrogen. San Diego,
Calif.) between the purification domain and the encoded polypeptide
may be used to facilitate purification. One such expression vector
provides for expression of a fusion protein containing a
polypeptide of interest and a nucleic acid encoding 6 histidine
residues preceding a thioredoxin or an enterokinase cleavage site.
The histidine residues facilitate purification on IMIAC
(immobilized metal ion affinity chromatography) as described in
Porath, J. et al. (1992, Prot. Exp. Purif. 3:263-281) while the
enterokinase cleavage site provides a means for purifying the
desired polypeptide from the fusion protein. A discussion of
vectors which contain fusion proteins is provided in Kroll, D. J.
et al. (1993; DNA Cell Biol. 12:441-453).
[0166] In addition to recombinant production methods, polypeptides
of the invention, and fragments thereof, may be produced by direct
peptide synthesis using solid-phase techniques (Merrifield J.
(1963) J. Am. Chem. Soc. 85:2149-2154). Protein synthesis may be
performed using manual techniques or by automation. Automated
synthesis may be achieved, for example, using Applied Biosystems
431A Peptide Synthesizer (Perkin Elmer). Alternatively, various
fragments may be chemically synthesized separately and combined
using chemical methods to produce the full length molecule.
[0167] T Cells Compositions
[0168] The present invention, in another aspect, provides T cells
specific for a tumor polypeptide disclosed herein, or for a variant
or derivative thereof. Such cells may generally be prepared in
vitro or ex vivo, using standard procedures. For example, T cells
may be isolated from bone marrow, peripheral blood, or a fraction
of bone marrow or peripheral blood of a patient, using a
commercially available cell separation system, such as the
Isolex.TM. System, available from Nexell Therapeutics, Inc.
(Irvine, Calif.; see also U.S. Pat. No. 5,240,856; U.S. Pat. No.
5,215,926; WO 89/06280; WO 91/16116 and WO 92/07243).
Alternatively, T cells may be derived from related or unrelated
humans, non-human mammals, cell lines or cultures.
[0169] T cells may be stimulated with a polypeptide, polynucleotide
encoding a polypeptide and/or an antigen presenting cell (APC) that
expresses such a polypeptide. Such stimulation is performed under
conditions and for a time sufficient to permit the generation of T
cells that are specific for the polypeptide of interest.
Preferably, a tumor polypeptide or polynucleotide of the invention
is present within a delivery vehicle, such as a microsphere, to
facilitate the generation of specific T cells.
[0170] T cells are considered to be specific for a polypeptide of
the present invention if the T cells specifically proliferate,
secrete cytokines or kill target cells coated with the polypeptide
or expressing a gene encoding the polypeptide. T cell specificity
may be evaluated using any of a variety of standard techniques. For
example, within a chromium release assay or proliferation assay, a
stimulation index of more than two fold increase in lysis and/or
proliferation, compared to negative controls, indicates T cell
specificity. Such assays may be performed, for example, as
described in Chen et al., Cancer Res. 54:1065-1070, 1994.
Alternatively, detection of the proliferation of T cells may be
accomplished by a variety of known techniques. For example, T cell
proliferation can be detected by measuring an increased rate of DNA
synthesis (e.g., by pulse-labeling cultures of T cells with
tritiated thymidine and measuring the amount of tritiated thymidine
incorporated into DNA). Contact with a tumor polypeptide (100
ng/ml-100 .mu.g/ml, preferably 200 ng/ml-25 .mu.g/ml) for 3-7 days
will typically result in at least a two fold increase in
proliferation of the T cells. Contact as described above for 2-3
hours should result in activation of the T cells, as measured using
standard cytokine assays in which a two fold increase in the level
of cytokine release (e.g., TNF or IFN-.gamma.) is indicative of T
cell activation (see Coligan et al., Current Protocols in
Immunology, vol. 1, Wiley Interscience (Greene 1998)). T cells that
have been activated in response to a tumor polypeptide,
polynucleotide or polypeptide-expressing APC may be CD4.sup.+
and/or CD8.sup.+. Tumor polypeptide-specific T cells may be
expanded using standard techniques. Within preferred embodiments,
the T cells are derived from a patient, a related donor or an
unrelated donor, and are administered to the patient following
stimulation and expansion.
[0171] For therapeutic purposes, CD4.sup.+ or CD8.sup.+ T cells
that proliferate in response to a tumor polypeptide, polynucleotide
or APC can be expanded in number either in vitro or in vivo.
Proliferation of such T cells in vitro may be accomplished in a
variety of ways. For example, the T cells can be re-exposed to a
tumor polypeptide, or a short peptide corresponding to an
immunogenic portion of such a polypeptide, with or without the
addition of T cell growth factors, such as interleukin-2, and/or
stimulator cells that synthesize a tumor polypeptide.
Alternatively, one or more T cells that proliferate in the presence
of the tumor polypeptide can be expanded in number by cloning.
Methods for cloning cells are well known in the art, and include
limiting dilution.
[0172] Pharmaceutical Compositions
[0173] In additional embodiments, the present invention concerns
formulation of one or more of the polynucleotide, polypeptide or
T-cell disclosed herein in pharmaceutically-acceptable solutions
for administration to a cell or an animal, either alone, or in
combination with one or more other modalities of therapy. In
particular, the present invention concerns, the use of cripto
polynucleotides, polypeptides, fragments, fusions and variants in a
pharmaceutical composition for the treatment of tumours. In
particular it is preferred that the Cripto is Cripto 1.
[0174] It will be understood that, if desired, a composition as
disclosed herein may be administered in combination with other
agents as well, such as, e.g., other proteins or polypeptides or
various pharmaceutically-active agents. In fact, there is virtually
no limit to other components that may also be included, given that
the additional agents do not cause a significant adverse effect
upon contact with the target cells or host tissues. The
compositions may thus be delivered along with various other agents
as required in the particular instance. Such compositions may be
purified from host cells or other biological sources, or
alternatively may be chemically synthesized as described herein.
Likewise, such compositions may further comprise substituted or
derivatized RNA or DNA compositions.
[0175] Therefore, in another aspect of the present invention,
pharmaceutical compositions are provided comprising one or more of
the polynucleotide, polypeptide and/or T-cell compositions
described herein in combination with a physiologically acceptable
carrier. In certain preferred embodiments, the pharmaceutical
compositions of the invention comprise immunogenic polynucleotide
and/or polypeptide compositions of the invention for use in
prophylactic and theraputic vaccine applications. Vaccine
preparation is generally described in, for example, M. F. Powell
and M. J. Newman, eds., "Vaccine Design (the subunit and adjuvant
approach)," Plenum Press (NY, 1995). Generally, such compositions
will comprise one or more polynucleotide and/or polypeptide
compositions of the present invention in combination with one or
more immunostimulants.
[0176] It will be apparent that any of the pharmaceutical
compositions described herein can contain pharmaceutically
acceptable salts of the polynucleotides and polypeptides of the
invention. Such salts can be prepared, for example, from
pharmaceutically acceptable non-toxic bases, including organic
bases (eg., salts of primary, secondary and tertiary amines and
basic amino acids) and inorganic bases (eg., sodium, potassium,
lithium, ammonium, calcium and magnesium salts).
[0177] In another embodiment, illustrative immunogenic
compositions, e.g., vaccine compositions, of the present invention
comprise DNA encoding one or more of the polypeptides as described
above, such that the polypeptide is generated in situ. As noted
above, the polynucleotide may be administered within any of a
variety of delivery systems known to those of ordinary skill in the
art. Indeed, numerous gene delivery techniques are well known in
the art, such as those described by Rolland, Crit. Rev. Therap.
Drug Carrier Systems 15:143-198, 1998, and references cited
therein. Appropriate polynucleotide expression systems will, of
course, contain the necessary regulatory DNA regulatory sequences
for expression in a patient (such as a suitable promoter and
terminating signal). Alternatively, bacterial delivery systems may
involve the administration of a bacterium (such as
Bacillus-Calmette-Guerrin) that expresses an immunogenic portion of
the polypeptide on its cell surface or secretes such an
epitope.
[0178] Therefore, in certain embodiments, polynucleotides encoding
immunogenic polypeptides described herein are introduced into
suitable mammalian host cells for expression using any of a number
of known viral-based systems. In one illustrative embodiment,
retroviruses provide a convenient and effective platform for gene
delivery systems. A selected nucleotide sequence encoding a
polypeptide of the present invention can be inserted into a vector
and packaged in retroviral particles using techniques known in the
art. The recombinant virus can then be isolated and delivered to a
subject. A number of illustrative retroviral systems have been
described (e.g., U.S. Pat. No. 5,219,740; Miller and Rosman (1989)
BioTechniques 7:980-990; Miller, A. D. (1990) Human Gene Therapy
1:5-14; Scarpa et al. (1991) Virology 180:849-852; Burns et al.
(1993) Proc. Natl. Acad. Sci. USA 90:8033-8037; and Boris-Lawrie
and Temin (1993) Cur. Opin. Genet. Develop. 3:102-109.
[0179] In addition, a number of illustrative adenovirus-based
systems have also been described. Unlike retroviruses which
integrate into the host genome, adenoviruses persist
extrachromosomally thus minimizing the risks associated with
insertional mutagenesis (Haj-Ahmad and Graham (1986) J. Virol.
57:267-274; Bett et al. (1993) J. Virol. 67:5911-5921; Mittereder
et al. (1994) Human Gene Therapy 5:717-729; Seth et al. (1994) J.
Virol. 68:933-940; Barr et al. (1994) Gene Therapy 1:51-58;
Berkner, K. L. (1988) BioTechniques 6:616-629; and Rich et al.
(1993) Human Gene Therapy 4:461-476).
[0180] Various adeno-associated virus (AAV) vector systems have
also been developed for polynucleotide delivery. AAV vectors can be
readily constructed using techniques well known in the art. See,
e.g., U.S. Pat. Nos. 5,173,414 and 5,139,941; International
Publication Nos. WO 92/01070 and WO 93/03769; Lebkowski et al.
(1988) Molec. Cell. Biol. 8:3988-3996; Vincent et al. (1990)
Vaccines 90 (Cold Spring Harbor Laboratory Press); Carter, B. J.
(1992) Current Opinion in Biotechnology 3:533-539; Muzyczka, N.
(1992) Current Topics in Microbiol. and Immunol. 158:97-129; Kotin,
R. M. (1994) Human Gene Therapy 5:793-801; Shelling and Smith
(1994) Gene Therapy 1:165-169; and Zhou et al. (1994) J. Exp. Med.
179:1867-1875.
[0181] Additional viral vectors useful for delivering the nucleic
acid molecules encoding polypeptides of the present invention by
gene transfer include those derived from the pox family of viruses,
such as vaccinia virus and avian poxvirus. By way of example,
vaccinia virus recombinants expressing the novel molecules can be
constructed as follows. The DNA encoding a polypeptide is first
inserted into an appropriate vector so that it is adjacent to a
vaccinia promoter and flanking vaccinia DNA sequences, such as the
sequence encoding thymidine kinase (TK). This vector is then used
to transfect cells which are simultaneously infected with vaccinia.
Homologous recombination serves to insert the vaccinia promoter
plus the gene encoding the polypeptide of interest into the viral
genome. The resulting TK.sup.(-) recombinant can be selected by
culturing the cells in the presence of 5-bromodeoxyuridine and
picking viral plaques resistant thereto.
[0182] A vaccinia-based infection/transfection system can be
conveniently used to provide for inducible, transient expression or
coexpression of one or more polypeptides described herein in host
cells of an organism. In this particular system, cells are first
infected in vitro with a vaccinia virus recombinant that encodes
the bacteriophage T7 RNA polymerase. This polymerase displays
exquisite specificity in that it only transcribes templates bearing
T7 promoters. Following infection, cells are transfected with the
polynucleotide or polynucleotides of interest, driven by a T7
promoter. The polymerase expressed in the cytoplasm from the
vaccinia virus recombinant transcribes the transfected DNA into RNA
which is then translated into polypeptide by the host translational
machinery. The method provides for high level, transient,
cytoplasmic production of large quantities of RNA and its
translation products. See, e.g., Elroy-Stein and Moss, Proc. Natl.
Acad. Sci. USA (1990) 87:6743-6747; Fuerst et al. Proc. Natl. Acad.
Sci. USA (1986) 83:8122-8126.
[0183] Alternatively, avipoxviruses, such as the fowlpox and
canarypox viruses, can also be used to deliver the coding sequences
of interest. Recombinant avipox viruses, expressing immunogens from
mammalian pathogens, are known to confer protective immunity when
administered to non-avian species. The use of an Avipox vector is
particularly desirable in human and other mammalian species since
members of the Avipox genus can only productively replicate in
susceptible avian species and therefore are not infective in
mammalian cells. Methods for producing recombinant Avipoxviruses
are known in the art and employ genetic recombination, as described
above with respect to the production of vaccinia viruses. See,
e.g., WO 91/12882; WO 89/03429; and WO 92/03545.
[0184] Any of a number of alphavirus vectors can also be used for
delivery of polynucleotide compositions of the present invention,
such as those vectors described in U.S. Pat. Nos. 5,843,723;
6,015,686; 6,008,035 and 6,015,694. Certain vectors based on
Venezuelan Equine Encephalitis (VEE) can also be used, illustrative
examples of which can be found in U.S. Pat. Nos. 5,505,947 and
5,643,576.
[0185] Moreover, molecular conjugate vectors, such as the
adenovirus chimeric vectors described in Michael et al. J. Biol.
Chem. (1993) 268:6866-6869 and Wagner et al. Proc. Natl. Acad. Sci.
USA (1992) 89:6099-6103, can also be used for gene delivery under
the invention.
[0186] Additional illustrative information on these and other known
viral-based delivery systems can be found, for example, in
Fisher-Hoch et al., Proc. Natl. Acad. Sci. USA 86:317-321, 1989;
Flexner et al., Ann. N.Y. Acad. Sci. 569:86-103, 1989; Flexner et
al., Vaccine 8:17-21, 1990; U.S. Pat. Nos. 4,603,112, 4,769,330,
and 5,017,487; WO 89/01973; U.S. Pat. No. 4,777,127; GB 2,200,651;
EP 0,345,242; WO 91/02805; Berkner, Biotechniques 6:616-627, 1988;
Rosenfeld et al., Science 252:431-434, 1991; Kolls et al., Proc.
Natl. Acad. Sci. USA 91:215-219, 1994; Kass-Eisler et al., Proc.
Natl. Acad. Sci. USA 90:11498-11502, 1993; Guzman et al.,
Circulation 88:2838-2848, 1993; and Guzman et al., Cir. Res.
73:1202-1207, 1993.
[0187] In another embodiment of the invention, a polynucleotide is
administered/delivered as "naked" DNA, for example as described in
Ulmer et al., Science 259:1745-1749, 1993 and reviewed by Cohen,
Science 259:1691-1692, 1993. The uptake of naked DNA may be
increased by coating the DNA onto biodegradable beads, which are
efficiently transported into the cells.
[0188] In still another embodiment, a composition of the present
invention can be delivered via a particle bombardment approach,
many of which have been described. In one illustrative example,
gas-driven particle acceleration can be achieved with devices such
as those manufactured by Powderject Pharmaceuticals PLC (Oxford,
UK) and Powderject Vaccines Inc. (Madison, Wis.), some examples of
which are described in U.S. Pat. Nos. 5,846,796; 6,010,478;
5,865,796; 5,584,807; and EP Patent No. 0500 799. This approach
offers a needle-free delivery approach wherein a dry powder
formulation of microscopic particles, such as polynucleotide or
polypeptide particles, are accelerated to high speed within a
helium gas jet generated by a hand held device, propelling the
particles into a target tissue of interest. The particles, when
delivering nucleic acid are preferably gold beads of a 0.4-4.0 um,
more preferably 0.6-2.0 um diameter and the DNA conjugate coated
onto these and then encased in a cartridge for placing into the
"gene gun". The particles are typically and preferably delivered to
the skin. Other means of delivery to the skin, comprise utilising
needle delivery via a needle of a liquid formulation.
[0189] DNA vaccines usually consist of a bacterial plasmid vector
into which is inserted a strong, normally viral, promoter, the gene
of interest which encodes for an antigenic peptide and a
polyadenylation/transcriptional termination sequences. Thus gene of
interest may encode a full cripto protein as described or simply an
antigenic peptide sequence such as described in seq ID no 13-94.
The plasmid can be grown in bacteria, such as for example E. coli
and then isolated and prepared in an appropriate medium, depending
upon the intended route of administration, before being
administered to the host. Following administration the plasmid is
taken up by cells of the host where the encoded peptide is
produced. The plasmid vector will preferably be made without an
origin of replication which is functional in eukaryotic cells, in
order to prevent plasmid replication in the mammalian host and
integration within chromosomal DNA of the animal concerned.
[0190] There are a number of advantages of DNA vaccination relative
to traditional vaccination techniques. First, it is predicted that
because of the proteins which are encoded by the DNA sequence are
synthesised in the host, the structure or conformation of the
protein will be similar to the native protein associated with the
disease state. It is also likely that DNA vaccination will offer
protection against different strains of a virus, by generating
cytotoxic T lymphocyte response that recognise epitopes from
conserved proteins. Furthermore, because the plasmids are taken up
by the host cells where antigenic protein can be produced, a
long-lasting immune response will be elicited. The technology also
offers the possibility of combing diverse immunogens/epitopes into
a single preparation.
[0191] Helpful background information in relation to DNA
vaccination is provided in Donnelly et al "DNA vaccines" Ann. Rev
Immunol. 1997 15: 617-648, the disclosure of which is included
herein in its entirety by way of reference.
[0192] In a related embodiment, other devices and methods that may
be useful for gas-driven needle-less injection of compositions of
the present invention include those provided by Bioject, Inc.
(Portland, Oreg.), some examples of which are described in U.S.
Pat. Nos. 4,790,824; 5,064,413; 5,312,335; 5,383,851; 5,399,163;
5,520,639 and 5,993,412.
[0193] According to another embodiment, the pharmaceutical
compositions described herein will comprise one or more
immunostimulants in addition to the immunogenic polynucleotide,
polypeptide, T-cell and/or APC compositions of this invention. An
immunostimulant refers to essentially any substance that enhances
or potentiates an immune response (antibody and/or cell-mediated)
to an exogenous antigen. One preferred type of immunostimulant
comprises an adjuvant. Many adjuvants contain a substance designed
to protect the antigen from rapid catabolism, such as aluminum
hydroxide or mineral oil, and a stimulator of immune responses,
such as lipid A, Bordatella pertussis or Mycobacterium tuberculosis
derived proteins. Certain adjuvants are commercially available as,
for example, Freund's Incomplete Adjuvant and Complete Adjuvant
(Difco Laboratories, Detroit, Mich.); Merck Adjuvant 65 (Merck and
Company, Inc., Rahway, N.J.); AS-2 (SmithKline Beecham,
Philadelphia, Pa.); aluminum salts such as aluminum hydroxide gel
(alum) or aluminum phosphate; salts of calcium, iron or zinc; an
insoluble suspension of acylated tyrosine; acylated sugars;
cationically or anionically derivatized polysaccharides;
polyphosphazenes; biodegradable microspheres; monophosphoryl lipid
A and quil A. Cytokines, such as GM-CSF, interleukin-2, -7, -12,
and other like growth factors, may also be used as adjuvants.
[0194] Within certain embodiments of the invention, the adjuvant
composition is preferably one that induces an immune response
predominantly of the Th1 type. High levels of Th1-type cytokines
(eg., IFN-.gamma., TNF.alpha., IL-2 and IL-12) tend to favor the
induction of cell mediated immune responses to an administered
antigen. In contrast, high levels of Th2-type cytokines (eg., IL-4,
IL-5, IL-6 and IL-10) tend to favor the induction of humoral immune
responses. Following application of a vaccine as provided herein, a
patient will support an immune response that includes Th1- and
Th2-type responses. Within a preferred embodiment, in which a
response is predominantly Th1-type, the level of Th1-type cytokines
will increase to a greater extent than the level of Th2-type
cytokines. The levels of these cytokines may be readily assessed
using standard assays. For a review of the families of cytokines,
see Mosmann and Coffman, Ann. Rev. Immunol. 7:145-173, 1989.
[0195] Certain preferred adjuvants for eliciting a predominantly
Th1-type response include, for example, a combination of
monophosphoryl lipid A, preferably 3-de-O-acylated monophosphoryl
lipid A, together with an aluminum salt. MPL.RTM. adjuvants are
available from Corixa Corporation (Seattle, Wash.; see, for
example, U.S. Pat. Nos. 4,436,727; 4,877,611; 4,866,034 and
4,912,094). CpG-containing oligonucleotides (in which the CpG
dinucleotide is unmethylated) also induce a predominantly Th1
response. Such oligonucleotides are well known and are described,
for example, in WO 96/02555, WO 99/33488 and U.S. Pat. Nos.
6,008,200 and 5,856,462. Immunostimulatory DNA sequences are also
described, for example, by Sato et al., Science 273:352, 1996.
Another preferred adjuvant comprises a saponin, such as Quil A, or
derivatives thereof, including QS21 and QS7 (Aquila
Biopharmaceuticals Inc., Framingham, Mass.); Escin; Digitonin; or
Gypsophila or Chenopodium quinoa saponins. Other preferred
formulations include more than one saponin in the adjuvant
combinations of the present invention, for example combinations of
at least two of the following group comprising QS21, QS7, Quil A,
.beta.-escin, or digitonin.
[0196] Alternatively the saponin formulations may be combined with
vaccine vehicles composed of chitosan or other polycationic
polymers, polylactide and polylactide-co-glycolide particles,
poly-N-acetyl glucosamine-based polymer matrix, particles composed
of polysaccharides or chemically modified polysaccharides,
liposomes and lipid-based particles, particles composed of glycerol
monoesters, etc. The saponins may also be formulated in the
presence of cholesterol to form particulate structures such as
liposomes or ISCOMs. Furthermore, the saponins may be formulated
together with a polyoxyethylene ether or ester, in either a
non-particulate solution or suspension, or in a particulate
structure such as a paucilamelar liposome or ISCOM. The saponins
may also be formulated with excipients such as Carbopol.RTM. to
increase viscosity, or may be formulated in a dry powder form with
a powder excipient such as lactose.
[0197] In one preferred embodiment, the adjuvant system includes
the combination of a monophosphoryl lipid A and a saponin
derivative, such as the combination of QS21 and 3D-MPL.RTM.
adjuvant, as described in WO 94/00153, or a less reactogenic
composition where the QS21 is quenched with cholesterol, as
described in WO 96/33739. Other preferred formulations comprise an
oil-in-water emulsion and tocopherol. Another particularly
preferred adjuvant formulation employing QS21, 3D-MPL.RTM. adjuvant
and tocopherol in an oil-in-water emulsion is described in WO
95/17210.
[0198] Another enhanced adjuvant system involves the combination of
a CpG-containing oligonucleotide and a saponin derivative
particularly the combination of CpG and QS21 as disclosed in WO
00/09159. Preferably the formulation additionally comprises an oil
in water emulsion and tocopherol.
[0199] Additional illustrative adjuvants for use in the
pharmaceutical compositions of the invention include Montanide ISA
720 (Seppic, France), SAF (Chiron, Calif., United States), ISCOMS
(CSL), MF-59 (Chiron), the SBAS series of adjuvants (eg., SBAS-2 or
SBAS-4, available from SmithKline Beecham, Rixensart, Belgium),
Detox (Enhanzyn.RTM.) (Corixa, Hamilton, Mont.), RC-529 (Corixa,
Hamilton, Mont.) and other aminoalkyl glucosaminide 4-phosphates
(AGPs), such as those described in pending U.S. patent application
Ser. Nos. 08/853,826 and 09/074,720, the disclosures of which are
incorporated herein by reference in their entireties, and
polyoxyethylene ether adjuvants such as those described in WO
99/52549A1.
[0200] Other preferred adjuvants include adjuvant molecules of the
general formula (I):
HO(CH.sub.2CH.sub.2O).sub.n-A-R
[0201] Wherein, n is 1-50, A is a bond or --C(O)--, R is C.sub.1-50
alkyl or Phenyl C.sub.1-50 alkyl.
[0202] One embodiment of the present invention consists of a
vaccine formulation comprising a polyoxyethylene ether of general
formula (I), wherein n is between 1 and 50, preferably 4-24, most
preferably 9; the R component is C.sub.1-50, preferably
C.sub.4-C.sub.20 alkyl and most preferably C.sub.1-2 alkyl, and A
is a bond. The concentration of the polyoxyethylene ethers should
be in the range 0.1-20%, preferably from 0.1-10%, and most
preferably in the range 0.1-1%. Preferred polyoxyethylene ethers
are selected from the following group: polyoxyethylene-9-lauryl
ether, polyoxyethylene-9-steoryl ether, polyoxyethylene-8-steoryl
ether, polyoxyethylene-4-lauryl ether, polyoxyethylene-35-lauryl
ether, and polyoxyethylene-23-lauryl ether. Polyoxyethylene ethers
such as polyoxyethylene lauryl ether are described in the Merck
index (12.sup.th edition: entry 7717). These adjuvant molecules are
described in WO 99/52549.
[0203] The polyoxyethylene ether according to the general formula
(I) above may, if desired, be combined with another adjuvant. For
example, a preferred adjuvant combination is preferably with CpG as
described in the pending UK patent application GB 9820956.2.
[0204] According to another embodiment of this invention, an
immunogenic composition described herein is delivered to a host via
antigen presenting cells (APCs), such as dendritic cells,
macrophages, B cells, monocytes and other cells that may be
engineered to be efficient APCs. Such cells may, but need not, be
genetically modified to increase the capacity for presenting the
antigen, to improve activation and/or maintenance of the T cell
response, to have anti-tumor effects per se and/or to be
immunologically compatible with the receiver (i.e., matched HLA
haplotype). APCs may generally be isolated from any of a variety of
biological fluids and organs, including tumor and peritumoral
tissues, and may be autologous, allogeneic, syngeneic or xenogeneic
cells.
[0205] Certain preferred embodiments of the present invention use
dendritic cells or progenitors thereof as antigen-presenting cells.
Dendritic cells are highly potent APCs (Banchereau and Steinman,
Nature 392:245-251, 1998) and have been shown to be effective as a
physiological adjuvant for eliciting prophylactic or therapeutic
antitumor immunity (see Timmerman and Levy, Ann. Rev. Med.
50:507-529, 1999). In general, dendritic cells may be identified
based on their typical shape (stellate in situ, with marked
cytoplasmic processes (dendrites) visible in vitro), their ability
to take up, process and present antigens with high efficiency and
their ability to activate nave T cell responses. Dendritic cells
may, of course, be engineered to express specific cell-surface
receptors or ligands that are not commonly found on dendritic cells
in vivo or ex vivo, and such modified dendritic cells are
contemplated by the present invention. As an alternative to
dendritic cells, secreted vesicles antigen-loaded dendritic cells
(called exosomes) may be used within a vaccine (see Zitvogel et
al., Nature Med. 4:594600, 1998).
[0206] Dendritic cells and progenitors may be obtained from
peripheral blood, bone marrow, tumor-infiltrating cells,
peritumoral tissues-infiltrating cells, lymph nodes, spleen, skin,
umbilical cord blood or any other suitable tissue or fluid. For
example, dendritic cells may be differentiated ex vivo by adding a
combination of cytokines such as GM-CSF, IL-4, IL-13 and/or
TNF.alpha. to cultures of monocytes harvested from peripheral
blood. Alternatively, CD34 positive cells harvested from peripheral
blood, umbilical cord blood or bone marrow may be differentiated
into dendritic cells by adding to the culture medium combinations
of GM-CSF, IL-3, TNF.alpha., CD40 ligand, LPS, flt3 ligand and/or
other compound(s) that induce differentiation, maturation and
proliferation of dendritic cells.
[0207] Dendritic cells are conveniently categorized as "immature"
and "mature" cells, which allows a simple way to discriminate
between two well characterized phenotypes. However, this
nomenclature should not be construed to exclude all possible
intermediate stages of differentiation. Immature dendritic cells
are characterized as APC with a high capacity for antigen uptake
and processing, which correlates with the high expression of
Fc.gamma. receptor and mannose receptor. The mature phenotype is
typically characterized by a lower expression of these markers, but
a high expression of cell surface molecules responsible for T cell
activation such as class I and class II MHC, adhesion molecules
(eg., CD54 and CD11) and costimulatory molecules (eg., CD40, CD80,
CD86 and 4-1BB).
[0208] APCs may generally be transfected with a polynucleotide of
the invention (or portion or other variant thereof) such that the
encoded polypeptide, or an immunogenic portion thereof, is
expressed on the cell surface. Such transfection may take place ex
vivo, and a pharmaceutical composition comprising such transfected
cells may then be used for therapeutic purposes, as described
herein. Alternatively, a gene delivery vehicle that targets a
dendritic or other antigen presenting cell may be administered to a
patient, resulting in transfection that occurs in vivo. In vivo and
ex vivo transfection of dendritic cells, for example, may generally
be performed using any methods known in the art, such as those
described in WO 97/24447, or the gene gun approach described by
Mahvi et al., Immunology and cell Biology 75:456-460, 1997. Antigen
loading of dendritic cells may be achieved by incubating dendritic
cells or progenitor cells with the tumor polypeptide, DNA (naked or
within a plasmid vector) or RNA; or with antigen-expressing
recombinant bacterium or viruses (eg., vaccinia, fowlpox,
adenovirus or lentivirus vectors). Prior to loading, the
polypeptide may be covalently conjugated to an immunological
partner that provides T cell help (eg., a carrier molecule).
Alternatively, a dendritic cell may be pulsed with a non-conjugated
immunological partner, separately or in the presence of the
polypeptide.
[0209] While any suitable carrier known to those of ordinary skill
in the art may be employed in the pharmaceutical compositions of
this invention, the type of carrier will typically vary depending
on the mode of administration. Compositions of the present
invention may be formulated for any appropriate manner of
administration, including for example, topical, oral, nasal,
mucosal, intravenous, intracranial, intraperitoneal, subcutaneous
and intramuscular administration.
[0210] Carriers for use within such pharmaceutical compositions are
biocompatible, and may also be biodegradable. In certain
embodiments, the formulation preferably provides a relatively
constant level of active component release. In other embodiments,
however, a more rapid rate of release immediately upon
administration may be desired. The formulation of such compositions
is well within the level of ordinary skill in the art using known
techniques. Illustrative carriers useful in this regard include
microparticles of poly(lactide-co-glycolide), polyacrylate, latex,
starch, cellulose, dextran and the like. Other illustrative
delayed-release carriers include supramolecular biovectors, which
comprise a non-liquid hydrophilic core (e.g., a cross-linked
polysaccharide or oligosaccharide) and, optionally, an external
layer comprising an amphiphilic compound, such as a phospholipid
(see eg., U.S. Pat. No. 5,151,254 and PCT applications WO 94/20078,
WO/94/23701 and WO 96/06638). The amount of active compound
contained within a sustained release formulation depends upon the
site of implantation, the rate and expected duration of release and
the nature of the condition to be treated or prevented.
[0211] In another illustrative embodiment, biodegradable
microspheres (e.g., polylactate polyglycolate) are employed as
carriers for the compositions of this invention. Suitable
biodegradable microspheres are disclosed, for example, in U.S. Pat.
Nos. 4,897,268; 5,075,109; 5,928,647; 5,811,128; 5,820,883;
5,853,763; 5,814,344, 5,407,609 and 5,942,252. Modified hepatitis B
core protein carrier systems, such as described in WO/99 40934, and
references cited therein, will also be for many applications.
Another illustrative carrier/delivery system employs a carrier
comprising particulate-protein complexes, such as those described
in U.S. Pat. No. 5,928,647, which are capable of inducing a class
I-restricted cytotoxic T lymphocyte responses in a host.
[0212] The pharmaceutical compositions of the invention will often
further comprise one or more buffers (eg., neutral buffered saline
or phosphate buffered saline), carbohydrates (e.g., glucose,
mannose, sucrose or dextrans), mannitol, proteins, polypeptides or
amino acids such as glycine, antioxidants, bacteriostats, chelating
agents such as EDTA or glutathione, adjuvants (eg., aluminum
hydroxide), solutes that render the formulation isotonic, hypotonic
or weakly hypertonic with the blood of a recipient, suspending
agents, thickening agents and/or preservatives. Alternatively,
compositions of the present invention may be formulated as a
lyophilizate.
[0213] The pharmaceutical compositions described herein may be
presented in unit-dose or multi-dose containers, such as sealed
ampoules or vials. Such containers are typically sealed in such a
way to preserve the sterility and stability of the formulation
until use. In general, formulations may be stored as suspensions,
solutions or emulsions in oily or aqueous vehicles. Alternatively,
a pharmaceutical composition may be stored in a freeze-dried
condition requiring only the addition of a sterile liquid carrier
immediately prior to use.
[0214] The development of suitable dosing and treatment regimens
for using the particular compositions described herein in a variety
of treatment regimens, including e.g., oral, parenteral,
intravenous, intranasal, and intramuscular administration and
formulation, is well known in the art, some of which are briefly
discussed below for general purposes of illustration.
[0215] In certain applications, the pharmaceutical compositions
disclosed herein may be delivered via oral administration to an
animal. As such, these compositions may be formulated with an inert
diluent or with an assimilable edible carrier, or they may be
enclosed in hard- or soft-shell gelatin capsule, or they may be
compressed into tablets, or they may be incorporated directly with
the food of the diet.
[0216] The active compounds may even be incorporated with
excipients and used in the form of ingestible tablets, buccal
tables, troches, capsules, elixirs, suspensions, syrups, wafers,
and the like (see, for example, Mathiowitz et al., Nature 1997 Mar.
27;386(6623):410-4; Hwang et al., Crit Rev Ther Drug Carrier Syst
1998;15(3):243-84; U.S. Pat. No. 5,641,515; U.S. Pat. No. 5,580,579
and U.S. Pat. No. 5,792,451). Tablets, troches, pills, capsules and
the like may also contain any of a variety of additional
components, for example, a binder, such as gum tragacanth, acacia,
cornstarch, or gelatin; excipients, such as dicalcium phosphate; a
disintegrating agent, such as corn starch, potato starch, alginic
acid and the like; a lubricant, such as magnesium stearate; and a
sweetening agent, such as sucrose, lactose or saccharin may be
added or a flavoring agent, such as peppermint, oil of wintergreen,
or cherry flavoring. When the dosage unit form is a capsule, it may
contain, in addition to materials of the above type, a liquid
carrier. Various other materials may be present as coatings or to
otherwise modify the physical form of the dosage unit. For
instance, tablets, pills, or capsules may be coated with shellac,
sugar, or both. Of course, any material used in preparing any
dosage unit form should be pharmaceutically pure and substantially
non-toxic in the amounts employed. In addition, the active
compounds may be incorporated into sustained-release preparation
and formulations.
[0217] Typically, these formulations will contain at least about
0.1% of the active compound or more, although the percentage of the
active ingredient(s) may, of course, be varied and may conveniently
be between about 1 or 2% and about 60% or 70% or more of the weight
or volume of the total formulation. Naturally, the amount of active
compound(s) in each therapeutically useful composition may be
prepared is such a way that a suitable dosage will be obtained in
any given unit dose of the compound. Factors such as solubility,
bioavailability, biological half-life, route of administration,
product shelf life, as well as other pharmacological considerations
will be contemplated by one skilled in the art of preparing such
pharmaceutical formulations, and as such, a variety of dosages and
treatment regimens may be desirable.
[0218] For oral administration the compositions of the present
invention may alternatively be incorporated with one or more
excipients in the form of a mouthwash, dentifrice, buccal tablet,
oral spray, or sublingual orally-administered formulation.
Alternatively, the active ingredient may be incorporated into an
oral solution such as one containing sodium borate, glycerin and
potassium bicarbonate, or dispersed in a dentifrice, or added in a
therapeutically-effective amount to a composition that may include
water, binders, abrasives, flavoring agents, foaming agents, and
humectants. Alternatively the compositions may be fashioned into a
tablet or solution form that may be placed under the tongue or
otherwise dissolved in the mouth.
[0219] In certain circumstances it will be desirable to deliver the
pharmaceutical compositions disclosed herein parenterally,
intravenously, intramuscularly, or even intraperitoneally or
intradermally. Such approaches are well known to the skilled
artisan, some of which are further described, for example, in U.S.
Pat. No. 5,543,158; U.S. Pat. No. 5,641,515 and U.S. Pat. No.
5,399,363. In certain embodiments, solutions of the active
compounds as free base or pharmacologically acceptable salts may be
prepared in water suitably mixed with a surfactant, such as
hydroxypropylcellulose. Dispersions may also be prepared in
glycerol, liquid polyethylene glycols, and mixtures thereof and in
oils. Under ordinary conditions of storage and use, these
preparations generally will contain a preservative to prevent the
growth of microorganisms.
[0220] Illustrative pharmaceutical forms suitable for injectable
use include sterile aqueous solutions or dispersions and sterile
powders for the extemporaneous preparation of sterile injectable
solutions or dispersions (for example, see U.S. Pat. No.
5,466,468). In all cases the form must be sterile and must be fluid
to the extent that easy syringability exists. It must be stable
under the conditions of manufacture and storage and must be
preserved against the contaminating action of microorganisms, such
as bacteria and fungi. The carrier can be a solvent or dispersion
medium containing, for example, water, ethanol, polyol (e.g.,
glycerol, propylene glycol, and liquid polyethylene glycol, and the
like), suitable mixtures thereof, and/or vegetable oils. Proper
fluidity may be maintained, for example, by the use of a coating,
such as lecithin, by the maintenance of the required particle size
in the case of dispersion and/or by the use of surfactants. The
prevention of the action of microorganisms can be facilitated by
various antibacterial and antifungal agents, for example, parabens,
chlorobutanol, phenol, sorbic acid, thimerosal, and the like. In
many cases, it will be preferable to include isotonic agents, for
example, sugars or sodium chloride. Prolonged absorption of the
injectable compositions can be brought about by the use in the
compositions of agents delaying absorption, for example, aluminum
monostearate and gelatin.
[0221] In one embodiment, for parenteral administration in an
aqueous solution, the solution should be suitably buffered if
necessary and the liquid diluent first rendered isotonic with
sufficient saline or glucose. These particular aqueous solutions
are especially suitable for intravenous, intramuscular,
subcutaneous and intraperitoneal administration. In this
connection, a sterile aqueous medium that can be employed will be
known to those of skill in the art in light of the present
disclosure. For example, one dosage may be dissolved in 1 ml of
isotonic NaCl solution and either added to 1000 ml of
hypodermoclysis fluid or injected at the proposed site of infusion,
(see for example, "Remington's Pharmaceutical Sciences" 15th
Edition, pages 1035-1038 and 1570-1580). Some variation in dosage
will necessarily occur depending on the condition of the subject
being treated. Moreover, for human administration, preparations
will of course preferably meet sterility, pyrogenicity, and the
general safety and purity standards as required by FDA Office of
Biologics standards.
[0222] In another embodiment of the invention, the compositions
disclosed herein may be formulated in a neutral or salt form.
Illustrative pharmaceutically-acceptable salts include the acid
addition salts (formed with the free amino groups of the protein)
and which are formed with inorganic acids such as, for example,
hydrochloric or phosphoric acids, or such organic acids as acetic,
oxalic, tartaric, mandelic, and the like. Salts formed with the
free carboxyl groups can also be derived from inorganic bases such
as, for example, sodium, potassium, ammonium, calcium, or ferric
hydroxides, and such organic bases as isopropylamine,
trimethylamine, histidine, procaine and the like. Upon formulation,
solutions will be administered in a manner compatible with the
dosage formulation and in such amount as is therapeutically
effective.
[0223] The carriers can further comprise any and all solvents,
dispersion media, vehicles, coatings, diluents, antibacterial and
antifungal agents, isotonic and absorption delaying agents,
buffers, carrier solutions, suspensions, colloids, and the like.
The use of such media and agents for pharmaceutical active
substances is well known in the art. Except insofar as any
conventional media or agent is incompatible with the active
ingredient, its use in the therapeutic compositions is
contemplated. Supplementary active ingredients can also be
incorporated into the compositions. The phrase
"pharmaceutically-acceptable" refers to molecular entities and
compositions that do not produce an allergic or similar untoward
reaction when administered to a human.
[0224] In certain embodiments, the pharmaceutical compositions may
be delivered by intranasal sprays, inhalation, and/or other aerosol
delivery vehicles. Methods for delivering genes, nucleic acids, and
peptide compositions directly to the lungs via nasal aerosol sprays
has been described, e.g., in U.S. Pat. No. 5,756,353 and U.S. Pat.
No. 5,804,212. Likewise, the delivery of drugs using intranasal
microparticle resins (Takenaga et al., J Controlled Release 1998
Mar. 2;52(1-2):81-7) and lysophosphatidyl-glycerol compounds (U.S.
Pat. No. 5,725,871) are also well-known in the pharmaceutical arts.
Likewise, illustrative transmucosal drug delivery in the form of a
polytetrafluoroetheylene support matrix is described in U.S. Pat.
No. 5,780,045.
[0225] In certain embodiments, liposomes, nanocapsules,
microparticles, lipid particles, vesicles, and the like, are used
for the introduction of the compositions of the present invention
into suitable host cells/organisms. In particular, the compositions
of the present invention may be formulated for delivery either
encapsulated in a lipid particle, a liposome, a vesicle, a
nanosphere, or a nanoparticle or the like. Alternatively,
compositions of the present invention can be bound, either
covalently or non-covalently, to the surface of such carrier
vehicles.
[0226] The formation and use of liposome and liposome-like
preparations as potential drug carriers is generally known to those
of skill in the art (see for example, Lasic, Trends Biotechnol 1998
July;16(7):307-21; Takakura, Nippon Rinsho 1998 March;56(3):691-5;
Chandran et al., Indian J Exp Biol. 1997 August;35(8):801-9;
Margalit, Crit Rev Ther Drug Carrier Syst. 1995;12(2-3):233-61;
U.S. Pat. No. 5,567,434; U.S. Pat. No. 5,552,157; U.S. Pat. No.
5,565,213; U.S. Pat. No. 5,738,868 and U.S. Pat. No. 5,795,587,
each specifically incorporated herein by reference in its
entirety).
[0227] Liposomes have been used successfully with a number of cell
types that are normally difficult to transfect by other procedures,
including T cell suspensions, primary hepatocyte cultures and PC 12
cells (Renneisen et al., J Biol Chem. 1990 Sep.
25;265(27):16337-42; Muller et al., DNA Cell Biol. 1990
April;9(3):221-9). In addition, liposomes are free of the DNA
length constraints that are typical of viral-based delivery
systems. Liposomes have been used effectively to introduce genes,
various drugs, radiotherapeutic agents, enzymes, viruses,
transcription factors, allosteric effectors and the like, into a
variety of cultured cell lines and animals. Furthermore, he use of
liposomes does not appear to be associated with autoimmune
responses or unacceptable toxicity after systemic delivery.
[0228] In certain embodiments, liposomes are formed from
phospholipids that are dispersed in an aqueous medium and
spontaneously form multilamellar concentric bilayer vesicles (also
termed multilamellar vesicles (MLVs).
[0229] Alternatively, in other embodiments, the invention provides
for pharmaceutically-acceptable nanocapsule formulations of the
compositions of the present invention. Nanocapsules can generally
entrap compounds in a stable and reproducible way (see, for
example, Quintanar-Guerrero et al., Drug Dev Ind Pharm. 1998
December;24(12):1113-28). To avoid side effects due to
intracellular polymeric overloading, such ultrafine particles
(sized around 0.1 .mu.m) may be designed using polymers able to be
degraded in viva. Such particles can be made as described, for
example, by Couvreur et al., Crit Rev Ther Drug Carrier Syst.
1988;5(1):1-20; zur Muhlen et al., Eur J Pharm Biopharm. 1998
March;45(2):149-55; Zambaux et al. J Controlled Release. 1998 Jan.
2;50(1-3):31-40; and U.S. Pat. No. 5,145,684.
[0230] Cancer Therapeutic Methods
[0231] In further aspects of the present invention, the
pharmaceutical compositions described herein may be used for the
treatment of cancer, particularly for the immunotherapy of colon or
colorectal cancer. In other embodiments the compositions can be
used to treat breast, or non-small cell lung carcinoma. Typically
the composition will be useful for treating patients whose cancers
express cripto antigen and/or whose metastases express cripto
antigen. Within such methods, the pharmaceutical compositions
described herein are administered to a patient, typically a
warm-blooded animal, preferably a human. A patient may or may not
be afflicted with cancer. Accordingly, the above pharmaceutical
compositions may be used to prevent the development of a cancer or
to treat a patient afflicted with a cancer. Pharmaceutical
compositions and vaccines may be administered either prior to or
following surgical removal of primary tumors and/or treatment such
as administration of radiotherapy or conventional chemotherapeutic
drugs. As discussed above, administration of the pharmaceutical
compositions may be by any suitable method, including
administration by intravenous, intraperitoneal, intramuscular,
subcutaneous, intranasal, intradermal, anal, vaginal, topical and
oral routes.
[0232] Within certain embodiments, immunotherapy may be active
immunotherapy, in which treatment relies on the in vivo stimulation
of the endogenous host immune system to react against tumors with
the administration of immune response-modifying agents (such as
polypeptides and polynucleotides as provided herein).
[0233] Within other embodiments, immunotherapy may be passive
immunotherapy, in which treatment involves the delivery of agents
with established tumor-immune reactivity (such as effector cells)
that can directly or indirectly mediate antitumor effects and does
not necessarily depend on an intact host immune system. Examples of
effector cells include T cells as discussed above, T lymphocytes
(such as CD8+ cytotoxic T lymphocytes and CD4+ T-helper
tumor-infiltrating lymphocytes), killer cells (such as Natural
Killer cells and lymphokine-activated killer cells), B cells and
antigen-presenting cells (such as dendritic cells and macrophages)
expressing a polypeptide provided herein. T cell receptors and
antibody receptors specific for the polypeptides recited herein may
be cloned, expressed and transferred into other vectors or effector
cells for adoptive immunotherapy.
[0234] Effector cells may generally be obtained in sufficient
quantities for adoptive immunotherapy by growth in vitro, as
described herein. Culture conditions for expanding single
antigen-specific effector cells to several billion in number with
retention of antigen recognition in vivo are well known in the art.
Such in vitro culture conditions typically use intermittent
stimulation with antigen, often in the presence of cytokines (such
as IL-2) and non-dividing feeder cells. As noted above,
immunoreactive polypeptides as provided herein may be used to
rapidly expand antigen-specific T cell cultures in order to
generate a sufficient number of cells for immunotherapy. In
particular, antigen-presenting cells, such as dendritic,
macrophage, monocyte, fibroblast and/or B cells, may be pulsed with
immunoreactive polypeptides or transfected with one or more
polynucleotides using standard techniques well known in the art.
For example, antigen-presenting cells can be transfected with a
polynucleotide having a promoter appropriate for increasing
expression in a recombinant virus or other expression system.
Cultured effector cells for use in therapy must be able to grow and
distribute widely, and to survive long term in vivo. Studies have
shown that cultured effector cells can be induced to grow in vivo
and to survive long term in substantial numbers by repeated
stimulation with antigen supplemented with IL-2 (see, for example,
Cheever et al., Immunological Reviews 157:177, 1997).
[0235] Alternatively, a vector expressing a polypeptide recited
herein may be introduced into antigen presenting cells taken from a
patient and clonally propagated ex vivo for transplant back into
the same patient. Transfected cells may be reintroduced into the
patient using any means known in the art, preferably in sterile
form by intravenous, intracavitary, intraperitoneal or intratumor
administration.
[0236] Routes and frequency of administration of the therapeutic
compositions described herein, as well as dosage, will vary from
individual to individual, and may be readily established using
standard techniques. In general, the pharmaceutical compositions
and vaccines may be administered by injection (e.g.,
intracutaneous, intramuscular, intravenous, intradermally or
subcutaneous), intranasally (e.g., by aspiration) or orally.
Preferably, between 1 and 10 doses may be administered over a 52
week period. Preferably, 6 doses are administered, at intervals of
1 month, and booster vaccinations may be given periodically
thereafter. Alternate protocols may be appropriate for individual
patients. A suitable dose is an amount of a compound that, when
administered as described above, is capable of promoting an
anti-tumor immune response, and is at least 10-50% above the basal
(i.e., untreated) level. Such response can be monitored by
measuring the anti-tumor antibodies in a patient or by
vaccine-dependent generation of cytolytic effector cells capable of
killing the patient's tumor cells in vitro. Such vaccines should
also be capable of causing an immune response that leads to an
improved clinical outcome (e.g., more frequent remissions, complete
or partial or longer disease-free survival) in vaccinated patients
as compared to non-vaccinated patients. In general, for
pharmaceutical compositions and vaccines comprising one or more
polypeptides, the amount of each polypeptide present in a dose
ranges from about 25 .mu.g to 5 mg per kg of host. Suitable dose
sizes will vary with the size of the patient, but will typically
range from about 0.1 ml to about 5 ml.
[0237] In general, an appropriate dosage and treatment regimen
provides the active compound(s) in an amount sufficient to provide
therapeutic and/or prophylactic benefit. Such a response can be
monitored by establishing an improved clinical outcome (e.g., more
frequent remissions, complete or partial, or longer disease-free
survival) in treated patients as compared to non-treated patients.
Increases in preexisting immune responses to a tumor protein
generally correlate with an improved clinical outcome. Such immune
responses may generally be evaluated using standard proliferation,
cytotoxicity or cytokine assays, which may be performed using
samples obtained from a patient before and after treatment.
[0238] As used herein "cripto" refers to polypeptides having about
188 amino acids and being expressed in carcinoma cells. In
addition, "cripto" refers to polypeptides having at least 70%, but
preferably 80%, and more preferably 90%, and more preferably 95%,
and yet most preferably 98% sequence identity to SEQ ID NOs: 3 or 4
or variants thereof, including Cripto 1 and Cripto 3.
EXAMPLES
[0239] The following examples illustrate various aspects of this
invention. These examples do not limit the scope of this invention
which is defined by the appended claims.
Example 1a
[0240] Expression of Immunoreactive Cripto-1 in Human Lesions
2 Non-involved Premalignant Tissue Epithelium Lesion Carcinoma TA
TVA Colon 25/193 (13) 26/65 (40) 10/13 (77) 122/168 (73)** IM 17/37
(46)** Stomach 1/37 (3) 16/30 (53) Pancreas 10/58 (17) 58/98 (59)**
Hyperplasias Adenomas Gall Bladder N.D. 6/9 (67) 4/7 (58) 89/132
(68)** DCIS Breast 5/33 (15) 26/55 (47) 497/631 (79)** Non Small
178/195 (91)** Cell Lung Non-involved Tissue Epithelium
Cystadenomas Serous Mucinous Serous Mucinous Ovary 6/7 (86) post-
6/14 (43) 0/7 4/10 (40) 4/5 (80) menopausal 23/40 (58) 25/48 (52)
3/9 (33) 3/8 (38) 4/8 (50) 9/10 (90) Borderline: 10/10 Endometrium
10/28 (36) 53/91 (58)* post-menopausal Hyperplasias 18/30 (60)
68/96 (71)* Cervix 4/25 (17) 40/74 (54)* Testis 0/3 29/51 (57)**
Embryonal Carcinomas Seminomas 19/19 (100)** 10/32 (31) Adrenal
Cortex 1/3 (33) Bladder 0/6 23/39 (60)** Renal 0/18 Prostate 0/9 TA
= Tubular adenoma TVC = Tubulovillous adenoma IM = Intestinal
metaplasia **Statistically significant expresson in carcinomas over
non-involved tissues
Example 1.6
Over-Expression of Cripto in Cancerous Tissues
[0241] Real-time RT-PCR (U. Gibson. 1996. Genome Research: 6,996)
is used to compare mRNA transcript abundance of the target protein
in a panel of normal and tumor tissues and/or cell lines. This
analysis is critical to establish the tumor specificity of Cripto
expression, which is an important criterion a good vaccine
candidate must fulfil.
[0242] Total RNA is extracted from snap frozen biopsies or cell
lines using TriPure reagent (Roche). Total RNA from normal tissues
is also purchased from InVitrogen. Poly-A+ mRNA is purified from
total RNA after DNAase treatment using oligo-dT magnetic beads
(Dynal). Quantification of the mRNA is performed by
spectrofluorimetry (VersaFluor, BioRad) using RiboGreen dye
(Molecular Probes).
[0243] TaqMan primers (forward primer sequence:
TGGGTAGGAAAGAGGAAGCAAAT, SEQ ID NO:7; reverse primer sequence:
TGCTTCTCTACCACCACCTAATCA, SEQ ID NO:8) and probe for real-time
RT-PCR amplification are designed with the Perkin-Elmer Primer
Express software using default options for TaqMan amplification
conditions.
[0244] Real-time reactions are assembled according to standard PCR
protocols using 2 ng of reverse transcribed mRNA (Expand RT, Roche)
for each reaction. Either SybrI or TaqMan detection is undergone,
depending on the evaluated sample. In case of SybrI detection,
SybrI dye (Molecular Probes) is added at a final dilution of
{fraction (1/75000)} for real-time detection, and TaqMan probe is
omitted. Amplification (40 cycles) and real-time detection is
performed in a Perkin-Elmer Biosystems PE7700 system using
conventional instrument settings. Ct values are calculated using
the PE7700 Sequence Detector Software. Ct values are obtained from
each tissue sample for the target mRNA (CtX) and for the actin mRNA
(CtA).
[0245] As the efficiency of PCR amplification under the prevailing
experimental conditions is close to the theoretical amplification
efficiency, 2.sup.(CtA-CtX) value is an estimate of the relative
target transcript level of the sample, standardized with respect to
Actin transcript level. A value of 1 thus suggests the candidate
antigen and Actin have the same expression level.
[0246] RT-PCR analysis, using SybrI detection, was performed on a
set of colon tumor and matched normal colon from 6 different
patients and 48 normal tissue samples. A TaqMan detection was run
on a set of colon tumor and matched normal colon from 6 other
patients (reactions were run in triplicates) and 48 normal tissue
samples. Tested normal tissues (and the abbreviations used in
graphics) are shown below:
[0247] Adrenal gland (Ad_Gl)
[0248] Aorta (Ao)
[0249] Bladder (Bl)
[0250] Bone marrow Bo_Ma
[0251] Brain (Bra, Bra1, Bra2, Bra3, Bra4, Bra5)
[0252] Cervix (Ce)
[0253] Colon (Co)
[0254] Fallopian tube (Fa_Tu)
[0255] Heart (He)
[0256] Ileum (Il)
[0257] Kidney (Ki)
[0258] Liver (Li, Li 1, Li2)
[0259] Lung (Lu)
[0260] Lymph node (Ly_No)
[0261] Esophagus (Oe)
[0262] Ovary (Ov)
[0263] Pancreas (Pa, Panc1, Panc2)
[0264] Parathyrois (Pa_Thy)
[0265] Placenta (Pl)
[0266] Prostate (Pr)
[0267] Rectum (Re)
[0268] Skin (Sk)
[0269] Skeletal muscle (Sk_Mu)
[0270] Small intestine (Sm_In)
[0271] Spleen (Sp)
[0272] Stomach (St)
[0273] Testis (Te)
[0274] Thyroid (Thyr, Thy, Thy1, Thy2)
[0275] Thymus (Thym1,)Thym2
[0276] Trachea (Tr, Tra)
[0277] Real-time RT-PCR reactions, using SybrI detection, were also
performed on a set of 7 lung cell lines:
[0278] CRL-5803 (Carcinoma, Non-Small Cell Lung Cancer, large cell,
neuroendocrine, metastatic site: lymph node)
[0279] CRL-5807 (Bronchioalveolar carcinoma, Non-Small Cell Lung
Cancer)
[0280] CRL-5810 (Adenocarcinoma, Non-Small Cell Lung Cancer)
[0281] CRL-5815 (Carcinoid, lung bronchus)
[0282] CRL-5865 (Adenocarcinoma, metastatic site: pleural
effusion)
[0283] CRL-9609 (Normal lung, bronchus, epithelial, virus
transformed)
[0284] HTB-177 (Carcinoma, large cell lung cancer, pleural
effusion) and 2 colon cell lines:
[0285] CRL-2159 (Carcinoma, Cecum, Dukes' B)
[0286] CCL-250
[0287] Fresh biopsy normal lung tissues (Lu(ucl), Lu(IVG)) and a
lung tumor tissue (LuTum) were also performed as control.
[0288] RT-PCR results on colorectal biopsies and normal tissues are
shown in FIGS. 1, 2, 3 and 4, and in Table 1. RT-PCR results on
cell lines are shown in FIG. 5.
3TABLE 1 Cripto expression in colorectal tumors and normal tissues.
Sybr detection.sup.1 TaqMan detection.sup.1 Colorectal tumor versus
adjacent normal colon.sup.2 Number of over-expressing 5/6 5/6
patients Average over-expression fold 200 90 in over-expressing
patients Median over-expression fold 64 (22-724) 20 (4-397)
(minimum-maximum) Colorectal tumor versus average normal
tissues.sup.2 Number of over-expressing 5/6 4/6 patients Average
over-expression fold 10 12 in over-expressing patients Median
over-expression fold 11 (3-22) 7 (3-32) (minimum-maximum) Normal
tissues with a high Spleen (0.5) Spleen (0.75), ovary (2).sup.4
transcript level.sup.3 (normal-to- tumor ratio) .sup.1Transcript
levels were calculated in colorectal tumors and a panel of normal
tissues using 2 detection techniques: TaqMan and Sybr. Regarding
Cripto, # TaqMan detection involved 6 patients and measures were
done in triplicates, whereas Sybr detection was undergone on 6
different patients. .sup.2Transcript level in colorectal tumors was
compared to both matched normal colon and average of normal tissue
transcript levels. .sup.3A normal tissue has a high transcript
level when it is higher than one fifth of colorectal tumors
transcript level. .sup.4Ovary has not been evaluated in Cripto Sybr
experiment.
[0289] Table 1, FIGS. 1, 2, 3 & 4 clearly show that Cripto,
while being marginally expressed in normal adult tissues, is highly
over-expressed in a majority of colorectal tumors, with an
over-expression rate of more than ten fold. Moreover, FIG. 5
indicates Cripto is dramatically over-expressed in a lung tumor
cell line (CRL-5815). Cripto tumor associated antigen is therefore
a suitable vaccine candidate to treat both colorectal and lung
cancer patients.
Example 2
Cloning of Cripto-1 c-DNA from Lung Tumor Cell Lines
[0290] Total RNA was extracted using TriPure reagent from 10.sup.7
cultured cells of 7 different lung cell lines (see section 1 for
the complete list of cell lines). Total RNAs were pooled, and mRNA
was purified from pooled total RNA on oligo-d(T) magnetic beads
(Dynal). 250 ng of mRNA were used for cDNA synthesis.
Quantification of the mRNA is performed by spectrofluorimetry
(VersaFluor, BioRad) using RiboGreen dye (Molecular Probes). cDNA
was synthesized using the GeneRacer technology (Invitrogen) which
ensures the amplification of only full-length transcripts. mRNA was
treated with CIP. mRNA 5' ends were decapped with TAP (Tobacco Acid
Pyrophosphatase) and were ligated to a specific RNA
oligonucleotide. The ligated mRNA was reverse transcribed into cDNA
using an oligod(T)-tailed primer. Amplification of cDNA was
performed using both GeneRacer flanking primers (Advantage,
Clontech). Cripto amplification was performed on 10 ng of GeneRacer
cDNA using gene specific PCR primers (forward primer sequence:
CGTCCAAGGCCGAAAGCCCTCCAGTT- , SEQ ID NO:9; and reverse primer
sequence: TTGGGAGAGGGCAGGGCAAAGAAGTAAGAA- , SEQ ID NO:10). PCR
reaction was done with Advantage II Taq DNA polymerase (Clontech)
under standard conditions. PCR product was cloned in pCR4-TOPO
plasmid (Invitrogen). Amplified sequence (SEQ ID NO:95) was shown
to display a variation at codon 22 (SEQ ID NO:96): Ala (GCC)
instead of Val (GTC) in the native version (SeqID6). Native version
was restored by PCR mutagenesis.
Example 3
Immunogenicity of Cripto Tumor-Associated Antigen in Animal
Models
[0291] The immunogenicity of the antigen of the present invention
can be verified by immunizing rabbits and mice using various means
of immunization. Indeed, immunization with Cripto forms, either
peptide or recombinant protein could induce humoral immune response
with the generation of specific antibodies against Cripto and/or
could induce a Cripto specific cellular immune response. In vivo
delivery of Cripto protein using for instance, naked DNA in an
appropriate vector encoding Cripto or fragments of Cripto, Cripto
genes delivered by a viral vector encoding Cripto or fragments of
Critpo, could also be useful to demonstrate Cripto
immunogenicity.
[0292] 3.1: Synthetic Peptide Immunization.
[0293] The synthetic peptides from human Cripto-1 amino-acid
sequence selected to immunize rabbits are GHQEFARPSRGYL (13 amino
acids, SEQ ID NO:11), and QEEPAIRPRSSQRVPPMG (18 amino acids, SEQ
ID NO:12). Synthetic peptides are then conjugated to a carrier
protein (KLH). Conjugates are formulated with Freund's adjuvant,
and two rabbits are immunized with each of the conjugates. Four
weeks after the second immunization and four weeks after the third
immunization, a blood sample is taken. Anti-Cripto antibody titers
are estimated in the serum by ELISA and/or Western Blot following
standard protocols (see section 3.5).
[0294] 3.2: Nucleic Acids Immunization.
[0295] pcDNA3.1 vector (Invitrogen) is used to construct the
vaccinating plasmid. To promote secretion of the in viva translated
protein and to therefore induce the humoral response against the
present invention antigen, nucleic acid sequence encoding Cripto-1
with its own signal peptide is inserted into the vector polycloning
site. The recombinant expression plasmid is used to transform a
host E. coli strain such as BL21.
[0296] The above recombinant strain is grown in conventional cell
culture medium. Bacteria are harvested before reaching the
stationary phase. Plasmid preparation using Quiagen system is
undergone for injection in mice.
[0297] Six to eight weeks-old Balb/c mice receive intramuscular
injections of recombinant expression plasmid. Two weeks after the
last injection, a blood sample is taken. Titers of specific
antibodies elicited against the present invention antigen are
determined by ELISA and/or Western Blot (see section 3.5).
[0298] 3.3 Viral Vector Immunization Using Adenoviruses.
[0299] Recombinant adenoviruses are effective vectors for
gene-based vaccination because they are capable of eliciting
humoral and cellular immune responses against the encoded antigen.
The nucleotide sequence coding for Cripto-1 protein with its own
signal sequence could be inserted in an appropriated Adeno
derivative viral vector. The adenoviral recombinant vector could be
administrated to mice by different routes (intramuscular,
intranasal, intradermal, subcutaneous or intraeperitoneal) After
two week, blood samples could be taken and the titer of antibodies
elicited examined. Additional experiments to measure the cellular
immune response could also be performed.
[0300] 3.4: Recombinant Protein Immunization.
[0301] 3.4.1: Expression and Purification of Cripto-1 Recombinant
Protein
[0302] Expression in microbial hosts, is used to produce the whole
protein or fragments of the invention antigen for immunization
purposes. Recombinant proteins may be expressed in two microbial
hosts, E. coli and in yeast (such as Saccharomyces cerevisiae or
Pichia pastoris). This allows the selection of the expression
system with the best features for this particular antigen
production.
[0303] The expression strategy first involves the design of the
primary structure of the recombinant antigen. In general, an
expression fusion partner (EFP) to improve levels of expression
and/or an immune fusion partner (IFP) to modulate the immunogenic
properties of the antigen, are placed at the N-terminal extremity.
In addition, an affinity fusion partner (AFP) useful for
facilitating further purification is included at the C-terminal
end.
[0304] When the recombinant strains are available, the recombinant
product is characterized by the evaluation of the level of
expression and the prediction of further solubility of the
engineered protein by analysis of its behavior in the crude
extract.
[0305] After growth in appropriate culture medium and induction of
the recombinant protein expression, total extracts are analyzed by
SDS-PAGE. The recombinant proteins are visualized in stained gels
and identified by Western blot analysis using the specific
anti-peptide antibodies generated by peptide immunization in rabbit
(see section 3.1).
[0306] A comparative evaluation of the different versions of the
expressed antigen and expression hosts will allow the selection of
the most promising candidate and host that is to be used for
further purification and further immunological evaluation.
[0307] The purification schemes follow a classical approach based
on the presence of a Histidine affinity tail in the recombinant
protein. In a typical experiment the disrupted cells are filtered
and the acellular extracts loaded onto an Ion Metal Affinity
Chromatography (IMAC; Ni++NTA from Qiagen) that will specifically
retain the recombinant protein. The retained proteins are eluted by
0-500 mM Imidazole gradient (possibly in presence of a detergent)
in a phosphate buffer.
[0308] 3.4.2: Protein Immunization
[0309] Rabbits are immunized, intramuscularly several times at
several week intervals with recombinant purified protein,
formulated in the adjuvant 3D-MPL/QS21. Three weeks after each
immunization, blood samples are taken. Anti-Cripto antibody titer
is estimated in the serum by ELISA. The specificity of the
anti-Cripto antibodies generated is tested by Western Blot (see
section 3.5) using the purified protein and including appropriated
controls.
[0310] 3.5: Immunological Response Assays of Cripto-Immunized
Animals.
[0311] Humoral response to Cripto immunization is assessed by
measuring Cripto specific antibody titers in animal sera using
ELISA and Western Blot. The following material harboring Cripto-1
derived peptides or full protein could be used for such test:
[0312] Cripto synthetic peptides (see section 3.1 for possible
peptides), or
[0313] protein extracts from cultures of Cripto-expressing cell
lines (see section 1 for possible cell lines), or
[0314] lysates of COS cells that have been engineered to
transiently express a Cripto recombinant plasmid (see below),
or
[0315] protein extracts of recombinant E. coli or yeast strains
(see section 3.3.1 for recombinant strain generation), or
[0316] purified recombinant antigen (see section 3.3.1 for antigen
purification).
[0317] Transient expression of Cripto in COS cells is obtained by
transiently transfecting COS cells with recombinant pcDNA3.1
plasmid prepared for nucleic acid vaccination (see section
3.2).
[0318] For ELISA reactions, one of the above mentioned antigen is
coated on microtiter plates (purified recombinant protein is
preferred). ELISA is then performed using standard protocol.
[0319] Western Blots are realized under standard conditions with
one of the above mentioned antigen (purified recombinant protein is
preferred, synthetic peptides are not used)
[0320] The cellular response can also be assessed by stimulating in
vitro vaccinated mouse spleen cells with the peptides used to
immunize the mice, or with antigen-derived overlapping peptides
covering the whole antigen sequence.
Example 4
Demonstration of Existing Cripto Specific Human T-Cell by In Vitro
Priming
[0321] Immunological relevance of Cripto-1 can be further confirmed
by in vitro priming of human T cells. All T cell lymphocytes, T
cell lines and dendritic cells are derived from PBMCs (peripheral
blood mononuclear cells) of healthy donors or cancer patients
(preferred donors are from HLA-A2 subtype).
[0322] Epitopes Binding of HLA Alleles Prediction:
[0323] The HLA Class I binding peptide sequences (nonamers,
decamers) are predicted either by the Parker's algorithm (Parker,
et al. J. Immunol. 152:163 (1994))
(http://bimas.dcrt.nih.gov/molbio/hla_bind/), and the Rammensee
method (Rammensee et al. (1997). Landes Bioscience (1997);
Rammensee et al., Immunogenetics 41,178-228 (1995)).
(http://syfpeithi.bmi-heidelberg.com/Scripts/MHCServer.dll/EpPredict.htm)-
.
[0324] The HLA Class II binding peptide sequences (nonamers) are
predicted using the Tepitope algorithm (Sturniolo et al. Nat
Biotechnol. 17: 555-61 (1999).
[0325] CD8+ T-Cell Response:
[0326] Two strategies to raise the CD8+ T cell lines are used: a
peptide-based approach and a whole gene-based approach. Both
approaches require the full-length cDNA of interest in the correct
reading frame to be cloned in an appropriate delivery system and to
be used to predict the sequence of the HLA binding peptides.
[0327] Peptide-Based Approach:
[0328] For this approach, an HLA-A2.1/Kb transgenic mouse model is
used for screening of the HLA-A2.1 peptides. Briefly, transgenic
mice are immunized with adjuvanted HLA-A2 peptides, those able to
induce a CD8 response (as defined by an efficient lysis or g-IFN
production on peptide-pulsed target cells) are further analyzed in
the human system.
[0329] Human dendritic cells (cultured according to Romani et al.
J. Exp. Med. 180:83-93(1994)) will be pulsed with the selected
peptides and used to stimulate CD8+-sorted T cells (by Facs). After
several weekly stimulation, the CD8+ lines are first tested on
peptide-pulsed autologous BLCL (EBV-B transformed cell lines). To
verify the proper in vivo processing of the peptide, the CD8+ lines
are then tested on cDNA-transfected tumor cells (HLA-A2 transfected
LnCaP, Skov3 or CAMA tumor cells).
[0330] Whole Gene-Based Approach:
[0331] CD8+ T cell lines are primed and stimulated with either
gene-gun transfected dendritic cells, retrovirally transduced
B7.1-transfected fibroblasts, recombinant pox virus (Kim, et al.,
J. Immunother. 20:276-286 (1997)) or adenovirus (Butterfield, et
al. J. Immunol. 161:5607-13 (1998)). infected dendritic cells.
Virus infected cells are very efficient to present antigenic
peptides since the antigen is expressed at high level but can only
be used once to avoid the over-growth of viral T cells lines.
[0332] After alternated stimulation, the CD8+ lines are tested on
cDNA-transfected tumor cells as indicated above. Peptide
specificity and identity is determined to confirm the immunological
validation of antigen of the present invention.
[0333] CD4+ T-Cell Response:
[0334] Similarly, the CD4+ T-cell immune response can also be
assessed. Generation of specific CD4+ T cells is made using
dendritic cells loaded with recombinant purified protein or
peptides to stimulate the T-cells.
[0335] Results
4 A - Prediction of Class I epitopes using the Parker method. A-1
Cripto-1 and -3 Class I epitopes. Start HLA allele Epitope size
position Sequence Score SEQ ID NO: A68 Decamer 12 SVIWIMAISK
240.000 SEQ ID NO: 13 A68 Decamer 117 SVPHDTWLPK 120.000 SEQ ID NO:
14 B2705 Nonamer 33 HQEFARPSR 100.000 SEQ ID NO: 15 B2705 Nonamer
59 IRPRSSQRV 600.000 SEQ ID NO: 16 B2705 Nonamer 72 IQHSKELNR
100.000 SEQ ID NO: 17 B2705 Nonamer 103 GRNCEHDVR 1000.000 SEQ ID
NO: 18 B2705 Nonamer 110 VRKENCGSV 600.000 SEQ ID NO: 19 B2705
Nonamer 138 LRCFPQAFL 2000.000 SEQ ID NO: 20 B2705 Nonamer 161
SRTPELPPS 200.000 SEQ ID NO: 21 B2705 Decamer 65 QRVPPMGIQH 200.000
SEQ ID NO: 22 B2705 Decamer 79 NRTCCLNGGT 200.000 SEQ ID NO: 23
B2705 Decamer 103 GRNCEHDVRK 2000.000 SEQ ID NO: 93 B2705 Decamer
136 GQLRCFPQAF 100.000 SEQ ID NO: 24 B2705 Decamer 161 SRTPELPPSA
200.000 SEQ ID NO: 94 B5101 Decamer 143 QAFLPGCDGL 110.000 SEQ
IDNO: 25 B5102 Decamer 143 QAFLPGCDGL 302.500 SEQ ID NO: 25 B5102
Decamer 150 DGLVMDEHLV 120.000 SEQ ID NO: 26 B60 Nonamer 23
FELGLVAGL 325.000 SEQ ID NO: 27 B60 Nonamer 76 KELNRTCCL 320.000
SEQ ID NO: 28 B62 Nonamer 137 QLRCFPQAF 240.000 SEQ ID NO: 29 B62
Decamer 136 GQLRCFPQAF 160.000 SEQ ID NO: 24 B7 Nonamer 169
SARTTTFML 120.000 SEQ ID NO: 30
[0336]
5 A-2 Cripto-1 specific class I epitopes. Start HLA allele Epitope
size position Sequence Score SEQ ID NO: A0201 Nonamer 5 KMARFSYSV
668.086 SEQ ID NO:31 A0201 Decamer 16 IMAISKVFEL 349.885 SEQ ID
NO:32 A0201 Decamer 13 VIWIMAISKV 310.361 SEQ ID NO:33 A0201
Decamer 175 FMLVGICLSI 128.242 SEQ ID NO:34 B2702 Nonamer 7
ARFSYSVIW 500.000 SEQ ID NO:35 B2702 Nonamer 3 CRKMARFSY 200.000
SEQ ID NO:36 B2702 Decamer 7 ARFSYSVIWI 300.000 SEQ ID NO:37 B2702
Decamer 37 ARPSRGYLAF 200.000 SEQ ID NO:38 B2705 Nonamer 7
ARFSYSVIW 1000.000 SEQ ID NO:35 B2705 Nonamer 3 CRKMARFSY 1000.000
SEQ ID NO:36 B2705 Nonamer 170 ARTTTFMLV 600.000 SEQ ID NO:39 B2705
Nonamer 37 ARPSRGYLA 200.000 SEQ ID NO:40 B2705 Decamer 7
ARFSYSVIWI 3000.000 SEQ ID NO:37 B2705 Decamer 37 ARPSRGYLAF
1000.000 SEQ ID NO:38 B2705 Decamer 3 CRKMARFSYS 200.000 SEQ ID
NO:41 B4403 Decamer 34 QEFARPSRGY 120.000 SEQ ID NO:42 B5101
Nonamer 6 MARFSYSVI 286.000 SEQ ID NO:43 B5101 Decamer 169
SARTTTFMLV 110.000 SEQ ID NO:44 B5102 Nonamer 17 MAISKVFEL 150.000
SEQ ID NO:45 B5102 Nonamer 6 MARFSYSVI 100.000 SEQ ID NO:43 B5103
Nonamer 6 MARFSYSVI 100.000 SEQ ID NO:43 B5103 Decamer 169
SARTTTFMLV 121.000 SEQ ID NO:44 B7 Nonamer 36 FARPSRGYL 180.000 SEQ
ID NO:46
[0337]
6 A-3 Cripto-3 specific class I epitopes. Start HLA allele Epitope
size position Sequence Score SEQ ID NO: A0201 Nonamer 5 KMVRFSYSV
668.086 SEQ ID NO:47 A0201 Nonamer 89 CMLESFCAC 103.417 SEQ ID
NO:48 A0201 Decamer 16 IMAISKAFEL 152.124 SEQ ID NO:49 A0201
Decamer 175 FMLAGICLSI 128.242 SEQ ID NO:50 B2702 Nonamer 7
VRFSYSVIW 500.000 SEQ ID NO:51 B2702 Nonamer 3 CRKMVRFSY 200.000
SEQ ID NO:52 B2702 Decamer 7 VRFSYSVIWI 300.000 SEQ ID NO:53 B2702
Decamer 37 ARPSRGDLAF 200.000 SEQ ID NO:54 B2705 Nonamer 3
CRKMVRFSY 1000.000 SEQ ID NO:52 B2705 Nonamer 7 VRFSYSVIW 1000.000
SEQ ID NO:51 B2705 Nonamer 37 ARPSRGDLA 200.000 SEQ ID NO:55 B2705
Nonamer 170 ARTTTFMLA 200.000 SEQ ID NO:56 B2705 Decamer 7
VRFSYSVIWI 3000.000 SEQ ID NO:53 B2705 Decamer 37 ARPSRGDLAF
1000.000 SEQ ID NO:54 B2705 Decamer 59 IRPRSSQRVL 600.000 SEQ ID
NO:57 B2705 Decamer 3 CRKMVRFSYS 200.000 SEQ ID NO:58 B2705 Decamer
65 QRVLPMGIQH 200.000 SEQ ID NO:59 B5101 Nonamer 60 RPRSSQRVL
120.000 SEQ ID NO:60 B5102 Nonamer 17 MAISKAFEL 150.000 SEQ ID
NO:61 B7 Nonamer 60 RPRSSQRVL 800.000 SEQ ID NO:60 B7 Nonamer 36
FARPSRGDL 180.000 SEQ ID NO:62 NB: Score is an estimate of
half-time of disassociation of a molecule containing this
subsequence.
[0338] B--Prediction of Class I Epitopes Using the Rammensee
Method.
7 B-1 Cripto-1 and -3 Class I epitopes. Start HLA allele Epitope
size position Sequence Score SEQ ID NO: A26 Nonamer 179 GICLSIQSY
27 SEQ ID NO:63 A26 Decamer 27 LVAGLGHQEF 25 SEQ ID NO:64 A26
Decamer 121 DTWLPKKCSL 25 SEQ ID NO:65 A3 Nonamer 58 AIRPRSSQR 29
SEQ ID NO:66 A3 Nonamer 13 VIWIMAISK 24 SEQ ID NO:67 A3 Decamer 12
SVIWIMAISK 29 SEQ ID NO:13 A3 Decamer 117 SVPHDTWLPK 24 SEQ ID
NO:14 B2705 Nonamer 103 GRNCEHDVR 25 SEQ ID NO:18 B2705 Nonamer 138
LRCFPQAFL 24 SEQ ID NO:20
[0339]
8 B-2 Cripto-1 specific class I epitopes. Start HLA allele Epitope
size position Sequence Score SEQ ID NO: A0201 Nonamer 83 CLNGGTCML
27 SEQ ID NO:68 A0201 Nonamer 5 KMARFSYSV 25 SEQ ID NO:31 A0201
Decamer 16 IMAISKVFEL 28 SEQ ID NO:32 A0201 Decamer 13 VIWIMAISKV
26 SEQ ID NO:33 A26 Nonamer 35 EFARPSRGY 24 SEQ ID NO:69 A3 Nonamer
66 RVPPMGIQH 27 SEQ ID NO:70 A3 Nonamer 21 KVFELGLVA 24 SEQ ID
NO:71 B08 Nonamer 17 MAISKVFEL 26 SEQ ID NO:45 B5101 Nonamer 6
MARFSYSVI 25 SEQ ID NO:43
[0340]
9 B-3 Cripto-3 specific class I epitopes. Start HLA allele Epitope
size position Sequence Score SEQ ID NO: A0201 Nonamer 83 CLNGGTCML
27 SEQ ID NO:68 A0201 Nonamer 176 MLAGICLSI 25 SEQ ID NO:72 A0201
Decamer 16 IMAISKAFEL 24 SEQ ID NO:49 A3 Nonamer 66 RVLPMGIQH 29
SEQ ID NO:73 B0702 Nonamer 60 RPRSSQRVL 24 SEQ ID NO:60 B08 Nonamer
17 MAISKAFEL 25 SEQ ID NO:61
[0341] C--Prediction of Class II Epitopes Using the Tepitope
Method.
10 C-1 Cripto-1 and -3 Class II epitopes. Start HLA allele Epitope
size position Sequence Score SEQ ID NO: DRB1*0102 Nonamer 70
MGIQHSKEL 1.8 SEQ ID NO:74 DRB1*0301 Nonamer 152 LVMDEHLVA 5.9 SEQ
ID NO:75 DRB1*0301 Nonamer 158 LVASRTPEL 4.3 SEQ ID NO:76 DRB1*0401
Nonamer 152 LVMDEHLVA 3.2 SEQ ID NO:75 DRB1*0402 Nonamer 59
IRPRSSQRV 4.9 SEQ ID NO:16 DRB1*0703 Nonamer 11 YSVIWIMAI 6 SEQ ID
NO:77 DRB1*0703 Nonamer 158 LVASRTPEL 5.7 SEQ ID NO:76 DRB1*0802
Nonamer 59 IRPRSSQRV 1.8 SEQ ID NO:16 DRB1*0802 Nonamer 123
WLPKKCSLC 2.3 SEQ ID NO:78 DRB1*0804 Nonamer 59 IRPRSSQRV 2.8 SEQ
ID NO:16 DRB1*0806 Nonamer 59 IRPRSSQRV 3.1 SEQ ID NO:16 DRB1*1101
Nonamer 11 YSVIWIMAI 2.8 SEQ ID NO:77 DRB1*1101 Nonamer 152
LVMDEHLVA 2.2 SEQ ID NO:75 DRB1*1102 Nonamer 152 LVMDEHLVA 2.4 SEQ
ID NO:75 DRB1*1104 Nonamer 25 LGLVAGLGH 2.8 SEQ ID NO:79 DRB1*1104
Nonamer 152 LVMDEHLVA 3.2 SEQ ID NO:75 DRB1*1106 Nonamer 25
LGLVAGLGH 2.8 SEQ ID NO:79 DRB1*1106 Nonamer 152 LVMDEHLVA 3.2 SEQ
ID NO:75 DRB1*1107 Nonamer 46 FRDDSIWPQ 2.8 SEQ ID NO:80 DRB1*1107
Nonamer 152 LVMDEHLVA 5.9 SEQ ID NO:75 DRB1*1107 Nonamer 158
LVASRTPEL 3.3 SEQ ID NO:76 DRB1*1305 Nonamer 11 YSVIWIMAI 3.7 SEQ
ID NO:77 DRB1*1307 Nonamer 11 YSVIWIMAI 1.2 SEQ ID NO:77 DRB1*1501
Nonamer 138 LRCFPQAFL 4.3 SEQ ID NO:20 DRB1*1501 Nonamer 152
LVMDEHLVA 4.5 SEQ ID NO:75 DRB1*1502 Nonamer 152 LVMDEHLVA 3.5 SEQ
ID NO:75 DRB5*0101 Nonamer 13 VIWIMAISK 5.3 SEQ ID NO:67
[0342]
11 C-2 Cripto-1 specific class II epitopes. Start HLA allele
Epitope size position Sequence Score SEQ ID NO: DRB1*0101 Nonamer
15 WIMAISKVF 1.3 SEQ ID NO:81 DRB1*0102 Nonamer 176 MLVGICLSI 1.8
SEQ ID NO:82 DRB1*0102 Nonamer 178 VGICLSIQS 1.7 SEQ ID NO:83
DRB1*0301 Nonamer 17 MAISKVFEL 3.9 SEQ ID NO:45 DRB1*0401 Nonamer
178 VGICLSIQS 2.8 SEQ ID NO:83 DRB1*0402 Nonamer 178 VGICLSIQS 4.2
SEQ ID NO:83 DRB1*0404 Nonamer 14 IWIMAISKV 2.9 SEQ ID NO:84
DRB1*0404 Nonamer 177 LVGICLSIQ 3.3 SEQ ID NO:85 DRB1*0404 Nonamer
178 VGICLSIQS 3.8 SEQ ID NO:83 DRB1*0405 Nonamer 175 FMLVGICLS 3.2
SEQ ID NO:86 DRB1*0405 Nonamer 177 LVGICLSIQ 3.1 SEQ ID NO:85
DRB1*0405 Nonamer 178 VGICLSIQS 2.8 SEQ ID NO:83 DRB1*0703 Nonamer
15 WIMAISKVF 5.7 SEQ ID NO:81 DRB1*0703 Nonamer 17 MAISKVFEL 7.6
SEQ ID NO:45 DRB1*0703 Nonamer 176 MLVGICLSI 5 SEQ ID NO:82
DRB1*0801 Nonamer 175 FMLVGICLS 3.8 SEQ ID NO:86 DRB1*0802 Nonamer
175 FMLVGICLS 3.8 SEQ ID NO:86 DRB1*0804 Nonamer 175 FMLVGICLS 2.8
SEQ ID NO:86 DRB1*1101 Nonamer 175 FMLVGICLS 3.9 SEQ ID NO:86
DRB1*1101 Nonamer 178 VGICLSIQS 2.4 SEQ ID NO:83 DRB1*1104 Nonamer
175 FMLVGICLS 2.9 SEQ ID NO:86 DRB1*1104 Nonamer 177 LVGICLSIQ 2.6
SEQ ID NO:85 DRB1*1104 Nonamer 178 VGICLSIQS 3.4 SEQ ID NO:83
DRB1*1106 Nonamer 175 FMLVGICLS 2.9 SEQ ID NO:86 DRB1*1106 Nonamer
177 LVGICLSIQ 2.6 SEQ ID NO:85 DRB1*1106 Nonamer 178 VGICLSIQS 3.4
SEQ ID NO:83 DRB1*1107 Nonamer 17 MAISKVFEL 2.9 SEQ ID NO:45
DRB1*1107 Nonamer 177 LVGICLSIQ 3.6 SEQ ID NO:85 DRB1*1107 Nonamer
178 VGICLSIQS 3 SEQ ID NO:83 DRB1*1302 Nonamer 15 WIMAISKVF 3.3 SEQ
ID NO:81 DRB1*1302 Nonamer 175 FMLVGICLS 3 SEQ ID NO:86 DRB1*1305
Nonamer 15 WIMAISKVF 3.1 SEQ ID NO:81 DRB1*1305 Nonamer 175
FMLVGICLS 4.3 SEQ ID NO:86 DRB1*1307 Nonamer 175 FMLVGICLS 3.9 SEQ
ID NO:86 DRB1*1307 Nonamer 177 LVGICLSIQ 1.6 SEQ ID NO:85 DRB1*1501
Nonamer 6 MARFSYSVI 4.5 SEQ ID NO:43 DRB1*1501 Nonamer 176
MLVGICLSI 4.1 SEQ ID NO:82 DRB1*1502 Nonamer 6 MARFSYSVI 3.5 SEQ ID
NO:43 DRB5*0101 Nonamer 15 WIMAISKVF 4.1 SEQ ID NO:81
[0343]
12 C-2 Cripto-3 specific class II epitopes. Start HLA allele
Epitope size position Sequence Score SEQ ID NO: DRB1*0101 Nonamer
15 WIMAISKAF 1.3 SEQ ID NO:87 DRB1*0102 Nonamer 6 MVRFSYSVI 1.4 SEQ
ID NO:88 DRB1*0102 Nonamer 17 MAISKAFEL 1.6 SEQ ID NO:61 DRB1*0401
Nonamer 7 VRFSYSVIW 2.9 SEQ ID NO:51 DRB1*0401 Nonamer 175
FMLAGICLS 2.7 SEQ ID NO:89 DRB1*0402 Nonamer 67 VLPMGIQHS 3.6 SEQ
ID NO:90 DRB1*0404 Nonamer 6 MVRFSYSVI 2.5 SEQ ID NO:88 DRB1*0404
Nonamer 14 IWIMAISKA 3.6 SEQ ID NO:91 DRB1*0404 Nonamer 67
VLPMGIQHS 3.5 SEQ ID NO:90 DRB1*0405 Nonamer 175 FMLAGICLS 2.7 SEQ
ID NO:89 DRB1*0703 Nonamer 7 VRFSYSVIW 6.5 SEQ ID NO:51 DRB1*0703
Nonamer 15 WIMAISKAF 5.7 SEQ ID NO:87 DRB1*0703 Nonamer 17
MAISKAFEL 7.5 SEQ ID NO:61 DRB1*0801 Nonamer 16 IMAISKAFE 3 SEQ ID
NO:92 DRB1*0801 Nonamer 175 FMLAGICLS 3.5 SEQ ID NO:89 DRB1*0802
Nonamer 67 VLPMGIQHS 1.9 SEQ ID NO:90 DRB1*0802 Nonamer 175
FMLAGICLS 3.5 SEQ ID NO:89 DRB1*0804 Nonamer 67 VLPMGIQRS 2.9 SEQ
ID NO:90 DRB1*0804 Nonamer 175 FMLAGICLS 2.5 SEQ ID NO:89 DRB1*0806
Nonamer 16 IMAISKAFE 4 SEQ ID NO:92 DRB1*1101 Nonamer 175 FMLAGICLS
3.5 SEQ ID NO:89 DRB1*1102 Nonamer 67 VLPMGIQHS 3.1 SEQ ID NO:90
DRB1*1102 Nonamer 175 FMLAGICLS 2.5 SEQ ID NO:89 DRB1*1107 Nonamer
7 VRFSYSVIW 2.8 SEQ ID NO:51 DRB1*1301 Nonamer 67 VLPMGIQHS 3.5 SEQ
ID NO:90 DRB1*1302 Nonamer 15 WIMAISKAF 3.3 SEQ ID NO:87 DRB1*1302
Nonamer 175 FMLAGICLS 3.9 SEQ ID NO:89 DRB1*1305 Nonamer 15
WIMAISKAF 3.1 SEQ ID NO:87 DRB1*1305 Nonamer 175 FMLAGICLS 3.9 SEQ
ID NO:89 DRB1*1307 Nonamer 67 VLPMGIQHS 1.5 SEQ ID NO:90 DRB1*1307
Nonamer 175 FMLAGICLS 3.5 SEQ ID NO:89 DRB1*1501 Nonamer 6
MVRFSYSVI 6.6 SEQ ID NO:88 DRB1*1502 Nonamer 6 MVRFSYSVI 5.6 SEQ ID
NO:88 DRB5*0101 Nonamer 15 WIMAISKAF 4.1 SEQ ID NO:87
Example 5
Anti-Tumor Potential of the Humoral Response Induced by Cripto
Vaccines
[0344] A series of experiments aimed at assessing the inhibitory
effect of the Cripto-specific humoral response on the
pathophysiological activities of Cripto in cancer could be carried
out by using various standards in vitro assays. The in vitro assays
could be, but not restricted to, growth inhibition assay, cell
motility inhibition assay, chemotaxis inhibition assay, inhibition
of the invasion through extracellular matrix protein (ECM), and
growth signal transduction pathway inhibition. The effects of the
sera of immunized animals with Cripto peptides or protein in
adjuvant, or with a plasmid DNA or a viral delivery system, e.g.
adenoviral vector, encoding the Cripto protein could be assessed in
these in vitro assays that gauge Cripto-mediated biological effects
on Cripto-expressing cell lines. In parallel, the effect of the
pre-immune sera from the same animals will be tested as negative
control. The cell lines used in these assays could be, but not
limited to, human tumor cells expressing Cripto such as GEO cells,
NTERA2 cells, the CRL-5815 cell line, or murine tumor cell lines
that naturally over-express Cripto. As example, the inhibition of
the in vitro growth of both GEO and NTERA2 cells has previously
been demonstrated by treatment with anti-sense oligonucleotides
designed to prevent the translation of Cripto mRNA (Baldassarre, et
al. Int J Cancer 66: 538-543 (1996); Ciardiello, et al. Oncogene
9:291-298 (1996); Alpe, et al. Int J Cancer 88: 566-574 (2000))
[0345] 5.1: Immunization Protocol:
[0346] Mice or rabbits would be immunized on day 0, 14, and 21 by
intra-footpad injections of either peptides or protein in adjuvant,
intra-dermal injections of a plasmid DNA encoding Cripto using
gene-gun devices, or intra-dermal injections of a viral vector
delivery system, e.g. adenoviral vector, encoding Cripto.
[0347] 5.2: Cell Proliferation Inhibition Assay:
[0348] The sera from immunized animals will be collected and added
at different dilutions to the culture medium of cells platted in
96-well plates. Similarly, pre-immune sera of these animals will
also be added to cells as negative control. The cells will be
treated for 3 to 7 days. The cell growth will be measured by
standard methods such as .sup.3H-thymidine incorporation assay, MTT
assay, crystal violet staining, or colony counting for
proliferation in soft agar-medium.
[0349] 5.3: Cell Invasion, Motility, and Chemotaxis Inhibition
Assays
[0350] The sera from immunized animals will be collected pre- and
post-immunization and added at different dilutions to cell
suspensions used for invasion, motility, and chemotaxis standards
assays. The inhibition of Cripto-mediated invasion, motility, and
chemotaxis could be assessed with the use of, for instance, but
limited to, commercially available Falcon chambers with matrigel
inserts (Collaborative Research), agarose droplet motility assay
(Yamamoto et al. Ophthalmology 97: 1204-1210 (1994)), and
commercially available Boyden apparatus (Neuro Probe),
respectively.
[0351] 5.4: Signal Transduction Inhibition Assays:
[0352] The sera from immunized animals will be collected pre- and
post-immunization and added at different dilutions to
Cripto-expressing tumor cells in culture. Exogenous Cripto protein
or human sera or milk containing the highest concentration of
Cripto detected by ELISA (Bianco, et al. Breast Cancer Res Treat
66:1-7 (2001)) will be added to the culture medium of the cells.
After various incubation times, the cells will be harvested and
processed by standard methods in order to perform immunoblot
analysis. The phosphorylation status of various key signal
transduction pathways involved in cell proliferation will be
assessed in these Cripto-simulated cells in the presence of pre- or
post-immune sera. For instance, the tyrosine phosphorylation status
of erb B-4 and mitogen-activated protein (MAP) kinase family such
as ERK1, ERK-2, and P38 will be assessed by immunoblotting with
antibodies that recognize the phosphorylated, active form of these
enzymes as previous described (Bianco, et al. J Biol Chem 274:
8624-8629 (1999); Paine, et al. J Biol Chem 275: 11284-11290
(2000)).
Example 6
In Vivo Anti-Tumor Effect of the Immune Response Induced by Cripto
Vaccines in Animal Models
[0353] The prophylactic or therapeutic potential of vaccines
containing the human Cripto protein, Cripto peptides, or Cripto
gene can be evaluated in mice challenged with syngeneic murine
tumor cell line that express Cripto. The tumor cell lines could be
a murine tumor cell line transfected with the human Cripto gene.
For instance the transfected cell lines could be the TC1 cell line
transfected with human Cripto gene. On the other hand, the high
level of homology between human Cripto and its murine homologue
suggests that cross-reactive immune responses induced by the human
vaccine can protect against mouse Cripto-expressing tumors. Indeed,
Cripto gene (TDGF-1) encodes a 171-amino acid protein which has 93%
identity with its human counterpart (Liguori, et al Mamm Genome
7:344-348 (1996)). Therefore, mice could be protected by
immunization with a human Critpo vaccine from murine tumor
challenge or spontaneously arising tumor known to endogenously
over-express the Cripto protein. With this respect, spontaneous
tumors in transgenic mice designed to over-express several
different oncogenes such as MMTV-Polyoma virus middle T antigen,
MMTV-c-ErbB2, and MT-hTGF alpha, have been shown also to
over-express Cripto. (Kenney, et al. Mol Carcinog 15: 44-56 (1996);
Niemeye, et al. Int. J Cancer 81:588-591 (1999)).
[0354] Alternatively, in order to vaccinate with the syngeneic
gene, the tumor-bearing mice could be vaccinated with a plasmid DNA
or a viral delivery system, e.g. adenoviral vector, encoding the
murine Cripto protein to protect from murine tumor growth.
[0355] 6.1: Prophylactic Experimental Design:
[0356] Mice would be vaccinated on day 0 and 14, prior tumor
challenge, by either intra footpad injections of 5 .mu.g of Cripto
protein in adjuvant, intra-dermal injections of DNA plasmid
encoding Cripto using gene-gun technology, or intra-dermal
injections of a viral vector, e.g. adenoviral vector, encoding
Cripto. Then, 10.sup.6 TC1-CR-1 cells, human Cripto-expressing
tumor cells, could be injected subcutaneously in the flank of
C57BL/6 immunocompetent mice 1 or 2 weeks post vaccination. The
tumor growth should be monitored in vivo by measuring individual
tumors twice a week for several weeks post-tumor challenge.
[0357] On the other hand, the efficacy of prophylactic vaccination
could be assessed by inhibiting the development of spontaneous
Cripto-expressing tumors in transgenic mice (Niemeye, et al. Int J
Cancer 81:588-591 (1999)) immunized multiple times before onset of
the palpable tumor with either form of Cripto vaccines.
[0358] 6.2: Therapeutic Experimental Design:
[0359] 10.sup.6 TC1-CR-1 cells, human-Critpo expressing tumor
cells, would be injected subcutaneously in the flank of C57BL/6
immunocompetent mice. Mice could be vaccinated on days 7 and 14,
post-tumor challenge, by either intra-footpad injections of 5 .mu.g
Cripto protein in adjuvant, intra-dermal injections of DNA plasmid
encoding Cripto using gene-gun technology, or intra-dermal
injections of a viral vector, e.g. adenoviral vector, encoding
Cripto. The tumor growth should be monitored in vivo by measuring
individual tumors twice a week. One to 4 weeks after the second
immunization, several mice per group will be sacrificed to harvest
spleen cells, draining lymph nodes, and sera for analysis of the
immune responses to establish a correlation between the induction
of a Cripto-specific immune response and the antitumor effect. The
analysis of the Cripto-specific immune response induced by
immunization could be assessed by measuring the antibody titers,
antibody isotypic profile, the CD4.sup.+ T-cell proliferation
response, and CTL CD8.sup.+ T-cell responses including cytokines
production and lysis activity against Cripto-expressing target
cells. All assays would be performed according to standards
protocols.
[0360] A similar kind of experiment could be carried out by
challenging parental mice with transplantable murine mammary tumor
lines over-expressing Cripto. These cells would be established from
spontaneous tumor arising in various oncogene transgenic mouse
strains such as MMTV-Polyoma virus middle T antigen, MMTV-c-ErbB2,
and MT-hTGF alpha transgenic mice (Niemeye, et al. Int J Cancer
81:588-591 (1999)).
Example 7
Demonstration of Cripto-1 Immunogenicity and Recognition of Cripto
Protein
[0361] 7.1 Objectives
[0362] This experiment demonstrates that two selected polypeptide
fragments of Cripto (SEQ ID NO:11 and SEQ ID NO:12) mixed with a
vaccine adjuvant induces Cripto peptide specific antibody response
in immunized animals. Furthermore, the assessment of the
recognition of Cripto protein shows that antibodies recognize the
tumour-associated antigen itself. Finally, an immunostaining study
on cancer tissues using anti-Cripto antibodies shows
Cripto-specific immune response to target cripto naturally
expressed in cancer cells.
[0363] 7.2 Selection of Cripto-1 Derived Peptides
[0364] Two peptides were selected and prepared from the amino acid
sequence of human Cripto-1: a 13 mer synthetic peptide
(GHQEFARPSRGYL--SEQ ID NO:11) that corresponds to amino acids 32 to
44 and an 18 mer synthetic peptide (QEEPAIRPRSSQRVPPMG--SEQ ID
NO:12) that corresponds to amino acids 54 to 71 of human Cripto-1
sequence. These peptides were coupled to KLH using
gluteraldehyde.
[0365] 7.3 Immunisation Protocol of Rabbits
[0366] The KLH-coupled synthetic peptides were used to immunize two
rabbits for each synthetic peptide. Antibodies were produced in
rabbits during 3 months according to the protocol described in
section 3.1 of the specification. Antisera were tested by ELISA
against the peptide and the carrier protein.
[0367] 7.4 Test of Rabbits Sera on Extracts of Recombinant
Full-Length Cripto-1 Expressed in E. coli
[0368] E. coli recombinant protein Cripto-1 (18 Kd) was detected
with the sera of rabbits injected with the synthetic peptides
aa32->44 (SEQ ID NO:11) or aa54->71 (SEQ ID NO:12). Western
blots using monoclonal antibodies to Cripto-1 and rabbit antisera
from rabbits injected with SEQ ID NO:11 or SEQ ID NO:12 indicated
the presence of a single intense polypeptide band at approximately
18 kD in cell extract as well as cell pellets. In addition,
Coommassie Blue stained polyacrylamide gel indicated the presence
of a polypeptide (.about.18 kD). No polypeptide having a molecular
weight of 18 kD was detected by antibodies, antisera, or Coommassie
Blue stain in the negative control or cellular extract
supernatant.
Example 8
Demonstration of the Recognition of Cripto in Tumour Tissue by
Immunostaining Studies Using Anti-Cripto Polyclonal Antibodies
[0369] SCID mice subcutaneous xenograft tumors (mRNA
cripto-expressing CRL5815 cell line--human small cell lung
carcinoma--expression determined by real time PCR methods) were
incubated in buffered formalin fixative for 24 h at room
temperature and paraffin embedded. Five micron thick sections were
attached to superfrost glass slides and deparaffinized. Prior to
antibody binding, the sections were heated in glyca buffer
(Biogenex) (microwave for 10 min), then saturated with PBS buffer
containing 0.5% blocking reagent (Borhinger) for 30 min. Two rabbit
anti-human CR-1 peptides (32-44; 54-71) were separately added (dil.
{fraction (1/50)}-{fraction (1/200)}) and incubated at 4.degree. C.
overnight. The sections were rinsed three times in PBS, incubated
with mouse-anti-rabbit IgG biotinylated secondary antibody (Sigma)
at 1:500 in PBS/0.5% blocking reagent for 30 min at room temp. The
sections were then rinsed three times in PBS, treated with
H.sub.2O.sub.2 1% to quench endogenous peroxidases, incubated in
HRP-Streptavidin (Zymed) at 1:500 in PBS and, finally, after PBS
rinsing, HRP activity was revealed using DAB (Zymed) solution for 5
min. The reaction was stopped with extensive rinsing in deionised
water. The sections were counterstained for 2 minutes in
hematoxylin, brought to xylene and mounted with DPX solution.
[0370] 8.1 Results
[0371] Cripto-1 peptide was detected using rabbit anti-human CR-1
peptide 54-71 (dil. {fraction (1/50)}) (SEQ ID NO:12) by
immunostaining. The immunostaining specificity was confirmed by
preabsorption of the anti-CR-1 peptide (54-71) antibody with the
corresponding purified Cripto-1 peptide (50 .mu.g/ml).
[0372] Cripto peptides formulated in vaccine adjuvant are
immunogenic in animals. Antibodies raised in immunized rabbits may
recognize not only the peptide used as immunogen, but also a
recombinant Cripto protein expressed in E. coli and Cripto
naturally expressed in tumour tissue. Cripto is a suitable target
for active immunotherapy.
Example 9
Demonstration of the Immunogenicity of Recombinant Cripto-1
Protein
[0373] 9.1. Immunogenicity of Recombinant Cripto-1 Protein Mixed
with Adjuvant
[0374] Recombinant Cripto protein purified from E. Coli was used to
immunize rabbits as described in Example 3.
[0375] 9.2. ELISA Protocol to Monitor Antibody Response
[0376] Quantification of anti-Cripto antibodies in the sera were
performed by ELISA using the Cripto protein as coating antigen and
expressed as the titer at midpoint dilution. For example, antigen
and antibodies solutions were used at 100 .mu.l/well. Antigen was
diluted to a final concentration of 1 .mu.g/ml in PBS and was
absorbed overnight at 4.degree. C. to the wells of 96 wells
microtiter plates. The plates were then incubated for 1 hr at
37.degree. C. with PBS containing 1% bovine serum albumin and 0.1%
tween 20 (saturation buffer). Two-fold dilutions of sera (starting
{fraction (1/100)}) in the saturation buffer were added to the
Cripto coated plates and incubated for 1 hr 30 min at 37.degree. C.
The plates were washed four times with PBS 0.1% Tween 20 and
biotin-conjugated anti-rabbit Ig diluted {fraction (1/5000)} in
saturation buffer were added to each well. The plates were
incubated for 1 hour 30 minutes at 37.degree. C. After washing
step, streptavidin biotinylated peroxydase complex reagent diluted
{fraction (1/5000)} in saturation buffer was added. Plates were
kept for an additional 30 min at 37.degree. C.
[0377] The plates were washed as above and incubated for 15 minutes
with TMB. The reaction was stopped with 0.2 M H.sub.2SO.sub.4 and
the optical densities were measured using a microplate reader
connected to a computer. Data were captured with SoftMaxPro
software and analyzed.
[0378] 9.3 Results:
[0379] No anti-Cripto antibodies were detected pre-vaccination as
shown in Table 2. At day 21 after the second vaccinations all the
three animals showed anti-Cripto antibodies, and 21 days after 4
vaccinations antibody titers were increased as shown in Table
2.
13 TABLE 2 Mid Point Dilution Pre- 21 days 21 days 21 days 21 days
vaccination Post 1 Post 2 Post 3 Post 4 rabbit 777 232 50 2686 2858
1127 rabbit 778 58 67 3074 4848 7645 rabbit 779 132 119 8548 8315
11523
[0380] This experiment shows that repeated administration of the
purified Cripto adjuvanted with QS21, 3D-MPL and oil-in-water
emulsion induces specific antibodies. This experiment also
demonstrates that recombinant Cripto antigen delivered with a
vaccine adjuvant is immunogenic.
Example 10
Immunogenicity of Recombinant Cripto-1 Gene by Genetic DNA
Immunisation
[0381] This experiment demonstrates that recombinant Cripto when
delivered as a nucleic acid sequence (genetic immunization)
encoding Cripto protein induces a Cripto-specific immune response
in mice.
[0382] 10.1. Genetic Construct Design for In Vivo Expression &
Mouse Immunization--
[0383] Genetic construct, in vivo expression and mouse immunization
were performed as described in Example 3.
[0384] 10.2. Determination of Serum Antibodies by Western Blot on
Crude Extracts of E. coli Recombinant Cripto-1 Protein
[0385] Serum from vaccinated mice was taken at day 0 and 42, for
Western blot analyses for the presence of anti-cripto antibodies.
Proteins contained in the solubilized pellet of an acellular
extract, were separated by SDS-PAGE and used to test the sera of
mice by Western blot. The pre-immune and post-immune serum (42 days
post-immunisation) of eight mice, and a pool of the negative
control group sera were tested at the dilution {fraction
(1/500)}.
[0386] The sera of all immunized mice reacted with the mature
Cripto-1 recombinant protein present in the extract as demonstrated
by Western blot analysis.
[0387] This experiment shows that repeated administration of cripto
DNA sequence can induce Cripto specific antibodies. Therefore,
recombinant Cripto protein delivered as the genetic vaccine is
immunogenic in mice.
Sequence Listing
[0388]
14 GGAGAATCCCCGGAAAGGCTGAGTCTCCAGCTCAAGGTCAAAACGTCCAAGGCCGAA SEQ ID
NO:1 AGCCCTCCAGTTTCCCCTGGACGCCTTGCTCCTGCTTCTGCTACGACCTTC- TGGGGA
AAACGAATTTCTCATTTTCTTCTTAAATTGCCATTTTCGCTTTAGGAGATG- AATGTT
TTCCTTTGGCTGTTTTGGCAATGACTCTGAATTAAAGCGATGCTAACGCCT- CTTTTC
CCCCTAATTGTTAAAAGCTATGGACTGCAGGAAGATGGCCCGCTTCTCTTA- CAGTGT
GATTTGGATCATGGCCATTTCTAAAGTCTTTGAACTGGGATTAGTTGCCGG- GCTGGG
CCATCAGGAATTTGCTCGTCCATCTCGGGGATACCTGGCCTTCAGAGATGA- CAGCAT
TTGGCCCCAGGAGGAGCCTGCAATTCGGCCTCGGTCTTCCCAGCGTGTGCC- GCCCAT
GGGGATACAGCACAGTAAGGAGCTAAACAGAACCTGCTGCCTGAATGGGGG- AACCTG
CATGCTGGGGTCCTTTTGTGCCTGCCCTCCCTCCTTCTACGGACGGAACTG- TGAGCA
CGATGTGCGCAAAGAGAACTGTGGGTCTGTGCCCCATGACACCTGGCTGCC- CAAGAA
GTGTTCCCTGTGTAAATGCTGGCACGGTCAGCTCCGCTGCTTTCCTCAGGC- ATTTCT
ACCCGGCTGTGATGGCCTTGTGATGGATGAGCACCTCGTGGCTTCCAGGAC- TCCAGA
ACTACCACCGTCTGCACGTACTACCACTTTTATGCTAGTTGGCATCTGCCT- TTCTAT
ACAAAGCTACTATTAATCGACATTGACCTATTTCCAGAAATACAATTTTAG- ATATCA
TGCAAATTTCATGACCAGTAAAGGCTGCTGCTACAATGTCCTAACTGAAAG- ATGATC
ATTTGTAGTTGCCTTAAAATAATGAATACAATTTCCAAAATGGTCTCTAAC- ATTTCC
TTACAGAACTACTTCTTACTTCTTTGCCCTGCCCTCTCCCAAAAAACTACT- TCTTTT
TTCAAAAGAAAGTCAGCCATATCTCCATTGTGCCTAAGTCCAGTGTTTCTT- TTTTTT
TTTTTTTTTGAGACGGAGTCTCACTCTGTCACCCAGGCTGGACTGCAATGA- CGCGAT
CTTGGTTCACTGCAACCTCCGCATCCGGGGTTCAAGCCATTCTCCTGCCTA- AGCCTC
CCAAGTAACTGGGATTACAGGCATGTGTCACCATGCCCAGCTAATTTTTTT- GTATTT
TAGTAGAGATGGGGGTTTCACCATATTGGCCAGTCTGGTCTCGAACTCTGA- CCTTGT
GATCCATCGATCAGCCTCTCGAGTGCTGAGATTACACACGTGAGCAACTGT- GCAAGG
CCTGGTGTTTCTTGATACATGTAATTCTACCAAGGTCTTCTTAATATGTTC- TTTTAA
ATGATTGAATTATATGTTCAGATTATTGGAGACTAATTCTAATGTGGACCT- TAGAAT
ACAGTTTTGAGTAGAGTTGATCAAAATCAATTAAAATAGTCTCTTTAAAAG- GAAAGA
AAACATCTTTAAGGGGAGGAACCAGAGTGCTGAAGGAATGGAAGTCCATCT- GCGTGT
GTGCAGGGAGACTGGGTAGGAAAGAGGAAGCAAATAGAAGAGAGAGGTTGA- AAAACA
AAATGGGTTACTTGATTGGTGATTAGGTGGTGGTAGAGAAGCAAGTAAAAA- GGCTAA
ATGGAAGGGCAAGTTTCCATCATCTATAGAAAGCTATATAAGACAAGAACT- CCCCTT
TTTTTCCCAAAGGCATTATAAAAAGAATGAAGCCTCCTTAGAAAAAAAATT- ATACCT
CAATGTCCCCAACAAGATTGCTTAATAAATTGTGTTTCCTCCAAGCTATTC- AATTCT
TTTAACTGTTGTAGAAGACAAAATGTTCACAATATATTTAGTTGTAAACCA- AGTGAT
CAAACTACATATTGTAAAGCCCATTTTTAAAATACATTGTATATATGTGTA- TGCACA
GTAAAAATGGAAACTATATTGACCTAAAAAAAAAAAAA
[0389]
15 AAGCTTGCGCGCCATGTAAGGTAAAGTGACTGATTCTATAGCAATCCAATTGTTCCT SEQ ID
NO:2 TTGTCTGCCCGTTTACATATAACAATGTTGTCAATGTTTGATTGAAAATAC- CTAGCA
GGCGACACACACACACCTAGCTCCTCAGGCGGAGAGCACCCCTTTCTTGGC- CACCCG
GGTATCCCCCAGGGAGTACGGGGCTCAAAACACCCTTTTGGAGAACAAGGT- GGAAGC
AAATTTCAGGAAGTAAAACTTCCTGAAATAAAATAAAATATCGAATGCCTT- GAGACC
CATACATTTTCAGGTTTTCCTAATTAAAGCAATTACTTTCCACCACCCCTC- CAACCT
GGAATCACCAACTTGGTTAGAGAAACTGATTTTTCTTTTTTCTTTTTTTTT- CCCAAA
AGAGTACATCTGATCATTTTAGCCTGCAACTAATGATAGAGATATTAGGGC- TAGTTA
ACCACAGTTTTACAAGACTCCTCTCCCGCGTGTGGGCCATTGTCATGCTGT- CGGTCC
CGCCCACCTGAAAGGTCTCCCCGCCCCGACTGGGGTTTGTTGTTGAAGAAG- GAGAAT
CCCCGGAAAGGCTGAGTCTCCAGCTCAAGGTCAAAACGTCCAAGGCCGAAA- GCCCTC
CACTTTCCCCTGGACACCTTGCTCCTGCTTCTGCTACGACCTTCTGGGAAC- GCGAAT
TTCTCATTTTCTTCTTAAATTGCCATTTTCGCTTTAGGAGATGAATGTTTT- CCTTTG
GCTGTTTTGGCAATGACTCTGAATTAAAGCGATGCTAACGCCTCTTTTCCC- CCTAAT
TGTTAAAAGCTATGGACTGCAGGAAGATGGTCCGCTTCTCTTACAGTGTGA- TTTGGA
TCATGGCCATTTCTAAAGCCTTTGAACTGGGATTAGTTGCCCGGCTGGGCC- ATCAGG
AATTTGCTCGTCCATCTCGGGGAGACCTGGCCTTCAGAGATGACAGCATTT- GGCCCC
AGGAGGAGCCTGCAATTCGGCCTCGGTCTTCCCAGCGTGTGCTGCCCATGG- GAATAC
AGCACAGTAAGGAGCTAAACAGAACCTGCTGCCTGAATGGGGGAACCTGCA- TGCTGG
AGTCCTTTTGTGCCTGCCCTCCCTCCTTCTACGGACGGAACTGTGAGCACG- ATGTGC
GCAAAGAGAACTGTGGGTCTGTGCCCCATGACACCTGGCTGCCCAAGAAGT- GTTCCC
TGTGTAAATGCTGGCACGGTCAGCTCCGCTGCTTTCCTCAGGCATTTCTAC- CCGGCT
GTGATGGCCTTGTGATGGATGAGCACCTCGTGGCTTCCAGGACTCCAGAAC- TACCAC
CGTCTGCACGTACTACCACTTTTATGCTAGCTGGCATCTGCCTTTCTATAC- AAAGCT
ACTATTAATCGACATTGACCTATTTCCAGAAATACAATTTTAGATATTATG- CAAATT
TCATGACCCGTAAAGGCTGCTGCTACAATGTCCTAACTGAAAGATGATCAT- TTGTAG
TTGCCTTAAAATAATGAATACAATTTCCAAAACGGTCTCTAACATTTCCTT- ACAGAA
CTAACTACTTCTTACCTCTTTGCCCTGCCCTCTCCCAAAAAACTACTTCTT- TTTTCA
AAAGAAAGTCAGCCATATCTCCATTGTGCCCAAGTCCAGTGTTTCTTTTTT- TTTTTT
GAGACGGAGTCTCACTCTGTCACCCAGGCTGGACTGCAATGACGCGATCTC- GGTTCA
CTGCAACCTCCGCATCCGGGGTTCAAGCCATTCTCCTGCCTCAGCCTCCCA- AGTAGC
TGGGATTACAGGCATGTGTCACCATGCCGGCTAATTTTTTTGTATTTTAGT- AGAGAC
GGGGGTTTCACCATATTGGCCAGCTGGTCTCGAACTCTGACCTTGTGATCC- ATCGCT
CGCCTCTCGAGTGCTGAGATTACACACGTGAGCAACTGTGCAAGGCCTGGT- GTTTCT
TGATACATGTAATTCTACCAAGGTCTTCTTAATATGTTCTTTTAAATGATT- GAATTA
TACACTCAGATTATTGGAGACTAAGTCTAATGTGGACCTTAGAATACAGTT- TTGAGT
AGAGTTGATCAAAATCAATTAAAATAGTCTCTTTAAAAGGAAAGAAAACAT- CTTTAA
GGGGAGGAACCAGAGTGCTGAAGGAATGGAAGTCCATCTGCGTGTGTGCAG- GGAGAC
TGGGTAGGAAAGAGGAAGCAAATAGAAGAGAGAGGTTGAAAAACAAAATGG- GTTACT
TGATTGGTGATTAGGTGGTGGTAGAGAAGCAAGTAAAAAGGCTAAATGGAA- GGGCAA
GTTTCCATCATCTATAGAAAGCTATGTAAGACAAGGACTCCCCTTTTTTTC- CCAAAG
GCATTGTAAAAAGAATGAAGTCTCCTTAGAAAAAAAATTATACCTCAATGT- CCCCAA
CAAGATTGCTTAATAAATTGTGTTTCCTCCAAGCTATTCAATTCTTTTAAC- TGTTGT
AGAAGAGAAAATGTTCACAATATATTTAGTTGTAAACCAAGTGATCAAACT- ACATAT
TGTAAAGCCCATTTTTAAAATACATTGTATATATGTGTATGCACAGTAAAA- ATGGAA
ACTATATTGACCTAAAAAAAAAAAAAGGAAACCACCCTTAGGCAGGCAGGA- CATGCT
CTTCAGAACTCTGCTCTTCAGAGTTCCAAAGAAGGGATAAAACATCTTTTA- TNNCCA
TCAAATAGC
[0390]
16 MDCRKMARFSYSVIWIMAISKVFELGLVAGLGHQEFARPSRGYLAFRDDSIWPQEEP SEQ ID
NO:3 AIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEH- DVRKEN
CGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPE- LPPSAR
TTTFMLVGICLSIQSYY
[0391]
17 MDCRKMVRFSYSVIWIMAISKAFELGLVAGLGHQEFARPSRGDLAFRDDSIWPQEEP SEQ ID
NO:4 AIRPRSSQRVLPMGIQHSKELNRTCCLNGGTCMLESFCACPPSFYGRNCEH- DVRKEN
CGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPE- LPPSAR
TTTFMLAGICLSIQSYY
[0392]
18 GGAGAATCCCCGGAAAGGCTGAGTCTCCAGCTCAAGGTCAAAACGTCCAAGGCCGAA SEQ ID
NO:5 AGCCCTCCAGTTTCCCCTGGACGCCTTGCTCCTGCTTCTGCTACGACCTTC- TGGGGA
AAACGAATTTCTCATTTTCTTCTTAAATTGCCATTTTCGCTTTAGGAGATG- AATGTT
TTCCTTTGGCTGTTTTGGCAATGACTCTGAATTAAAGCGATGCTAACGCCT- CTTTTC
CCCCTAATTGTTAAAAGCTATGGACTGCAGGAAGATGGCCCGCTTCTCTTA- CAGTGT
GATTTGGATCATGGCCATTTCTAAAGTCTTTGAACTGGGATTAGTTGCCGG- GCTGGG
CCATCAGGAATTTGCTCGTCCATCTCGGGGATACCTGGCCTTCAGAGATGA- CAGCAT
TTGGCCCCAGGAGGAGCCTGCAATTCGGCCTCGGTCTTCCCAGCGTGTGCC- GCCCAT
GGGGATACAGCACAGTAAGGAGCTAAACAGAACCTGCTGCCTGAATGGGGG- AACCTG
CATGCTGGGGTCCTTTTGTGCCTGCCCTCCCTCCTTCTACGGACGGAACTG- TGAGCA
CGATGTGCGCAAAGAGAACTGTGGGTCTGTGCCCCATGACACCTGGCTGCC- CAAGAA
GTGTTCCCTGTGTAAATGCTGGCACGGTCAGCTCCGCTGCTTTCCTCAGGC- ATTTCT
ACCCGGCTGTGATGGCCTTGTGATGGATGAGCACCTCGTGGCTTCCAGGAC- TCCAGA
ACTACCACCGTCTGCACGTACTACCACTTTTATGCTAGTTGGCATCTGCCT- TTCTAT
ACAAAGCTACTATTAATCGACATTGACCTATTTCCAGAAATACAATTTTAG- ATATCA
TGCAAATTTCATGACCAGTAAAGGCTGCTGCTACAATGTCCTAACTGAAAG- ATGATC
ATTTGTAGTTGCCTTAAAATAATGAATACAATTTCCAAAATGGTCTCTAAC- ATTTCC
TTACAGAACTACTTCTTACTTCTTTGCCCTGCCCTCTCCCAAAAAACTACT- TCTTTT
TTCAAAAGAAAGTCAGCCATATCTCCATTGTGCCTAAGTCCAGTGTTTCTT- TTTTTT
TTTTTTTTTGAGACGGAGTCTCACTCTGTCACCCAGGCTGGACTGCAATGA- CGCGAT
CTTGGTTCACTGCAACCTCCGCATCCGGGGTTCAAGCCATTCTCCTGCCTA- AGCCTC
CCAAGTAACTGGGATTACAGGCATGTGTCACCATGCCCAGCTAATTTTTTT- GTATTT
TAGTAGAGATGGGGGTTTCACCATATTGGCCAGTCTGGTCTCGAACTCTGA- CCTTGT
GATCCATCGATCAGCCTCTCGAGTGCTGAGATTACACACGTGAGCAACTGT- GCAAGG
CCTGGTGTTTCTTGATACATGTAATTCTACCAAGGTCTTCTTAATATGTTC- TTTTAA
ATGATTGAATTATATGTTCAGATTATTGGAGACTAATTCTAATGTGGACCT- TAGAAT
ACAGTTTTGAGTAGAGTTGATCAAAATCAATTAAAATAGTCTCTTTAAAAG- GAAAGA
AAACATCTTTAAGGGGAGGAACCAGAGTGCTGAAGGAATGGAAGTCCATCT- GCGTGT
GTGCAGGGAGACTGGGTAGGAAAGAGGAAGCAAATAGAAGAGAGAGGTTGA- AAAACA
AAATGGGTTACTTGATTGGTGATTAGGTGGTGGTAGAGAAGCAAGTAAAAA- GGCTAA
ATGGAAGGGCAAGTTTCCATCATCTATAGAAAGCTATATAAGACAAGAACT- CCCCTT
TTTTTCCCAAAGGCATTATAAAAAGAATGAAGCCTCCTTAGAAAAAAAATT- ATACCT
CAATGTCCCCAACAAGATTGCTTAATAAATTGTGTTTCCTCCAAGCTATTC- AATTCT
TTTAACTGTTGTAGAAGACAAAATGTTCACAATATATTTAGTTGTAAACCA- AGTGAT
CAAACTACATATTGTAAAGCCCATTTTTAAAATACATTGTATATATGTGTA- TGCACA
GTAAAAATGGAAACTATATTGACCTAAAAAAAAAAAAA
[0393]
19 MDCRKMARFSYSVIWIMAISKVFELGLVAGLGHQEFARPSRGYLAFRDDSIWPQEEP SEQ ID
NO:6 AIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEH- DVRKEN
CGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPE- LPPSAR
TTTFMLVGICLSIQSYY
[0394]
20 TGGGTAGGAAAGAGGAAGCAAAT SEQ ID NO:7
[0395]
21 TGCTTCTCTACCACCACCTAATCA SEQ ID NO:8
[0396]
22 CGTCCAAGGCCGAAAGCCCTCCAGTT SEQ ID NO:9
[0397]
23 TTGGGAGAGGGCAGGGCAAAGAAGTAAGAA SEQ ID NO:10
[0398]
24 GHQEFARPSRGYL SEQ ID NO:11
[0399]
25 QEEPAIRPRSSQRVPPMG SEQ ID NO:12
[0400]
26 SVIWIMAISK SEQ ID NO:13
[0401]
27 SVPHDTWLPK SEQ ID NO:14
[0402]
28 HQEFARPSR SEQ ID NO:15
[0403]
29 IRPRSSQRV SEQ ID NO:16
[0404]
30 IQHSKELNR SED ID NO:17
[0405]
31 GRNCEHDVR SEQ ID NO:18
[0406]
32 VRKENCGSV SEQ ID NO:19
[0407]
33 LRCFPQAFL SEQ ID NO:20
[0408]
34 SRTPELPPS SEQ ID NO:21
[0409]
35 QRVPPMGIQH SEQ ID NO:22
[0410]
36 NRTCCLNGGT SEQ ID NO:23
[0411]
37 GQLRCFPQAF SEQ ID NO:24
[0412]
38 QAFLPGCDGL SEQ ID NO:25
[0413]
39 DGLVMDEHLV SEQ ID NO:26
[0414]
40 FELGLVAGL SEQ ID NO:27
[0415]
41 KELNRTCCL SEQ ID NO:28
[0416]
42 QLRCFPQAF SEQ ID NO:29
[0417]
43 SARTTTFML SEQ ID NO:30
[0418]
44 KMARFSYSV SEQ ID NO:31
[0419]
45 IMAISKVFEL SEQ ID NO:32
[0420]
46 VIWIMAISKV SEQ ID NO:33
[0421]
47 FMLVGICLSI SEQ ID NO:34
[0422]
48 ARFSYSVIW SEQ ID NO:35
[0423]
49 CRKMARFSY SEQ ID NO:36
[0424]
50 ARFSYSVIWI SEQ ID NO:37
[0425]
51 ARPSRGYLAF SEQ ID NO:38
[0426]
52 ARTTTFMLV SEQ ID NO:39
[0427]
53 ARPSRGYLA SEQ ID NO:40
[0428]
54 CRKMARFSYS SEQ ID NO:41
[0429]
55 QEFARPSRGY SEQ ID NO:42
[0430]
56 MARFSYSVI SEQ ID NO:43
[0431]
57 SARTTTFMLV SEQ ID NO:44
[0432]
58 MAISKVFEL SEQ ID NO:45
[0433]
59 FARPSRGYL SEQ ID NO:46
[0434]
60 KMVRFSYSV SEQ ID NO:47
[0435]
61 CMLESFCAC SEQ ID NO:48
[0436]
62 IMAISKAFEL SEQ ID NO:49
[0437]
63 FMLAGICLSI SEQ ID NO:50
[0438]
64 VRFSYSVIW SEQ ID NO:51
[0439]
65 CRKMVRFSY SEQ ID NO:52
[0440]
66 VRFSYSVIWI SEQ ID NO:53
[0441]
67 ARPSRGDLAF SEQ ID NO:54
[0442]
68 ARPSRGDLA SEQ ID NO:55
[0443]
69 ARTTTFMLA SEQ ID NO:56
[0444]
70 IRPRSSQRVL SEQ ID NO:57
[0445]
71 CRKMVRFSYS SEQ ID NO:58
[0446]
72 QRVLPMGIQH SEQ ID NO:59
[0447]
73 RPRSSQRVL SEQ ID NO:60
[0448]
74 MAISKAFEL SEQ ID NO:61
[0449]
75 FARPSRGDL SEQ ID NO:62
[0450]
76 GICLSIQSY SEQ ID NO:63
[0451]
77 LVAGLGHQEF SEQ ID NO:64
[0452]
78 DTWLPKKCSL SEQ ID NO:65
[0453]
79 AIRPRSSQR SEQ ID NO:66
[0454]
80 VIWIMAISK SEQ ID NO:67
[0455]
81 CLNGGTCML SEQ ID NO:68
[0456]
82 EFARPSRGY SEQ ID NO:69
[0457]
83 RVPPMGIQH SEQ ID NO:70
[0458]
84 KVFELGLVA SEQ ID NO:71
[0459]
85 MLAGICLSI SEQ ID NO:72
[0460]
86 RVLPMGIQH SEQ ID NO:73
[0461]
87 MGIQHSKEL SEQ ID NO:74
[0462]
88 LVMDEHLVA SEQ ID NO:75
[0463]
89 LVASRTPEL SEQ ID NO:76
[0464]
90 YSVIWIMAI SEQ ID NO:77
[0465]
91 WLPKKCSLC SEQ ID NO:78
[0466]
92 LCLVAGLGH SEQ ID NO:79
[0467]
93 FRDDSIWPQ SEQ ID NO:80
[0468]
94 WIMAISKVF SEQ ID NO:81
[0469]
95 MLVGICLSI SEQ ID NO:82
[0470]
96 VGICLSIQS SEQ ID NO:83
[0471]
97 IWIMAISKV SEQ ID NO:84
[0472]
98 LVGICLSIQ SEQ ID NO:85
[0473]
99 FMLVGICLS SEQ ID NO:86
[0474]
100 WIMAISKAF SEQ ID NO:87
[0475]
101 MVRFSYSVI SEQ ID NO:88
[0476]
102 FMLAGICLS SEQ ID NO:89
[0477]
103 VLPMGIQHS SEQ ID NO:90
[0478]
104 IWIMAISKA SEQ ID NO:91
[0479]
105 IMAISKAFE SEQ ID NO:92
[0480]
106 GRNCEHDVRK SEQ ID NO:93
[0481]
107 SRTPELPPSA SEQ ID NO:94
[0482]
108 CGTCCAAGGCCGAAAGCCCTCCAGTTTCCCCTGGACGCCTTGCTCCTGCTTCTGCTA SEQ
ID NO:95 CGACCTTCTGGGGAAAACGAATTTCTCATTTTCTTCTTAAATTGCCA-
TTTTCGCTTT AGGAGATGAATGTTTTCCTTTGGCTGTTTTGGCAATGACTCTGAATT-
AAAGCGATGC TAACGCCTCTTTTCCCCCTAATTGTTAAAAGCTATGGACTGCAGGAA-
GATGGCCCGC TTCTCTTACAGTGTGATTTGGATCATGGCCATTTCTAAAGcCTTTGA-
ACTGGGATTA GTTGCCGGGCTGGGCCATCAGGAATTTGCTCGTCCATCTCGGGGATA-
CCTGGCCTTC AGAGATGACAGCATTTGGCCCCAGGAGGAGCCTGCAATTCGGCCTCG-
GTCTTCCCAG CGTGTGCCGCCCATGGGGATACAGCACAGTAAGGAGCTAAACAGAAC-
CTGCTGCCTG AATGGGGGAACCTGCATGCTGGGGTCCTTTTGTGCCTGCCCTCCCTC-
CTTCTACGGA CGGAACTGTGAGCACGATGTGCGCAAAGAGAACTGTGGGTCTGTGCC-
CCATGACACC TGGCTGCCCAAGAAGTGTTCCCTGTGTAAATGCTGGCACGGTCAGCT-
CCGCTGCTTT CCTCAGGCATTTCTACCCGGCTGTGATGGCCTTGTGATGGATGAGCA-
CCTCGTGGCT TCCAGGACTCCAGAACTACCACCGTCTGCACGTACTACCACTTTTAT-
GCTAGTTGGC ATCTGCCTTTCTATACAAAGCTACTATTAATCGACATTGACCTATTT-
CCAGAAATAC AATTTTAGATATCATGCAAATTTCATGACCAGTAAAGGCTGCTGCTA-
CAATGTCCTA ACTGAAAGATGATCATTTGTAGTTGCCTTAAAATAATGAATACAATT-
TCCAAAATGG TCTCTAACATTTCCTTACAGAACTACTTCTTACTTCTTTGCCCTGCC-
CTCTCCCAA
[0483]
109 MDCRKMARFSYSVIWIMAISKAFELGLVAGLGHQEFARPSRGYLAFRDDSIWPQEEP SEQ
ID NO:96 AIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSKYGR-
NCEHDVRKEN CGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVAS-
RTPELPPSAR TTTFMLVGICLSIQSYY
[0484]
* * * * *
References