U.S. patent application number 10/681389 was filed with the patent office on 2004-06-17 for ubiquitin fusion-based vaccine system.
This patent application is currently assigned to Proteinix Company. Invention is credited to Kenten, John H., Lohnas, Gerald L., Pilon, Aprile L., Roberts, Steven F., Tramontano, Alfonso.
Application Number | 20040115218 10/681389 |
Document ID | / |
Family ID | 21830878 |
Filed Date | 2004-06-17 |
United States Patent
Application |
20040115218 |
Kind Code |
A1 |
Kenten, John H. ; et
al. |
June 17, 2004 |
Ubiquitin fusion-based vaccine system
Abstract
Disclosed are epitope-containing heat shock fusion proteins, DNA
constructs encoding such fusion proteins, and methods of use. More
specifically, disclosed are ubiquitin fusion proteins comprising
ubiquitin fused to a plurality of identical or non-identical
epitopes at specified locations.
Inventors: |
Kenten, John H.; (Boyds,
MD) ; Tramontano, Alfonso; (Rockville, MD) ;
Pilon, Aprile L.; (Gaithersburg, MD) ; Lohnas, Gerald
L.; (Catonsville, MD) ; Roberts, Steven F.;
(Bethesda, MD) |
Correspondence
Address: |
Kevin M. Farrell
Suite 350
One New Hampshire Avenue
Portsmouth
NH
03801
US
|
Assignee: |
Proteinix Company
16020 Industrial Drive
Gaithersburg
MD
30877
|
Family ID: |
21830878 |
Appl. No.: |
10/681389 |
Filed: |
October 7, 2003 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
10681389 |
Oct 7, 2003 |
|
|
|
09964201 |
Sep 26, 2001 |
|
|
|
6660271 |
|
|
|
|
09964201 |
Sep 26, 2001 |
|
|
|
09026276 |
Feb 19, 1998 |
|
|
|
6319503 |
|
|
|
|
Current U.S.
Class: |
424/185.1 ;
530/350 |
Current CPC
Class: |
C07K 2319/35 20130101;
C07K 2319/40 20130101; C07K 14/61 20130101; C12N 15/62 20130101;
C07K 2319/75 20130101; A61K 39/00 20130101; C07K 2319/95 20130101;
C07K 14/00 20130101; C07K 2319/00 20130101 |
Class at
Publication: |
424/185.1 ;
530/350 |
International
Class: |
A61K 039/00; C07K
014/47 |
Claims
1. A fusion protein comprising a heat shock protein fused to a
single epitope-containing segment, the epitope-containing segment
comprising two or more identical epitopes.
2. The fusion protein of claim 1 wherein the heat shock protein is
ubiquitin and the fusion protein is a ubiquitin fusion protein.
3. The ubiquitin fusion protein of claim 2 wherein the
epitope-containing segment is fused to ubiquitin at a fusion site
selected from the group consisting of the N-terminus, the
C-terminus and an internal fusion site.
4. The ubiquitin fusion protein of claim 2 wherein the N-terminal
residue of ubiquitin is a residue other than methionine, and the
N-terminal residue other than methionine is fused to the C-terminal
residue of a second, unmodified ubiquitin protein.
5. The ubiquitin fusion protein of claim 2 wherein the N-terminal
residue of ubiquitin is a residue other than methionine, and the
N-terminal residue other than methionine is fused to the C-terminal
residue of a C-terminal ubiquitin subdomain competent to specify
cleavage by a ubiquitin-specific protease between the C-terminal
residue of the C-terminal ubiquitin subdomain and the N-terminal
residue other than methionine.
6. The ubiquitin fusion protein of claim 5 wherein at least one
epitope-containing segment is positioned between the C-terminal
residue of the C-terminal ubiquitin subdomain and the N-terminal
residue other than methionine, and the C-terminus of the C-terminal
subdomain is modified to inhibit cleavage by a ubiquitin-specific
protease.
7. The ubiquitin fusion protein of claim 2 which is
post-translationally modified by the addition of fatty acids to
enhance immunogenicity.
8. The ubiquitin fusion protein of claim 2 wherein the
epitope-containing segment contains from about 2 to about 30
epitopes.
9. The ubiquitin fusion protein of claim 2 wherein the identical
epitopes are B cell epitopes.
10. The ubiquitin fusion protein of claim 2 wherein the identical
epitopes are T cell epitopes.
11. The ubiquitin fusion protein of claim 2 wherein the identical
epitopes are structural mimics of biomolecules.
12. The ubiquitin fusion protein of claim 2 wherein the identical
epitopes are microbial epitopes.
13. The ubiquitin fusion protein of claim 2 wherein the identical
epitopes are self epitopes.
14. The ubiquitin fusion protein of claim 2 wherein the identical
epitopes represent epitopes from the proteins selected from the
group consisting of gonadotropin releasing hormone, tumor necrosis
factor, immunoglobulins, human immunodeficiency virus proteins,
chorionic gonadotrophin, inhibin, growth hormones and sperm
proteins.
15. The ubiquitin fusion protein of claim 2 wherein the identical
epitopes which comprise the plurality of identical epitopes are
gonadotropin releasing hormone epitopes.
16. The ubiquitin fusion protein of claim 2 wherein internal fusion
sites comprise regions of ubiquitin linking two domain of secondary
structure, the two domains of secondary structure being selected
from the group consisting .beta.-strand and .alpha.-helix.
17. The ubiquitin fusion protein of claim 2 wherein the
epitope-containing segment is fused to the C-terminus of ubiquitin
and the C-terminus of ubiquitin is modified to inhibit cleavage of
the ubiquitin fusion protein by a ubiquitin-specific protease.
18. The ubiquitin fusion protein of claim 17 wherein the C-terminus
of ubiquitin is modified at amino acid 76.
19. The ubiquitin fusion protein of claim 18 wherein the
modification at amino acid 76 of ubiquitin is a substitution of an
amino acid selected from the group consisting of: alanine, valine,
and cysteine for the wild-type glycine amino acid residue.
20. A fusion protein comprising a heat shock protein fused to two
or more non-contiguous epitope-containing segments, each
epitope-containing segment comprising one or more identical or
non-identical epitopes.
21. The fusion protein of claim 20 wherein the heat shock protein
is ubiquitin and the fusion protein is a ubiquitin fusion
protein.
22. The ubiquitin fusion protein of claim 21 wherein the
non-contiguous epitope-containing segments are fused to ubiquitin
at fusion sites selected from the group consisting of the
N-terminus, the C-terminus and internal fusion sites.
23. The ubiquitin fusion protein of claim 21 wherein the N-terminal
residue of ubiquitin is a residue other than methionine, and the
N-terminal residue other than methionine is fused to the C-terminal
residue of a second, unmodified ubiquitin protein.
24. The ubiquitin fusion protein of claim 21 wherein the N-terminal
residue of ubiquitin is a residue other than methionine, and the
N-terminal residue other than methionine is fused to the C-terminal
residue of a C-terminal ubiquitin subdomain competent to specify
cleavage by a ubiquitin-specific protease between the C-terminal
residue of the C-terminal ubiquitin subdomain and the N-terminal
residue other than methionine.
25. The ubiquitin fusion protein of claim 24 wherein at least one
epitope-containing segment is positioned between the C-terminal
residue of the C-terminal ubiquitin subdomain and the N-terminal
residue other than methionine, and the C-terminus of the C-terminal
subdomain is modified to inhibit cleavage by a ubiquitin-specific
protease.
26. The ubiquitin fusion protein of claim 21 which is
post-translationally modified by the addition of fatty acids to
enhance immunogenicity.
27. The ubiquitin fusion protein of claim 21 wherein the
epitope-containing segments contain from about 1 to about 30
epitopes.
28. The ubiquitin fusion protein of claim 21 wherein one
epitope-containing segment contains at least one B cell epitope and
one T cell epitope.
29. The ubiquitin fusion protein of claim 21 wherein one
epitope-containing segments contains at least two B cell
epitopes.
30. The ubiquitin fusion protein of claim 21 wherein one
epitope-containing segments contains at least two T cell
epitopes.
31. The ubiquitin fusion protein of claim 21 wherein one or more
epitopes contained within the epitope-containing segments are
structural mimics of biomolecules.
32. The ubiquitin fusion protein of claim 21 wherein one or more
epitopes contained within the epitope-containing segments are
microbial epitopes.
33. The ubiquitin fusion protein of claim 21 wherein one or more
epitopes contained within the epitope-containing segments are self
epitopes.
34. The ubiquitin fusion protein of claim 21 wherein one or more
epitopes contained within the epitope-containing segments represent
epitopes from the group of proteins selected from the group
consisting of gonadotropin releasing hormone, tumor necrosis
factor, immunoglobulins, human immunodeficiency proteins, chorionic
gonadotrophin, inhibin, growth hormones and sperm proteins.
35. The ubiquitin fusion protein of claim 21 wherein one or more
epitopes contained within the epitope-containing segments represent
epitopes from gonadotropin releasing hormone.
36. The ubiquitin fusion protein of claim 21 wherein the internal
fusion sites comprise regions of ubiquitin linking two domain of
secondary structure, the two domains of secondary structure being
selected from the group consisting .beta.-strand and
.alpha.-helix.
37. The ubiquitin fusion protein of claim 21 wherein one
epitope-containing segment comprises a single B-cell epitope or a
plurality of identical or non-identical B-cell epitopes and a
second epitope-containing segment comprises a single T-cell epitope
or a plurality of identical or non-identical T-cell epitopes.
38. The ubiquitin fusion protein of claim 21 wherein at least one
epitope-containing segment is fused to the C-terminus of ubiquitin
and the C-terminus of ubiquitin is modified to inhibit cleavage of
the ubiquitin fusion protein by a ubiquitin-specific protease.
39. The ubiquitin fusion protein of claim 38 wherein the C-terminus
of ubiquitin is modified at amino acid 76.
40. The ubiquitin fusion protein of claim 21 wherein the
modification at amino acid 76 of ubiquitin is a substitution of an
amino acid selected from the group consisting of: alanine, valine,
and cysteine for the wild-type glycine amino acid residue.
41. A fusion protein comprising a heat shock protein fused to a
single epitope-containing segment comprising two or more identical
or non-identical epitopes, the epitope-containing segments being
fused to the heat shock protein at fusion sites selected from the
group consisting of the N-terminus and an internal fusion site.
42. The fusion protein of claim 41 wherein the heat shock protein
is ubiquitin and the fusion protein is a ubiquitin fusion
protein.
43. The ubiquitin fusion protein of claim 42 wherein single epitope
containing segment contains from about 2 to about 30 identical or
non-identical epitopes.
44. The ubiquitin fusion protein of claim 42 wherein the N-terminal
residue of ubiquitin is a residue other than methionine, and the
N-terminal residue other than methionine is fused to the C-terminal
residue of a second, unmodified ubiquitin protein.
45. The ubiquitin fusion protein of claim 42 wherein the N-terminal
residue of ubiquitin is a residue other than methionine, and the
N-terminal residue other than methionine is fused to the C-terminal
residue of a C-terminal ubiquitin subdomain competent to specify
cleavage by a ubiquitin-specific protease between the C-terminal
residue of the C-terminal ubiquitin subdomain and the N-terminal
residue other than methionine.
46. The ubiquitin fusion protein of claim 45 wherein at least one
epitope-containing segment is positioned between the C-terminal
residue of the C-terminal ubiquitin subdomain and the N-terminal
residue other than methionine, and the C-terminus of the C-terminal
subdomain is modified to inhibit cleavage by a ubiquitin-specific
protease.
47. The ubiquitin fusion protein of claim 42 which is
post-translationally modified by the addition of fatty acids to
enhance immunogenicity.
48. The ubiquitin fusion protein of claim 42 wherein the
epitope-containing segment contains at least one B cell and one T
cell epitope.
49. The ubiquitin fusion protein of claim 42 wherein the
epitope-containing segment contains at least two B cell
epitopes.
50. The ubiquitin fusion protein of claim 42 wherein the
epitope-containing segment contains at least two T cell
epitopes.
51. The ubiquitin fusion protein of claim 42 wherein the
epitope-containing segment contains epitopes which are structural
mimics of biomolecules.
52. The ubiquitin fusion protein of claim 42 wherein the
epitope-containing segment contains epitopes which are microbial
epitopes.
53. The ubiquitin fusion protein of claim 42 wherein the
epitope-containing segment contains epitopes which are self
epitopes.
54. The ubiquitin fusion protein of claim 42 wherein the
epitope-containing segment contains at least one epitope from
proteins selected from the group consisting of gonadotrophin
releasing hormone, tumor necrosis factor, immunoglobulins, human
immunodeficiency virus proteins, chorionic gonadotrophin, inhibin,
growth hormones and sperm proteins.
55. The ubiquitin fusion protein of claim 42 wherein the
epitope-containing segment contains epitopes from gonadotropin
releasing hormone.
56. The ubiquitin fusion protein of claim 42 wherein the internal
fusion site comprises a region of ubiquitin linking two regions of
secondary structure selected from the group consisting of
.beta.-strand and .alpha.-helix.
57. The ubiquitin fusion protein of claim 42 wherein the
epitope-containing segment contains a single B-cell epitope-or a
plurality of identical or non-identical B-cell epitopes and a
second epitope-containing segment comprises a single T-cell epitope
or a plurality of identical or non-identical T-cell epitopes.
58. A fusion protein comprising a heat shock protein fused to a
single epitope-containing segment comprising one or more identical
or non-identical epitopes, the epitope-containing segment being
fused to the heat shock protein at the N-terminus of the heat shock
protein.
59. The fusion protein of claim 58 wherein the heat shock protein
is ubiquitin and the fusion protein is a ubiquitin fusion
protein.
60. The ubiquitin fusion protein of claim 59 wherein the
epitope-containing segment contains from about 1 to about 30
epitopes.
61. The ubiquitin fusion protein of claim 59 wherein the N-terminal
residue of ubiquitin is a residue other than methionine, and the
N-terminal residue other than methionine is fused to the C-terminal
residue of a second, unmodified ubiquitin protein.
62. The ubiquitin fusion protein of claim 59 wherein the N-terminal
residue of ubiquitin is a residue other than methionine, and the
N-terminal residue other than methionine is fused to the C-terminal
residue of a C-terminal ubiquitin subdomain competent to specify
cleavage by a ubiquitin-specific protease between the C-terminal
residue of the C-terminal ubiquitin subdomain and the N-terminal
residue other than methionine.
63. The ubiquitin fusion protein of claim 62 wherein at least one
epitope-containing segment is positioned between the C-terminal
residue of the C-terminal ubiquitin subdomain and the N-terminal
residue other than methionine, and the C-terminus of the C-terminal
subdomain is modified to inhibit cleavage by a ubiquitin-specific
protease.
64. The ubiquitin fusion protein of claim 59 which is
post-translationally modified by the addition of fatty acids to
enhance immunogenicity.
65. The ubiquitin fusion protein of claim 59 wherein the
epitope-containing segment contains at least one B cell epitope and
one T cell epitope.
66. The ubiquitin fusion protein of claim 59 wherein the
epitope-containing segment contains at least two B cell
epitopes.
67. The ubiquitin fusion protein of claim 59 wherein the
epitope-containing segment contains at least two T cell
epitopes.
68. The ubiquitin fusion protein of claim 59 wherein one or more
epitopes contained within the epitope-containing segment is a
structural mimic of a biomolecule.
69. The ubiquitin fusion protein of claim 59 wherein one or more
epitopes contained within the epitope-containing segment is a
microbial epitope.
70. The ubiquitin fusion protein of claim 59 wherein one or more
epitopes contained within the epitope-containing segment is a self
epitope.
71. The ubiquitin fusion protein of claim 59 wherein one or more
epitopes contained within the epitope-containing segment represents
an epitope from the group of proteins selected from the group
consisting of gonadotropin releasing hormone, tumor necrosis
factor, immunoglobulins, human immunodeficiency proteins, chorionic
gonadotrophin, inhibin, growth hormones and sperm proteins.
72. The ubiquitin fusion protein of claim 59 wherein one or more
epitopes contained within the epitope-containing segment represents
an epitope from gonadotropin releasing hormone.
73. The ubiquitin fusion protein of claim 59 wherein the
epitope-containing segment contains a single B-cell epitope or a
plurality of identical or non-identical B-cell epitopes and a
second epitope-containing segment comprises a single T-cell epitope
or a plurality of identical or non-identical T-cell epitopes.
74. A DNA construct encoding a fusion protein of claims 20, 41, or
58.
75. A cell containing a DNA construct encoding a fusion protein of
claims 1, 20, 41 or 58.
76. A method for stimulating an immune response in an animal, the
immune response being directed toward a ubiquitin fusion protein,
the method comprising: a) providing a ubiquitin fusion protein
comprising ubiquitin fused to a single epitope-containing segment,
the epitope-containing segment comprising two or more identical
epitopes; and. b) administering the fusion protein of step a) to an
animal under conditions appropriate for the stimulation of an
immune response.
77. A method for stimulating an immune response in an animal, the
immune response being directed toward a ubiquitin fusion protein,
the method comprising: (a) providing a ubiquitin fusion protein
comprising ubiquitin fused to two or more non-contiguous
epitope-containing segments, each epitope-containing segment
comprising one or more identical or non-identical epitopes; and (b)
administering the fusion protein of step a) to an animal under
conditions appropriate for the stimulation of an immune
response.
78. A method for stimulating an immune response in an animal, the
immune response being directed toward a ubiquitin fusion protein,
the method comprising: (a) providing a ubiquitin fusion protein
comprising ubiquitin fused to a single epitope-containing segment
comprising two or more identical or non-identical epitopes, the
epitope-containing segments being fused to ubiquitin at fusion
sites selected from the group consisting of the N-terminus and an
internal fusion site; (b) administering the fusion protein of step
a) to an animal under conditions appropriate for the stimulation of
an immune response.
79. A method for stimulating an immune response in an animal, the
immune response being directed toward a ubiquitin fusion protein,
the method comprising: (a) providing a ubiquitin fusion protein
comprising ubiquitin fused to a single epitope-containing segment
comprising one or more identical or non-identical epitopes, the
epitope-containing segment being fused to ubiquitin at N-terminus
of ubiquitin; (b) administering the fusion protein of step a) to an
animal under conditions appropriate for the stimulation of an
immune response.
80. A method for stimulating an immune response in an animal, the
immune response being directed toward a fusion protein, the method
comprising: a) providing a DNA construct encoding a fusion protein
of claims 1, 20, 41 or 58; b) introducing the DNA construct of step
a) into the cells of the animal under conditions appropriate for
expression.
81. A ubiquitin fusion protein comprising ubiquitin having the
peptide QHWSYGLRPGQHWSYGLRPGQHWSYGLRPGQHWSYGLRPGC fused via its N
terminus to the C-terminal residue of ubiquitin, the ubiquitin
fusion protein being cleavable by a ubiquitin-specific
protease.
82. The fusion protein of claim 81 conjugated to an immunogenic
carrier protein.
83. A ubiquitin fusion protein comprising ubiquitin having the
peptide QHWSYGLRPGQHWSYGLRPGQHWSYGLRPGQHWSYGLRPG fused via its N
terminus to the C-terminal residue of ubiquitin, the ubiquitin
moiety being modified such that the ubiquitin fusion protein is
non-cleavable by a ubiquitin-specific protease.
84. A method for stimulating an immune response in an animal, the
immune response being directed toward a ubiquitin fusion protein,
the method comprising: (a) providing a ubiquitin fusion protein
comprising ubiquitin having the peptide
QHWSYGLRPGQHWSYGLRPGQHWSYGLRPGQHWSYGLRPGC fused via its N terminus
to the C-terminal residue of ubiquitin; and (b) administering the
conjugate of step (a) to an animal under conditions appropriate for
the stimulation of an immune response.
85. The method of claim 84 wherein thephysiological consequences of
administration to the animal are substantially similar to the
consequences of surgical castration.
86. A method for the identification of antibodies in experimental
or diagnostic samples, comprising: a) providing a ubiquitin fusion
protein of selected from the group consisting of ubiquint fusion
proteins described in claims 1, 20, 41 and 58; b) providing
antibodies from an experimental or clinical source; c) forming an
incubation mixture comprising the ubiquitin fusion protein of step
a) and the antibodies of step b); and d) detecting binding of the
antibodies of step b) to the ubiquitin fusion protein of step
a).
87. A method for reducing levels of a predetermined protein in an
animal relative to base-line levels, comprising: a) providing a
ubiquitin fusion protein of selected from the group consisting of
ubiquitin fusion proteins described in claims 1, 20, 41 and 58
which contain at least one epitope representing an epitope from the
predetermined protein and b) administering the fusion protein of
step a) to the animal under, conditions appropriate for the
stimulation of an immune response.
88. The method of claim 87 wherein the predetermined protein is a
peptide hormone.
89. The method of claim 88 wherein the predetermined peptide
hormone is a male-specific or female-specific peptide hormone.
90. The method of claim 89 wherein the predetermined peptide
hormone is gonadotropin releasing hormone.
91. The method of claim 87 wherein the predetermined protein is
tumor necrosis factor.
92. The method of claim 87 wherein the predetermined protein is a
growth hormone protein.
93. The method of claim 87 wherein the fusion protein is conjugated
to a non-ubiquitin carrier protein.
94. A method for reducing levels of a predetermined protein in an
animal relative to base-line levels, comprising: a) providing a DNA
construct encoding a ubiquitin fusion protein of selected from the
group consisting of ubiquitin fusion proteins described in claims
1, 20, 41 and 58 which contain at least one epitope representing an
epitope from the predetermined protein; and b) introducing the DNA
construct of step a) into the cells of an animal under conditions
appropriate for the expression and stimulation of an immune
responses.
95. The method of claim 94 wherein the predetermined protein is a
peptide hormone.
96. The method of claim 95 wherein the predetermined peptide
hormone is a male-specific or female-specific peptide hormone.
97. The method of claim 96 wherein the predetermined peptide
hormone is gonadotropin releasing hormone.
98. The method of claim 94 wherein the predetermined protein is
tumor necrosis factor.
99. The method of claim 94 wherein the predetermined protein is a
growth hormone protein.
100. The method of claim 94 wherein the fusion protein is
conjugated to a non-ubiquitin carrier protein.
Description
BACKGROUND OF THE INVENTION
[0001] The construction of immunogenic peptides or peptide
conjugates is an active and ongoing research pursuit. The goals
include production of reagent antibodies for research, for example
in neurobiology, and production of synthetic vaccines for human or
veterinary application. Small synthetic peptides are poor antigens
and typically require covalent association with macromolecular
carriers and administration with adjuvant in order to elicit an
immune response. Carriers also provide T-cell epitopes necessary
for cell-mediated response and for helper functions in the humoral
response. When presented appropriately, synthetic peptides can
elicit antibodies against large proteins which display the same
peptide epitope within their sequence. Vaccine research further
seeks to define those synthetic immunogens capable of inducing an
antibody response that is also able to neutralize the infectious
activity of a virus or other pathogen from which the protein is
derived.
[0002] A significant effort has been devoted to discovery of
general rules which govern the selection of protein epitopes by the
immune system and development of methodology for mimicry of such
epitopes with synthetic immunogens. Evidence has emerged suggesting
that linear or discontinuous epitopes may be recognized and that
these may adopt defined conformational states that are not readily
duplicated in a synthetic peptide. Attempts to devise
conformationally restricted peptides as superior antigens have also
been given serious attention. In such approaches the structural
context of a peptide sequence within a protein antigen is
considered in producing a suitable mimic. Typically, the epitope
may adopt a secondary structure such as a .beta.-turn or a-helix. A
similar structure may be induced in a small peptide by
intramolecular covalent modification between two residues that
constrains its conformational freedom. These ordered structures can
be important as B-cell determinants. However, they are insufficient
immunogens in the absence of helper T-cell determinants. Recently
developed peptide vaccine models have incorporated T-cell epitopes
in association with the B-cell epitope. Designs include simple
tandem linear synthesis of peptides as well as increased epitope
valency through coupling T-cell and B-cell peptides to a branched
polylysine oligomer. The latter assemblies, referred to as multiple
antigenic peptides, have shown promise as vaccines against various
pathogens.
[0003] Unlike the conformationally defined B-cell epitopes,
sequences recognized by T-cells undergo extensive processing to
short linear peptide fragments before they are bound to a major
histocompatibility complex (MHC) for recognition at the surface of
an antigen-presenting cell. This elaborate processing mechanism
depends on intracellular proteolytic activity and translocation of
the products to the cell membrane. Synthetic peptide immunogens may
not effectively participate in this process, despite the presence
of the T-cell epitope. The immunogenicity of the molecule can be
expected to correlate with the efficiency of natural processing of
the T-cell epitope. Studies with linear synthetic peptides
indicated that chimeric peptides containing T-cell and B-cell
epitopes were superior immunogens when the B-cell epitope was
amino-terminal. However, the reverse orientation has also been
reported to produce a stronger immune response. A general rule may
not be obvious since natural antigen processing probably accepts
various orientations, including internal epitopes that require
multiple processing steps to release the peptide. Also the
efficiency of a construct may depend on many other factors, such as
molecular context and flanking sequences that affect processing or
presentation and the overall nature of the immunogen which can
affect the functional pairing between several available T-cell and
B-cell epitopes.
[0004] Further limitations to the use of synthetic peptides as
vaccines result from the genetic restriction to T-cell helper
function. Multiple MHC class II molecules encoded within the genome
of a species are subject to allelic exclusion. A specific T-cell
epitope may interact with only one or a few alleles of the MHC.
Therefore individuals may respond differently to the immunogen
despite inclusion of T-cell helper epitopes. Vaccine development
must overcome the MHC-restricted response to provide the broadest
possible response in an outbred population. In the murine model the
T-helper cell responses are MHC-restricted and major haplotypes
H-2b, H-2k, and H-2d are represented in several inbred strains.
Certain T-cell epitopes are known to be recognized in the context
of multiple MHC class II alleles and can thereby provide
"promiscuous" T-helper stimulation. A number of epitopes, such as
from tetanus toxin, measles virus, and Mycobacterium tuberculosis
have been reported to be universally immunogenic. These may have
significant benefit for subunit vaccine design.
[0005] As an alternative to chemical synthesis, molecular
biological techniques can provide significant advantages for
production of polypeptides that display both B-cell and T-cell
epitopes. Expression of proteins from cloned genes obviates
burdensome peptide synthesis, purification and conjugation
chemistry typically used in production of immunogenic materials.
Furthermore, the stochastic chemistry for preparation of
peptide-carrier conjugates is replaced by the defined chemical
structure provided by the genetic fusion. Therefore the epitopes
can be introduced in ordered structures that have optimal and
reproducible immunogenic properties. Considerations that arise in
the development of optimal designs can be addressed at the genetic
level. Thus, definition of the target epitopes and their flanking
sequences, relative orientation and conformations of these
sequences within the larger polypeptide, and epitope copy frequency
can be established in the gene design.
[0006] Several recombinant host proteins have been successfully
utilized for immune presentation of peptide epitopes. The E. coli
maltose-binding protein (MalE) has been used to study the influence
of location and orientation of inserted T-cell epitopes. The major
coat protein (pVIII) of filamentous bacteriophage fd has been used
for display of HIV B-cell epitopes at the N-terminus. The
recombinant phage particles evoked a strong antibody response in
mice, which cross-reacted with HIV strains and which is also
capable of neutralizing the virus. These approaches promise to
enhance the potential of subunit or synthetic vaccine models.
SUMMARY OF THE INVENTION
[0007] The present invention relates to a variety of
epitope-containing heat shock fusion proteins. In one embodiment,
the heat shock protein ubiquitin is fused to a variety of eptiopes
or epitope-containing segments. The specific fusion architecture is
described in detail below. The epitope-containing segments of the
ubiquitin fusion protein comprise either a single epitope or a
group of identical or non-identical epitopes.
[0008] The present invention also relates to DNA constructs which
encode an epitope-containing heat shock fusion protein of the type
described above, and to cells transformed with such expression
constructs.
[0009] In other aspects, the present invention relates to methods
for stimulating an immune response in an animal, the immune
response being directed toward a heat shock fusion protein of the
type described above. The heat shock fusion protein is administered
to an animal under conditions appropriate for the stimulation of an
immune response. In an alternative embodiment, a DNA construct
encoding the heat shock fusion protein is introduced into cells,
rather than the fusion protein directly.
[0010] The present invention also relates to methods for inducing
the production of antibodies to endogenous biomolecules using a
heat shock fusion protein as described above where the said peptide
epitopes are, or are not, related to the endogenous biomolecules in
chemical composition but are so called "mimics" of the biomolecular
structure and as such have the ability to elicite antibodies to the
said biomolecules. Such peptide (epitope) mimics are isolated
typically by using phage peptide libraries.
[0011] The present invention also relates to methods for reducing
levels of a predetermined protein (e.g., hormone(s)) in an animal
relative to base-line levels, to methods for reducing endogenous
TNF levels relative to those in a disease state, to methods for
reducing the sperm count in males or inactivating sperm in men and
women, to methods for reducing the allergic response, to methods
for increasing the growth rate of an animal and to methods for the
production and identification of antibodies for use in experimental
or diagnostic samples.
DETAILED DESCRIPTION OF THE INVENTION
[0012] The present invention is based, in one aspect, on the
discovery that a fusion protein comprising a heat shock protein
(e.g., ubiquitin), fused to an epitope or epitopes in a defined
manner, is useful for the stimulation of a highly specific immune
response when administered to an animal. The specific fusion
architecture encompassed by the invention will be discussed in
greater detail below.
[0013] Heat shock proteins are proteins which are induced during a
heat shock. Other stress stimuli are also known to induce a similar
response. These proteins are produced to enable the cell to better
stand the heat shock or stress. Under these conditions the pattern
of gene expression changes and cells overproduce a characteristic
set of proteins commonly referred to as heat-shock proteins (hsps).
One factor in the induction of the heat shock response is the
proteolysis of abnormal proteins.
[0014] Various examples of heat shock proteins-exist. In yeast,
mammals and other eukaryotes, ubiquitin is one of these proteins.
Ubiquitin is known to be involved in an ATP-dependent pathway of
proteolysis. It is also known that proteolysis is an important step
in the production of peptides which function in development of the
immune response to antigens. Thus it is recognized that hsps are
ideal candidates for use in connection with vaccine
development.
[0015] In connection with the present invention, ubiquitin is used
as a scaffold to stabilize and display recombinant immunologically
active heterologous antigens (referred to herein as epitopes),
presumably in a form which generally approximates the native
conformation of the epitope. This technique is sometimes referred
to as conformational mimicry. Generally, the preferred size of the
amino acid segments referred to in items a) and b) of the preceding
paragraph range from about 5 to about 70 amino acid residues,
although larger segments are not intended to be excluded by this
statement of the preferred size range.
[0016] Ubiquitin is a small 76-residue single domain protein which
does not induce an appreciable immune response when administered to
an animal. Presumably, this "immunological silence" is based on the
fact that ubiquitin is expressed in nearly identical form in all
eukaryotic systems. Ubiquitin has a variety of other
characteristics which make it an ideal "carrier" for the
conformational mimicry approach. For example, ubiquitin is highly
resistant to protease digestion and is extremely stable both in
vivo and when stored for extended periods of time in vitro. The
three-dimensional structure of ubiquitin has been determined by
X-ray crystallography and its small size makes it amenable to
molecular modeling. Additionally, ubiquitin fusions can be
overexpressed in prokaryotic systems such as E. coli, in soluble
form, and purified. One of skill in the art will recognize that for
particular applications some of the aforementioned properties are
unimportant and dispensable. At the present time, there is no
comparable protein scaffold system available which offer the
benefits of the ubiquitin system.
[0017] If epitopes are to be fused to the ubiquitin framework as
outlined above, whether at a single location or non-contiguous
locations, it is important to determine what types of ubiquitin
modifications are tolerated. In this context, "tolerated" can have
at least two meanings, systemic tolerance and functional tolerance.
It should also be noted that the expression "fused", as used
herein, means covalent bound by an amide linkage. This expression
encompasses insertion, as well as substitution. At times, these
expressions may be used interchangeably herein.
[0018] Systemic tolerance, (i.e., tolerance by the immune system)
is important to ensure that the immune response is directed to the
epitopes, and not to the ubiquitin carrier. Thus, epitope insertion
should be designed such that changes to the secondary and tertiary
structure of ubiquitin are minimized.
[0019] Ubiquitin functional tolerance refers to the ability of the
ubiquitin protein to behave functionally in a manner analogous to
wild-type ubiquitin. This functional tolerance can also be
important in a variety of contexts. This property should also be
maintained, at least in connection with certain applications, by
the ubiquitin fusion carrier constructs of the present
invention.
[0020] As disclosed herein, insertions at particular internal sites
in ubiquitin are "tolerated", as this term is defined above. One
advantage of using ubiquitin as an immunogenic display scaffold,
particularly for an internally-fused epitope or epitopes, resides
in its ability to maintain the secondary structure found in the
epitopes native protein. These secondary structures include, for
example, .beta.-turns and .alpha.-helices. The conformation of the
epitope can be further modified by introducing intramolecular bonds
between two residues of the epitope which results in conformational
constraints on the overall structure of the epitope. The fusion of
an epitope or epitopes to terminal regions of ubiquitin also offers
advantages in connection with immune-stimulatory activities.
[0021] In a first embodiment, the present invention relates to a
ubiquitin fusion protein comprising ubiquitin fused to a single
epitope-containing segment comprising two or more identical or
non-identical epitopes, the epitope-containing segments being fused
to ubiquitin at fusion sites selected from the group consisting of
the N-terminus and an internal fusion site. As discussed in greater
detail below, a variety of considerations are taken into account
when selecting an epitope of use in connection with the fusion
proteins of the present invention. Generally speaking, an epitope
which can stimulate an immune response which protects against an
infectious disease, an auto-immune disease or allergic reactions
are candidate epitopes for use in connection with the present
invention. Epitopes which do not fall into one of these categories
can also be useful, and non-limiting examples are discussed more
fully below.
[0022] With respect to the first embodiment, fusions at a single
internal location in the ubiquitin moiety must be designed
rationally to minimize, for example, adverse consequences with
respect to ubiquitin structure and function. In light of the fact
that fused epitopes must be "seen" by the immune surveillance
system, it is also important that internally fused epitopes are
exposed in the folded fusion protein, not buried within a
hydrophobic domain. The plurality of epitopes can also be fused to
ubiquitin at the N-terminus of the molecule. The epitopes can be
identical or non-identical. In addition, the epitopes can be B cell
epitopes, T cell epitopes or a mixture of B and T cell epitopes.
For many applications, preferred epitopes are B-cell epitopes which
are known to be a target for neutralizing antibodies.
[0023] A second embodiment of the present invention relates to a
ubiquitin fusion protein comprising ubiquitin fused to two or more
non-contiguous epitope-containing segments, each epitope-containing
segment comprising one or more identical or non-identical epitopes.
The non-contiguous locations where fusion is appropriate are
internal locations within the ubiquitin moiety, or at the N- or
C-terminus of the ubiquitin molecule.
[0024] As used herein in connection with the second embodiment, the
term "epitope-containing segment" refers to a sequence of amino
acids containing one or more epitopes. The epitopes within any
particular epitope-containing segment can be identical, or
non-identical. In addition, the epitopes in a particular
epitope-containing segment can be B cell epitopes, T cell epitopes
or a mixture of B and T cell epitopes. As discussed above, B-cell
epitopes targeted by neutralizing antibodies are preferred in some
contexts.
[0025] When considering the insertion of epitopes within the
ubiquitin molecule, the structure of the ubiquitin molecule must be
considered. The prominent structural features of ubiquitin, as
determined by X-ray crystallography (see, e.g., Vijay-Kumar et al.,
Proc. Natl. Acad. Sci. USA 82: 3582 (1985); Vijay-Kumar et al., J.
Mol. Biol. 194: 525 (1987); and Vijay-Kumar et al., J. Biol. Chem.
262: 6396 (1987)) include a mixed .beta.-sheet comprising two
parallel inner strands (residues 1-7 and. 64-72), as well as two
antiparallel strands (residues 10-17 and 40-45). In addition, an
.alpha.-helix (residues 23-34) fits within the concavity formed by
the mixed .beta.-sheet.
[0026] The amino acid sequences which link the structural elements
defined in the preceding paragraph are referred to herein as "loop
regions". Thus, loop regions can be defined as domains of ubiquitin
which link either two strands within a .beta.-sheet or a strand of
a .beta.-sheet and an .alpha.-helix. Insertions and substitutions
can be made within these loop regions without disrupting the
integrity of the ubiquitin molecule or abolishing the features
which make ubiquitin a useful carrier for the display of
constrained epitopes. Insertions and substitutions within these
loop regions tend not to alter the relationships between the
prominent structural features defined in the preceding paragraph.
Rather, the epitopes introduced into these loop regions tend to
protrude from the compact globular ubiquitin structure thereby
exposing these epitope residues such that they are easily
recognizable by lymphocytes, for example.
[0027] As discussed above, internal modification sites are selected
such that the ubiquitin secondary structure is maintained and the
conformation of the inserted epitope is constrained. Epitopes can
also be joined to ubiquitin as extensions of the C-terminus.
Epitopes fused to the C-terminus of ubiquitin can be cleaved off by
ubiquitin-specific proteases in vivo or in vitro. This allows the
peptide to be administered to a cell as part of a larger fusion
protein which is both easier to purify and handle as compared to
free epitope. Following cellular uptake, the epitope attached to
the ubiquitin can be cleaved from the C-terminus of ubiquitin and
associated with a surface protein such as the MHC complex for
expression on the cellular membrane.
[0028] In another embodiment, the subject invention relates to a
ubiquitin fusion protein comprising ubiquitin fused to a single
epitope-containing segment, the epitope-containing segment
comprising two or more identical or non-identical epitopes. The
epitope-containing segment can be fused to ubiquitin at its
N-terminus, terminus or internally.
[0029] The invention relates to yet another fusion protein
embodiment comprising ubiquitin fused to a single
epitope-containing segment comprising one or more identical or
non-identical epitopes. In this embodiment, the epitope-containing
segment is fused to the ubiquitin moiety at the N-terminus of
ubiquitin.
[0030] The use of ubiquitin fusion proteins to initiate a humoral
response is described in more detail in the following
Exemplification section. More, specifically, these experiments
demonstrate, for example, that the B-cell and T-cell epitopes
expressed in the ubiquitin fusion protein stimulated targeted
immune responses. Further, the experiments demonstrate that a
humoral immune response to an internally inserted B-cell epitope
was enhanced by the addition of a T-cell epitope to the C-terminus
of the ubiquitin fusion protein. Although the bulk of the in vivo
data reported herein were generated in experiments employing murine
indicator assays for the generation of antibodies against the
ubiquitin fusion proteins, the fundamental principles are
applicable to humans as well as other animals. Given the disclosure
of the subject application it is a matter of routine
experimentation to select epitopes of interest and incorporate such
epitopes of interest into a ubiquitin fusion protein for use as an
immunogen.
[0031] Thus, in a preferred embodiment, the ubiquitin fusion
protein comprises an internally inserted B-cell epitope and a
T-cell epitope joined to the C-terminus of ubiquitin. One of skill
in the art can identify B-cell epitopes which have the ability to
drive a strong humoral immune response following administration to
an animal. The B-cell epitope which is selected will depend upon
the intended use of the ubiquitin fusion protein. For instance, if
the ubiquitin fusion protein is to be used as a vaccine, the B-cell
epitope can be derived from a protein which is expressed by a
virus, bacteria or other infectious organism associated with
causing a disease. The protein which is selected should be one
which contains epitopes which elicit strong antibody responses.
These responses are associated with protection of the animal
species from the symptomology caused by the infectious organism.
Preferably, the B-cell epitope which is selected is derived from a
portion of the protein from the infectious organism known to be
both highly immunogenic and to which protective antibodies can be
produced. In general, this will include proteins found on the
surface of the infectious organism which are involved in binding
and to which antibodies have a high degree of access.
[0032] One example of a B-cell epitope which fulfills the
requirements set forth above is the V3 loop of the HIV gp120
glycoprotein. As described in the following section, an epitope
derived from the V3 loop of the HIV gp120 glycoprotein, when
internally inserted within a ubiquitin fusion protein, is able to
drive a strong humoral response. In fact, the antibody response was
stronger than that found when the epitope was administered
independently as a peptide antigen. The selection of this epitope
was based on extensive data showing it is a target of neutralizing
antibodies.
[0033] The selection of the B-cell epitope is not limited to
proteins associated with infectious organisms. For instance, as
shown in Example 2 below, when the ubiquitin fusion protein
contains an internally inserted epitope from a prostate-specific
antigen, a strong antibody recognition was detected. Examples of
other epitopes useful in connection with the present invention
include those from proteins which are commonly used as
immunological "carriers" as part of experimental studies. These
include hen egg lysozyme, keyhole limpet hemocyanin and ovalbumin.
One of skill in the art will recognize that any protein containing
a B-cell epitope which is capable of driving a humoral immune
response can be included in a fusion protein of the present
invention. Many such epitopes are known and others can be
determined through routine experimentation.
[0034] In a preferred embodiment, a T-cell epitope is joined to the
C-terminus of the ubiquitin fusion protein. This epitope is
selected based on its ability to enhance the humoral immune
response directed to the internally inserted B-cell epitope when
both are placed in their proper orientation with respect to
ubiquitin. The preferred T-cell epitope is selected from a group of
T-cell epitopes which are able to elicit "promiscuus" T-cell help.
This type of T-cell epitope is commonly referred to as a universal
epitope. Universal T-cell epitopes function by stimulating helper
T-cells specific to the B-cells responsive to the ubiquitin fusion
protein containing the internally inserted B-cell epitope. They do
this regardless of the subject's MHC haplotype or whether the
specific "target" protein is different than the protein the
universal T-cell epitope is derived from. Examples of universal
T-cell epitopes include epitopes from tetanus toxin, measles virus
and Mycobacterium tuberculosis. This list of universal T-cell
epitopes is not intended to be comprehensive, others which are
known or can be determined through application of routine
experimentation are also included.
[0035] To stimulate cytotoxic T-cells as part of a cellular immune
response, T-cell epitopes are preferably inserted internally within
the ubiquitin moiety. In addition, it is preferable to fuse at
least one T-cell epitope to the C-terminus of the ubiquitin fusion
protein. In this case, the T-cell epitopes are selected on the
basis of their ability to ensure stimulation of cytotoxic T-cells
specific for the particular epitope. However, a universal T-cell
epitope can be attached to the C-terminus of the ubiquitin fusion
protein to enhance the stimulation of the specific T-cell
response.
[0036] Cytotoxic T-cells play an important role in the surveillance
and control of viral infections, bacterial infections, parasitic
infections and cancer, for example. Vaccination with synthetic
epitopes, or with epitope pulsed cells, has been shown to induce
specific cytotoxic T-cell responses directed against immunogenic
viral or tumor-derived epitopes. Alternative protocols of T-cell
activation allow the triggering of more selective cytotoxic T-cell
responses with greater therapeutic effectiveness.
[0037] Generally, the fusion of peptides to the C-terminus of
ubiquitin generates a construct which is cleavable, in vivo, by
ubiquitin-specific proteases. It is well-established that such
ubiquitin-specific proteases cleave ubiquitin fusions after a
C-terminal residue (residue 76), thereby releasing the C-terminal
peptide. The present invention also encompasses ubiquitin fusion
proteins which have been modified such that the fusion is not
efficiently cleaved by ubiquitin-specific proteases. As is well
known to those of skill in the art, ubiquitin can be made resistant
to ubiquitin-specific proteases by altering residues at the
C-terminus of ubiquitin. For example, by altering the identity of
the amino acid at position 76 of ubiquitin (e.g., from glycine to
valine or cysteine), the rate of cleavage of a C-terminal ubiquitin
fusion can be substantially reduced to the point where cleavage can
not be detected using the assays typically employed for monitoring
such cleavage.
[0038] As mentioned previously, the present invention also
encompasses fusions to the N-terminus of ubiquitin. It is noted
that fusion proteins in which an epitope or epitopes are attached
to the N-terminus ubiquitin must be designed such that the
N-terminal residue of the encoded fusion protein is methionine. If
the N-terminal residue is a residue other than methionine,
initiation of translation does not occur efficiently.
Unfortunately, however, previous studies have demonstrated that
fusions of this type can reduce antibody binding or elicit the
production of antibodies of low affinity for the epitope fused to
the N-terminus of ubiquitin.
[0039] To overcome this problem, a tandem ubiquitin fusion is
created by attaching a second ubiquitin protein to the N-terminus
of the epitope or epitopes attached to the N-terminus of the first
ubiquitin moiety. Thus, in this embodiment of the present
invention, two ubiquitin molecules flank an epitope or epitopes.
The C-terminus of the N terminal ubiquitin protein is of the
wild-type sequence such that it is cleavable by ubiquitin specific
proteases. DNA encoding this tandem ubiquitin fusion is used to
transform either prokaryotic or eukaryotic cells. Previous work has
shown that the tandem ubiquitin fusion is produced at an equivalent
or increased level as compared to the single ubiquitin fusion
proteins.
[0040] Following purification, the tandem ubiquitin fusion can be
cleaved, in vitro, by a ubiquitin specific protease thereby
releasing the N terminal ubiquitin protein from the core fusion
protein which is comprised of an epitope attached to the N-terminus
of the C terminal ubiquitin protein.
[0041] The C terminal ubiquitin protein in the tandem ubiquitin
fusion protein can be modified by the inclusion of other epitopes
in a manner consistent with the description of the invention above.
Thus, fusion can be made within the C terminal ubiquitin molecule
or to the C-terminus of the C terminal ubiquitin molecule.
[0042] An alternative tandem ubiquitin construct suitable for use
in connection with all embodiments of the present invention is
encompassed within the scope of the present invention. More
specifically, in the alternative tandem ubiquitin construct, the
two ubiquitin moieties are contiguous (i.e., the N-terminus of a
first ubiquitin moiety is joined to the C-terminus of a second
ubiquitin moiety). In this embodiment, the N-terminal residue of
the first ubiquitin moiety is a residue other than methionine. This
first ubiquitin moiety is then fused to a wild-type ubiquitin
moiety which is cleavable by a ubiquitin-specific protease.
[0043] Alternatively, the second ubiquitin moiety in this tandem
construct need not be a complete ubiquitin moiety. Rather, a
C-terminal subdomain of ubiquitin competent to direct cleavage by a
ubiquitin-specific protease, is sufficient. In addition, in
connection with this and any other embodiment of the present
invention, ubiquitin (or portions thereof) may be modified to
inhibit cleavage by a ubiquitin-specific protease.
[0044] A variant of one of the two major embodiments of the present
invention is a ubiquitin fusion comprising a first and a second
epitope-containing segment inserted internally, and a third
epitope-containing segment fused to the C-terminus of ubiquitin.
The subject invention encompasses a wide range of such variant
embodiments. There is no theoretical limit on the number of
epitopes which can be inserted within or fused to the N and
C-terminus of a ubiquitin fusion protein.
[0045] In preferred embodiments, internally fused epitopes are
fused as single epitopes, non-contiguously. This design ensures
that antibodies produced following vaccination are specific for a
single epitope and do not cross-react with other epitopes which
have also been internally fused to ubiquitin. Thus, each epitope
elicits a specific antibody response by producing antibodies which
do not cross-react with other epitopes contained within the same
ubiquitin fusion protein. The use of an epitope-containing segment
in which two or more distinct epitopes are displayed is preferred
when attempting to create bifunctional antibodies for experimental,
diagnostic or therapeutic uses.
[0046] In another embodiment of the present invention, an
epitope-containing ubiquitin fusion protein is modified by
conjugation to a carrier protein such as ovalbumin (OVA) or keyhole
limpet hemocyanin (KLH). Example 5, presented below, exemplifies
such an embodiment.
[0047] Ubiquitin fusion proteins of the type described above can be
modified post-translationally by the addition of fatty acids to
enhance immunogenicity. For example, palmatic acid (C.sub.16) can
be added using appropriate chemistry for this purpose.
[0048] The discussion above has focused on a wide variety of
epitope-containing ubiquitin fusion proteins. The invention also
relates to DNA expression constructs which encode such
epitope-containing ubiquitin fusion proteins. These constructs can
be based on prokaryotic expression vectors or eukaryotic expression
vectors. Many examples of such expression vectors are known in the
art. Prokaryotic expression vectors are useful, for example, for
the preparation of large quantities (e.g., up to milligram
quantities) of the ubiquitin fusion protein. Eukaryotic expression
vectors are useful, for example, when the addition of carbohydrate
side chains (i.e., glycosylation) is important. The carbohydrate
side chains can affect the properties of a protein in a variety of
ways including, for example, the ability of the protein to function
in vivo or in vitro; the ability of the protein to form a complex
and associate with other proteins or nucleic acids; and the ability
of the protein to bind to an antibody or other molecules specific
for the protein of interest.
[0049] In another aspect, the present invention relates to methods
of vaccination. The vaccine can be used to drive a cellular and/or
humoral immune response depending on the type of epitopes fused to
the ubiquitin fusion protein. The therapeutic amount of the
ubiquitin fusion protein given to an animal species will be
determined as that amount deemed effective in eliciting the desired
immune response. The ubiquitin fusion protein is administered in a
pharmaceutically acceptable or compatible carrier or adjuvant.
[0050] Thus, the present invention also encompasses pharmaceutical
compositions for the administration of ubiquitin fusion proteins.
Examples of specific diseases which can be treated in this manner
include, for example, gastrointestinal diseases, pulmonary
infections, respiratory infections and infection with HIV. The
pharmaceutical compositions are prepared by methods known to one of
skill in the art. In general, the ubiquitin fusion protein is
admixed with a carrier and other necessary diluents which are known
in the art to aid in producing a product which is stable and
administrable. Administration of the pharmaceutical composition can
be accomplished by several means known to those of skill in the
art. These include oral, intradermal, subcutaneous, intranasal,
intravenous or intramuscular.
[0051] Conventional vaccination methods involve the administration
of an epitope-containing protein. Recently, and alternative to
conventional vaccination methods, referred to as DNA vaccination,
has been developed. In this method, DNA encoding the
epitope-containing protein is introduced into the cells of an
organism. Within these cells, the epitope-containing protein is
directly expressed. Direct expression of the ubiquitin fusion
proteins of the present invention by endogenous cells of a
vaccinated animal allows for the continual stimulation of humoral
and cellular immune responses over an extended period of time. This
is in contrast to standard immunization protocols whereby the
vaccine is injected at a single site one or more times. Following
injection, the vaccine is disseminated to lymphoid organs where a
single immune response occurs.
[0052] Direct expression can be accomplished by introducing DNA
constructs which encode the desired ubiquitin fusion protein into
the cells of an animal. The constructs typically contain promoter
elements and other transcriptional control elements which direct
the expression of the ubiquitin fusion protein. Introduction of the
DNA construct can be by any conventional means including direct
injection. The preferred administration site is muscle tissue or
tissues rich in antigen presenting cells.
[0053] The introduction of a ubiquitin fusion protein as described
above can also induce a tolerizing effect on the humoral or
cellular immune response in an animal. Tolerization occurs
following delivery of the ubiquitin fusion proteins to T-cells. The
induction of a tolerization response is useful, for example, in
connection with the treatment of allergic or autoimmune disorders.
Examples of epitopes which can be used in a therapeutic regimen
designed to induce tolerization include the Fel d 1 peptides, which
are the major allergens found in cat pelts. These peptides can be
internally inserted, for example, and fused to a cleavable
C-terminus of ubiquitin. Typically patients to be treated are dosed
subcutaneously with the ubiquitin fusion proteins once per week for
several weeks. However, dosing can also be done orally or
intranasally over a similar length of time. The result is a
reduction of the allergic and/or autoimmune responses. These
ubiquitin fusion proteins can also be given orally.
[0054] The use of ubiquitin as a scaffold for the presentation and
stimulation of immune responses also allows the stimulation and
generation of anti-self responses. An example of a potentially
valuable anti-self response is the generation of anti-GnRH
(gonadotrophin releasing hormone) antibodies. As described in
Example 3 below, efforts have been made to generate immunogens
which stimulate a strong anti-GnRH response which results in the
suppression of luteinizing hormone (LH) and follicle stimulating
hormone (FSH) and indirectly suppresses the production of the
steroidogenesis and gamete maturation in both males and females.
The value of this type of anti-self response in humans lies in the
treatment of prostate cancer and breast cancer.
[0055] In livestock and pets, the ability to stimulate an anti-self
response provides a simple alternative to physical castration.
Previous work employing complex immunogens has demonstrated varying
degrees of success in immunological castration. However, the
production of complex immunogens is cumbersome, typically involving
a combination of synthetic chemistry, expensive HPLC purifications,
and chemical coupling methods. The use of ubiquitin fusion proteins
containing GnRH epitopes facilitates the production of inexpensive
and potent immunogens for use in connection with immunocastration.
In particular, ubiquitin fusions which include the peptide
QHWSYGLRPGQHWSYGLRPGQHWSYGLRPGQHWSYGLRPGC are of interest.
[0056] Immunocastration of pigs is especially valuable since it
does not result in the detrimental side-effects associated with
physical castration. More specifically, physical castration of pigs
typically results in animals which do not grow as well as normal
animals. In addition, physically castrated pigs tend to have a
higher fat percentage than non-castrated pigs. Since,
immunocastrated animals are not castrated as early as those which
undergo normal physical castration, a farmer can take advantage of
the growth rates found with non-castrated animals. Finally, by
immunocastrating, the farmer avoids the production of unpalatable
meat found with uncastrated male pigs.
[0057] Other examples of self proteins which could be used with
ubiquitin to generate vaccines able to modulate the hormones,
cytokines and physiology of humans and animals are: growth hormone
and its peptides to modulate growth both negatively and positively;
TNF and its epitopes to modulate septic shock, arthritis,
inflammatory bowel disease, crohn's disease, and ulcerative
colitis; immunoglobulin epsilon heavy chain for the control of
allergic reactions; chorionic gonadotrophin for fertility control;
inhibit for fertility control; and Sperm proteins such as sp17 (for
example amino acids 4-19 and 118-127) and the 71 kd sperm protein
for control of fertility both in men and in women.
[0058] A further use of ubiquitin as a scaffold is as part of a
vaccine to enhance the growth rate and thereby the final weight of
livestock prior to shipment to market. This type of vaccine offers
a cost effective means to increase the value of livestock such as
pigs, cattle and other commonly raised animals. Presently, to
increase the weight of livestock several methods are being
utilized. Amongst these methods, the addition of antibiotics to the
feed has become very common. However, while addition of antibiotics
to feed is cost effective, it has limitations. For instance, it has
been blamed for an increase in the creation of antibiotic resistant
strains of bacteria.
[0059] An alternative means to increase the growth rate of
livestock which does not result in detrimental side-effects is
through vaccination of the animals with an epitope of growth
hormone which is part of a ubiquitin fusion protein. The result of
this vaccination is an increase in the activity of the animals
endogenous growth hormone. The vaccine is created by inserting an
epitope from the growth hormone protein (e.g., amino acids 54-95)
into the ubiquitin protein thus creating a ubiquitin-growth hormone
fusion protein. The effective use of this type of vaccine is
described in Example 7 below. More specifically, following the
injection of a vaccine comprised of adjuvant and a ubiquitin fusion
protein containing the growth hormone protein epitope, the growth
rate of pigs was improved when compared to control pigs which
received either adjuvant only or adjuvant and ubiquitin only.
[0060] In addition to the uses described above, the ubiquitin
fusion proteins of the present invention can be used for the
identification of antibodies from experimental or clinical samples.
Antibodies to be assayed can be found, for example, in blood, fecal
material, the linings of mucosal associated lymphoid tissues,
cellular biopsies and other sources known by one of skill in the
art to contain at least a minute quantity of antibody. Assays for
which the ubiquitin fusion proteins are well suited include ELISAs,
radioimmunoassay as well as other commonly used competition assays.
These types of assays are useful in identifying antibodies from an
experimental or clinical sample which have specificity to at least
one epitope of a known protein. In general, the assays involve
mixing a predetermined aliquot of the ubiquitin fusion protein with
a series of dilutions of the experimental or clinical antibody
sample. This is followed by detection of the antibodies which bind
to the ubiquitin fusion protein.
[0061] Detection can be accomplished by various means, but for the
present invention, a labeled detection antibody is preferable. For
example, if the experimental or clinical antibody sample is from a
human, the detection antibody can be a polyclonal antibody with
specificity for the human heavy chain portion of the sample
antibody. The detection antibody is attached to either an enzymatic
label, a radioactive label or a fluorochromatic label. Examples of
commonly used enzymatic labels are horse radish peroxidase and
alkaline phosphatase. A standard radioactive label includes iodine
131. Fluorochromatic labels include fluorescein and Texas red. The
method of visualization of the complex containing the ubiquitin
fusion protein, the sample antibody, and the labeled antibody
depends on the label attached to the antibody and would be known to
those of skill in the art.
EXAMPLES
[0062] No. 1
[0063] Fusion proteins consisting of short-peptide sequences
inserted within a ubiquitin scaffold were developed and tested as
immunogens for eliciting a targeted immune response. Preparation
and testing of the fusion proteins required several steps
including: (I) the design and construction of plasmids encoding
peptide sequences fused to the ubiquitin polypeptide at two
permissive sites which could be useful for epitope display; (II)
the high-level expression in E. coli, purification and
characterization of the expected ubiquitin fusions; and (III)
evaluation of the immune response in mice with regard to
immunogenicity, antibody specificity, cross-reactivity and helper T
cell response. Fusion proteins were developed to display the
sequence of the HIV-1 gp120 V3 loop, the principal recognition
determinant of virus neutralizing antibodies.
[0064] Materials and Methods
[0065] Mice
[0066] BALB/c, C57BL/6 and C3H/HeN female mice at 6-8 weeks of age
were obtained from Charles River (Frederick, Md.) or Jackson Labs.
Animals were housed and cared for in an IACUC supervised facility
in accordance with an NIH approved Animal Welfare Assurance.
[0067] Peptides, Proteins and Antibodies
[0068] Bovine ubiquitin (Sigma, St. Louis Mo.) was dissolved in PBS
and filtered through a 0.2 micron filter. Goat anti-mouse
peroxidase conjugate was used as obtained from Promega. Mouse
monoclonal antibodies against V3 peptides of gp120MN (HG-1) and
gp1201IIB (# 13-105-100) were purchased from Biodesign
International (Kennebunk, Me.) and from Advanced Biotechnologies
Inc. (Guilford, Md.) respectively. Recombinant proteins gp1201IIB
and gp120MN and a 36 residue "universal" V3 peptide
CTRPNNNTRKSIHIGPGRAFYTTGEIIGDIRQAHC (SEQ ID NO:1) were obtained
from Intracel Corporation (Cambridge, Mass.). Synthetic peptides
KRIHIGPGRAFYTTK (L-V3) (SEQ ID NO:2) and CKSIHIGPGRAFYTTGC (C-V3)
(SEQ ID NO:3) were obtained through the AIDS Research and Reference
Reagent Program, Division of AIDS, NIAID, NIH: from Peptide &
Protein Research Consultants. (Exeter, Devon, UK).
[0069] Oligonucleotide Design
[0070] Oligonucleotides were obtained by custom synthesis through
Bioserve Biotechnologies. Sequences shown below were designed to
encode peptide sequences and to provide appropriate complementary
overhangs for ligation to restriction sites in plasmids.
Oligonucleotides were treated with T4 polynucleotide kinase and
complementary pairs were annealed by heating to 65EC for 5 minutes,
then cooling: to room temperature over 30 minutes.
1 (SEQ ID NO:4) A 5'-TTAAGACTGCGTGGCGGCGACCA
GGTTCACTTCCAGCCGCTGCCGCCGGC-3' (SEQ ID NO:5) B
5'-TGTTGTTAAACTGTCTGACGCTC TGTAAGCTTCTGCA-3' (SEQ ID NO:6) C
5'-GAAGCTTACAGAGCGTCAGACAGTTTA ACAACAGCCGGCGGCA-3' (SEQ ID NO:7) D
5'-GCGGCTGGAAGTGAACCTGGTCGCC GCCACGCAGTC-3' (SEQ ID NO:8) E
5'-TTAAGACTGCGTGGCGCTGACCAGGTTCACT TCCAGCCGCTGCCGCCGGC-3' (SEQ ID
NO:9) F 5'-GCGGCTGGAAGTGAACCTGGTCA GCGCCACGCAGTC-3' (SEQ ID NO:10)
G 5'-AAGAAATCCACATCGGTCCGGGTCGTGCTTT CTACACCACCATCCCGCCGGATCA-3'
(SEQ ID NO:11) H 5'-ATCCGGCGGGATGGTGGTGTAGAAAGCACGA
CCCGGACCGATGTGGATTTCTTT-3' (SEQ ID NO:12) I 5'-TTAAGACTGCGTGGCGG
CATCCACATCGGTCCG-3' (SEQ ID NO:13) J 5'-GGTCGTGCTTTCTACAC
CACCTAACTGCA-3' (SEQ ID NO:14) K 5'-GTTAGGTGGTGTAGAAAGC
ACGACCCGGACCGAT-3' (SEQ ID NO:15) L 5'-GTGGATGCCGCCACGCAGTC-3'
[0071] Strains and Vector Construction
[0072] Ubiquitin fusions were cloned and expressed in the Proteinix
proprietary E. coli strain DH5.alpha. F' IQ.TM. (Life
Technologies). Vector constructs for expression of fusion proteins
are derivatives of pDSUb (provided by M. Rechsteiner, Univ. of
Utah), which is a derivative of pDS78/RBSII. The ubiquitin codon
usage was optimized for expression in E. coli. Transformants
containing pDSUb or its derivatives were selected for ampicillin
resistance. Ubiquitin fusion expression, under control of the lac
promoter, is inducible by addition of IPTG. Cloning at the
ubiquitin codon 35 was initially performed in pRSETUb, derived from
PRSET (Invitrogen, Inc.) by subcloning of the ubiquitin gene from
pDSUb to PRSET utilizing the Nde I and Hind III restriction sites.
Restriction sites for insertions at codon 35 of ubiquitin were
created by in vitro mutagenesis with a synthetic oligonucleotide
using the MORPH mutagenesis kit (5 Prime-3 Prime, Inc.) to obtain
pPX153. Digested vector fragments were treated with calf intestinal
alkaline phosphatase and purified from agarose gel slices after
electrophoresis using the Geneclean kit (Bio 101). Vector fragments
and double stranded oligos were ligated and products were used for
cloning in E. coli strain DHSaF' IQ.TM. (Life Technologies. All
restriction digests, ligations and transformation of E. coli were
done according to standard manipulations using commercial DNA
modifying enzymes as instructed by the manufacturer (New England
Biolabs). Correct cloning of the oligonucleotide insertions was
confirmed by DNA sequencing using the Sequenase Version 2.0 kit
(USB, Cleveland, Ohio).
[0073] Expression, Purification and Characterization of fusion
Proteins
[0074] Cell paste from bacterial fermentation was resuspended in
lysis buffer (5 ml/g wet paste) with vortexing. General purpose
buffer consisted of 20 mM MES pH 5.5, supplemented with 1 mM PMSF,
0.5 mM ZnCl2. Cultures expressing certain fusion proteins were
lysed in 50 mM acetate pH 4.0 (UbaMT) or pH 4.5 (UbgMT). Cells were
disrupted by sonication on ice 2.times.4 min with a 50% duty cycle.
Homogenates were centrifuged at 15,000.times.g, 45 min, 4EC. The
supernatants were further diluted with 3 volumes of lysis buffer,
filtered through a 0.45 Fm filter, and loaded onto a 30 mL SP
sepharose HP ion exchange column at a linear flow rate of 1.4
cm/min. The fusion protein was eluted by a NaCl gradient (0-0.5 M)
over 16 column volumes. Fractions were assayed by SDS-PAGE on
10-20% tricine gels (Novex, San Diego Calif.) and protein
concentration was determined by the BCA method (Pierce Co.) using a
ubiquitin standard curve. Peak fractions were pooled and evaluated
further by C18 reversed phase HPLC on a Vydac 218TP54 column using
a gradient of 30-45% acetonitrile in water containing 0.1% TFA over
7 min at 1.00 mL/min, with UV detector set at 214 nm.
[0075] Immunoblots were prepared by electroblotting of samples from
SDS-PAGE gels onto Immobilon-P membrane (Millipore Corp.) using an
X-Cell II Blot Module (Novex). The membranes were incubated in PBS
containing 4% dry milk overnight and then washed with PBS.
Incubations with primary antibody were done in PBS, 0.1% Tween 20
for 2 hr at room temperature. After 3 washes with the dilution
buffer, membranes were incubated with goat anti-mouse IgG HRP
conjugate at 1:5000 dilution in the same buffer. The wash steps
were repeated and the membrane was developed with ECL Western
detection reagents kit (Amersham, Waltham, Mass.) according to the
manufacturer's instructions.
[0076] In Vitro cleavage of Ubicuitin Fusion Proteins by UBP
[0077] Reactions of UbV3gMT, UbgMT and UbaMT were monitored by C18
reverse phase HPLC on a Vydac 218TP54 column with detection at 214
nm using a 10 min gradienty of 20-50% acetonitrile in water
containing 0.1% TFA, and by SDS-PAGE on 10-20% tricine gels.
Aliquots of fusion protein (100-200 Fg) were diluted into 200 FL of
50 mM Tris pH 8.0, 5 mM DTT, 1 mM EDTA. A 1 Fl aliquot of UCH-L3 (2
ug) or reaction buffer (control) was added and the samples were
incubated at 37EC and monitored over 1 hr by HPLC. SDS-PAGE samples
were run after 2 hrs reaction time.
[0078] For large scale digests, purified UbgV3 from SP sepharose HP
ion exchange was concentrated 3-fold by Centriplus 3 membrane
concentrators. The final concentration of fusion protein was 2.1
mg/ml. The fusion protein in 12 ml of buffer was buffered with 631
Fl of 1 M Tris pH 8.0, 64.8 uL 1 M DTT, 24.0 uL 0.5 M EDTA. UCH-L3
(0.24 mg in 120 Fl) was added and the reaction was incubated at
room temperature and monitored by HPLC. The product peptide peak
was purified by semi-preparative C18 HPLC (Vydac 218TP510 1.0 cm
diameter column) and lyophilized to yield the V3 peptide
IHIGPGRAFYTT (SEQ ID NO:16). Identity was verified by FAB-MS. The
MT peptide DQVHFQPLPPAVVKLSDAL (SEQ ID NO:17) was obtained by a
similar procedure from ion exchange purified UbgMT (4.82 mg/ml).
The peptide product was isolated from semi-preparative C18 HPLC
using a 20-40% gradient of acetonitrile in 20 mM potassium
phosphate, pH 6.0 over 8 min. The peptide content in the
lyophilized product was estimated at 10% by weight based on HPLC
peak area.
[0079] Immunization Protocols and Mouse Lymphocyte Proliferation
Assay
[0080] Mice were inoculated in groups of 3 to 5 per antigen by an
initial subcutaneous (s.c.) injection of 100 Fg of proteins in PBS
emulsified in an equal volume of complete Freund's adjuvant (CFA)
or incomplete Freund's adjuvant (IFA). Booster injections of
proteins (100 Fg) were delivered intraperitoneal in IFA 3 weeks and
7 weeks later. Blood samples were collected at 4 weeks, 6 weeks, 8
weeks and 10 weeks from the initial injection. Serum was separated
and diluted in PBS.
[0081] For preparation of sensitized T cells, mice were immunized
in groups of 3 by injection s.c. in footpads with 50 Fg of proteins
in PBS emulsified in IFA.d Eight to ten days later mice were
sacrificed and popliteal lymph nodes (LN) were removed aseptically.
LN cell suspensions in RPMI 1640 were prepared as described and
dispensed into 96-well plates at 5.times.105 cells per well.
Antigens or peptides were added in triplicate wells and plates were
kept in a CO.sub.2 incubator at 37EC for 4 days. Wells were then
pulsed with 3H-deoxythymidine (1 FCi/well) and cells were harvested
on filter pads 24 hours later using an automated collecting device.
Filter sheets were allowed to dry and then counts were read on a
Wallac microbeta plate reader (Wallac, Inc., Gaithersburg Md.).
Stimulation was expressed as the average signal of duplicate or
triplicate wells corrected for mean background counts (c.p.m. with
protein or peptide--c.p.m. with buffer added).
[0082] Immunoassays
[0083] Fusion proteins (50 Fg/ml) or synthetic peptides (10 Fg/ml)
in PBS were dispensed into immunosorbent 96-well plates (0.1
ml/well, Corning high binding flat bottom plates) and incubated for
1 hour at 37EC. Excess antigen was shaken out and nonspecific sites
were blocked by addition of PBS containing 10 mg/ml of BSA (0.1
ml/well, incubated 30 min at 37EC). Plates were washed three times
(Tris buffer 10 mM, 0.1% Tween 20, pH 8) and serially diluted serum
samples (1/103-1/104 in PBS supplemented with 1% BSA) were added
(0.1 ml/well). After 1 hour at 37EC plates were washed as before
and developed with affinity purified goat anti-mouse IgG-horse
radish peroxidase conjugate (0.5 Fg/ml in PBS supplemented with 1%
BSA, 0.1 ml/well). After washing, bound enzyme was detected with
o-phenylenediamine (1 mg/ml in phosphate-citrate buffer, 0.05M,
0.02% H.sub.2O.sub.2, pH 5). Plates were read at 450 nm on a
96-well plate reader (Titertek). Titers are expressed as the
dilution of serum giving an absorbance reading of 0.3 or 15% of the
maximum reading.
[0084] Solution phase binding assays were performed by incubating
peptides or proteins at concentrations ranging from 0.5-50 Fg/ml
with antiserum in 0.1 M potassium phosphate, 2 mM EDTA, 10 mg/ml
BSA, pH 7.8 at a fixed concentration of 2-fold greater than the
previously determined titer dilution. Samples were incubated at
37EC for 2 hours, then applied to antigen-coated ELISA plates. The
standard ELISA procedure was followed to determine the
concentration of unbound antibody relative to samples containing no
added ligand.
[0085] Results
[0086] Plasmid Construction and Sequences
[0087] Sequences of the oligonucleotides encoding for peptide
inserts and their letter designations are given above. Linearized
DNA from pDSUb restriction digested with Afl II and Pst I was
ligated to double-stranded oligos A/D and B/C to obtain pDSUbgMT.
Similar ligation to oligos E/F and B/C provided pDSUbaMT. Double
stranded oligos G/H were ligated to the 1.2 kb and 1.6 kb fragments
obtained from digest of pPX153 with restriction enzymes Xcm I and
Bpm I to provide the V3 insertion at codon 35 of ubiquitin.
[0088] The new vector pRSETUbV3 was digested with Bgl II and Afl
II, and the smaller fragment encoding UbV3 was gel purified.
Ligation of this fragment to pDSUb, pDSUbgMT or pDSUbaMT, each
digested with Bgl II and Afl II, generated expression vectors
pDSUbV3, pDSUbV3gMT, and pDSUbV3aMT respectively. These were used
to express the internal UbV3 fusion and double epitope fusions with
a 19-residue C-terminal extension DQVHFQPLPPAVVKLSDAL (MT
sequence)(SEQ ID NO:17) and either native (RGG) or mutant (RGA)
protease recognition site at the ubiquitin C-terminus. A vector
encoding ubiquitin fusion with a C-terminal 12-residue V3 sequence
was assembled as follows: pDSUb was digested with Afl II and Pst I
and the product ligated to paired oligos I/L and J/K to obtain
pDSUbV3c.
[0089] Expression Yield and Purification
[0090] Fermentations in 10 L batches provided 150-175 g of wet cell
paste. Fusion protein yields after a single ion exchange
chromatography step ranged from 185 mg to 336 mg per 15 g of cell
paste, equivalent to 1 L of culture. Product was isolated from 1-2
L shaker flask cultures (UbgV3) with similar results and yields.
Fusion proteins UbgMT and UbaMT required chromatography with 50 mM
acetic acid pH 4.0 and pH 4.5, respectively for retention on the
ion exchange matrix. Ubiquitin fusions purified by ion exchange
were greater than 98% pure as judged by SDS-PAGE.
[0091] In Vitro Cleavage of C-terminal Ubiquitin Fusions with
UCH-L3
[0092] Processing of ubiquitin fusion polypeptides by the ubiquitin
C-terminal hydrolase UCH-L3 is presumed to depend on recognition of
the native structure of the ubiquitin domain. Analytical digests of
UbV3gMT and UbgMT by UCH-L3 proceeded with similar efficiency as
shown by the HPLC and SDS-PAGE results. Cleavage of the UbV3gMT
having an internal fusion in the ubiquitin sequence suggests that
an insert in the 34-40 loop does not interfere with folding of
ubiquitin or recognition by the enzyme. The reaction can be
followed by the formation of peptide product detected by HPLC
analysis. SDS-PAGE analysis is useful for determining completion by
depletion of substrate and formation of a band corresponding in
size with ubiquitin.
[0093] The enzymatic digest of ubiquitin fusions is a practical
bioprocess for production of peptides. Two short peptides,
1HIGPGRAFYTT (SEQ ID NO:16) and DQVHFQPLPPAVVKLSDAL (SEQ ID NO:17),
useful in this study, were conveniently prepared by processing of
recombinant C-terminal ubiquitin fusions.
[0094] Binding and Specificity of Anti-V3 Deptide Antibodies to
UbV3
[0095] Antibodies that neutralize HIV-1 infectivity are directed
against the V3 loop or principal neutralizing determinant (PND) of
gp120. The PND is implicated in several viral mechanisms known to
evade the humoral immune response. Subunit vaccines based on the
native structure in gp120 indicate only weak immunogenicity toward
this region. Variability of the V3 loop in divergent viral isolates
and depletion of B-cells producing antibodies to the PND in
infected individuals could also allow for HIV-1 escape from immune
surveillance. The gp120 V3 loop has been studied in the context of
hybrid protein scaffolds or peptide fusions as a means of producing
immunogens that could induce neutralizing antibodies against HIV-1.
These materials could be important as components of an effective
vaccine for combating the virus.
[0096] Monoclonal antibodies raised against synthetic V3 peptides
which are known to react with gp120 were tested for binding to the
recombinant UbV3 by ELISA. The antibody HG-1 specific for gp120
from the HIV-1 strain MN bound to UbV3 and to a 36-residue
synthetic V3 loop "universal" peptide with similar efficiency. The
binding to UbV3 was inhibited by preincubating the antibody with
the 36-residue V3 peptide. Absorbance was reduced by 50% in the
presence of 0.5 Fg/ml peptide. Antibody specific for gp120 of the
111B strain did not bind-UbV3.
[0097] Ubiquitin fusion proteins analyzed by SDS-PAGE were
transferred to nitrocellulose membranes for Western blot assays.
Strong staining was seen when membranes were developed with mAb
HG-1 which is specific for the V3 sequence of gp120 from HIV-1
strain MN. No staining occurred with the mAb derived against the V3
peptide of gp120 of strain IIB.
[0098] Immunogenicitv of Ubicuitin and Ubicuitin Fusion
Proteins
[0099] Immune responses in mice were evaluated from antiserum
titers and from comparison at fixed dilutions of antisera taken at
different times after immunizations. Reactivity against ubiquitin,
UbV3 and UbgMT proteins, displaying either native ubiquitin
epitopes alone, the "V3" epitope at the internal site or the MT
sequence at the C-terminal site were assessed by ELISA with the
proteins adsorbed to the solid support.
[0100] In the BALB/c (H-2d) strain a strong immune response was
observed after an initial inoculation and one boost of either UbV3,
UbV3aMT, or UbV3gMT fusion proteins. In contrast ubiquitin, given
by an analogous protocol, was a poor immunogen (Table 1). Mice
receiving two or more injections of ubiquitin over 4 weeks
generally showed decreasing anti-ubiquitin reactive antibody. Mice
immunized with fusion proteins UbV3, UbV3aMT and UbV3gMT produced
antiserum specific for UbV3. The anti-UbV3 response continued to
increase after an additional boost. Average titers of the final
sera collected were in excess of 1:105. The antibody in these sera
was shown to be primarily IgG. The V3 insert was the dominant
B-cell target in all three immunogens. The sera bound only weakly
or not at all to native ubiquitin or the UbMT fusion. Animals
receiving. UbgMT or UbaMT developed measurable antibody against
UbgMT and ubiquitin. This response was directed partly to the
C-terminal peptide as suggested by the higher ELISA signals
obtained against the fusion protein compared with those against
ubiquitin (Table 1).
2TABLE 1 Summary of Immune Response Specificity to Antigens
Displaying Heterologous and Native Ubiquitin Epitopes Strain:
BALB/c Adjuvant: CFA, or PN222/IFA Routes: SQ, IP 9 Immunogena //
Antigenb6 Ub-V3 Ub-MT Ub Ub-V3-rgg-MT + + + +/- -- Ub-V3-rga-MTc +
+ + +/- -- Ub-V3-rgg + + -- -- Ub-rgg-MT +/- + + + + Ub-rga-MTc --
+ + +
[0101] (a) Fusion proteins were purified from E. coli lysates and
purified by ion exchange chromatography. Solutions in Tris buffer,
pH 7.4 were emulsified with Freund's complete adjuvant and injected
as described.
[0102] (b) Antigens used to coat microtiter plates for ELISA were
prepared from recombinant E. coli extracts and purified by ion
exchange. Three antigens used displayed a single (V3 or MT) or no
(Ub) heterologous epitope. Immunoreactivity is indicated by the
relative scale from no reaction (-) to strongest reaction++++).
Borderline reactivity (signal at the highest concentration of
antisera used) is scored as +/-.
[0103] (c) Proteins with C-terminal fusions were produced with the
native (rgg) and a mutated (rga) ubiquitin C-terminal sequence to
test for stability to or assisted processing of the T-cell epitope
by endogenous ubiquitin C-terminal hydrolases that may be present
in antigen processing cells.
[0104] Immune Responses to Cleavable and Noncleavable C-Terminal
Fusions
[0105] Double epitope fusions had either the native ubiquitin
C-terminus (UbV3gMT), retaining the processing site (RGG) for
cleavage by cellular ubiquitin-specific proteases (UBPs), or a
single residue mutation expressing the sequence RGA at the
ubiquitin C-terminus (UbV3aMT), that is resistant to processing.
Immunizations with the two types of double-epitope fusions were
compared to determine if processing by UBPs in antigen presenting
cells could influence a T-helper response. Since the antibody
response to the V3 site was independent of the MT epitope in the
BALB/c mouse, the effect of the processing mutation could not be
observed in this strain. The immunogenicity in C57BL/6 (H-2b) and
C3H (H-2k) mouse strains was determined after similar
treatment.
[0106] In both strains a specific anti-UbV3 or UbV3gMT. Responses
against UbV3aMT were comparable in the two mouse strains when
evaluated after two injections given two weeks apart.
[0107] Immunoassays against ubiquitin and UbgMT, determined at
1/4000 serum dilution, indicated significantly lower antigenicity
of these proteins. Signals were 16 and 35% of the values against
UbV3 in the H-2b and H-2k mice, respectively. A second boost of the
H-2b mice with double epitope fusion UbV3aMT produced improvements
in the anti-UbV3 response similar to those seen in the BALB/c mice.
The anti-UbV3 antiserum persisted at 3 weeks from the boost,
although the signal at {fraction (1/4000)} dilution was diminished
by about 50% from sera collected in the previous bleed.
[0108] Moreover, the anti-ubiquitin response was negligible in the
mice that received the additional boosts. Immunizations with UbaMT
produced antiserum of significant titer against all three antigens.
A weaker, but similarly non-specific reaction was observed in mice
inoculated with UbgMT. The anti-UbMT antisera reacted equivalently
with native bovine ubiquitin and with recombinant ubiquitin but not
with BSA. The anti-ubiquitin antibody persisted with additional
immunizations.
[0109] Epitope Specificity of Antisera
[0110] Differences in antigenicity of the three proteins could
suggest the epitope specificity of antisera for the V3 insert or
the MT tag or specificity for discontinuous determinants composed
of insert sequences as well as ubiquitin residues. Antiserum
specific for UbV3 was incubated with short peptides analogous to
the V3 sequence at varying concentrations, and residual unbound
antibody measured by indirect ELISA. Reduction in signal was
apparent in the 1-30 FM range of peptide concentration. By
contrast, no competition was seen using ubiquitin at 10-100 FM as a
competitor.
[0111] Anti-UbV3 sera reacted similarly with peptide L-V3 or a
disulfide-bridged cyclic peptide C-V3 as mimics of the epitope.
Although the peptide C-V3 could mimic the conformation of the V3
loop in the fusion protein this assay did not discriminate widely
between the two peptides in solution.
[0112] Similar conformations of the V3 insert in the UbV3 and the
V3 loop structure presented in gp120 could be suggested by better
cross-reactivity of the antiserum with gp120. Adsorption of
recombinant gp120 to ELISA plates appears to mask the V3 epitope
such that detection of antibodies is inefficient. Binding to other
epitopes on gp120 was detectable by direct or sandwich capture
ELISA, but this technique was less successful with anti-V3 loop
antibodies. Cross-reactivity of the anti-UbV3 antiserum for gp120
was demonstrated by Western blot analysis. Solution-phase
competition binding as described for the V3 peptides using
accessible concentrations of gp120 (# 0.8 FM) did not produce
measurable changes in the indirect ELISA.
[0113] T-cell Proliferative Responses to Peptides and Ubicuitin
Fusions
[0114] LN cells from BALB/c mice immunized with fusion proteins
UbV3 or UbV3MT showed a proliferative response when cultured in the
presence of UbV3 fusion. No obvious stimulation was provided by V3
or MT peptides at 100 Fg/ml, suggesting that the major T-helper
epitope is not found in these sequences. No proliferation was
observed in the presence of native bovine ubiquitin. In order to
control for possible mitogenic contaminants contributed from the E.
coli extracts, mice were immunized with recombinant ubiquitin or
with buffer. LN cells from these mice were incubated in the
presence of ubiquitin or UbV3. No proliferation was observed in any
case. Potential T-helper epitopes in UbV3 could include sequences
spanning the inserted residues and flanking ubiquitin sequences.
Peptides representing these regions should be prepared and tested
in the assay to address this point.
[0115] LN cells from C3H mice immunized with UbV3aMT were
marginally stimulated by UbV3. However, incubation in the presence
of increasing concentration of MT peptide, but not the V3 peptide,
produced a significant proliferation signal. No stimulation was
observed in the same experiment when C3H mice were immunized with
UbV3. These preliminary experiments did not allow quantitation of
the relative efficiency of T-cell stimulation by peptide and intact
fusion proteins used as immunogen. Positive stimulation values were
in the same range as those observed in the presence of concanavalin
A added at 2-20 Fg/ml.
[0116] No. 2
[0117] Results
[0118] Production of Ubicuitin Fusion Proteins
[0119] Ubiquitin has been used as a scaffold for displaying
multiple epitopes. These ubiquitin fusion proteins have been
successfully recognized by antibodies of the appropriate
specificity and analyzed using Origen technology. An immediate
technological application for these ubiquitin fusion proteins that
display a structurally defined antigenic epitope which is known to
be a target for neutralizing antibodies is in production of
diagnostic antibodies for clinical or research use. The advantages
conferred by the use of ubiquitin as a scaffold include: 1) its
ability to stabilize the epitopes in storage, and in in vitro
assays, and 2) its ability to constrain the peptide at one: or both
ends, thereby conferring the appropriate conformation for: antibody
recognition.
[0120] A commonly used sandwich immunoassay requires two distinct
monoclonal antibodies against a single macromolecular analyte, in
the present case the ubiquitin fusion proteins. These antibodies
are directed to nonoverlapping epitopes on the ubiquitin fusion
proteins, allowing the formation of a trimeric complex, or
sandwich. Typically, many monoclonal antibodies must be screened in
order to identify an appropriate pair for the immunoassay. The
technology described here permits the production of monoclonal or
polyclonal antibodies against structurally defined epitopes in a
macromolecule. Thus, a pair of reagent antibodies for a sandwich
immunoassay may be produced by design rather than by random
screening. Such reagents may be employed in a wide variety of
important immunoassays utilizing any number of formats that are
standard in the industry.
[0121] Construction of Ubiquitin Fusion Proteins
[0122] In Example 2, several ubiquitin fusions were constructed.
These ubiquitin fusions contain a peptide epitope loop derived from
the human PSA (prostate specific antigen). As shown in Table 3
below, ubiquitin fusion proteins contained either single or double
epitope insertions on the ubiquitin scaffold. Four different
versions of an antigenic PSA peptide loop from human prostate
specific antigen were inserted into the ubiquitin scaffold at amino
acid position 35. In Table 3 below they are labeled as Fus 5, Fus
5M, Fus 7 and Fus 7M. Four C-terminal fusions were also
constructed, both individually and in various combinations with the
fusions inserted into the ubiquitin scaffold at amino acid position
35. The peptides joined to the C-terminus of the ubiquitin fusions
are shown below in Table 3. They include ATNAT, FLAG, PSA conpep
and Fus 7 conpep. The "PSA conpep" fusions contain a modification
at amino acid 76 of the ubiquitin to prevent cleavage by a
ubiquitin specific protease. These fusions were produced for
testing by growth and isolation from bacterial cultures transformed
with DNA constructs that encode the ubiquitin fusion proteins. The
bacterial lysate from these transformed cultures is nearly
homogeneous with respect to protein content. Thus, dilution was
sufficient for the following experimentation.
3TABLE 2 Single and Double Insertions on the Ubipuitin Scaffold Fus
5 92 AA 10.44 k pI 8.20 KE-DVCAQVHPQKVTKFMLC-IPP (SEQ ID NO:18) Fus
5M 90 AA 10.24 k pI 8.63 KE-DVCAQVHPQKVTKFMLC-MPP (SEQ ID NO:19)
Fus 7 90 AA 10.22 k pI 8.81 KE-CAQVHPQKVTKFMLC-IPP (SEQ ID NO:20)
Fus 7M 87 AA 98.93 k pI 9.26 KE-CAQVHPQKVTKFM-PP (SEQ ID NO:21)
ATNAT 104 AA 11.63 k pI 9.65 RGG-SLRRSSCFGGRMDRIGAQSGLGCN- SFRY
(SEQ ID NO:22) FLAG 98 AA 11.22 k pI 6.12 RGG-DYKDD DDK (SEQ ID
NO:23) PSA conpep (W/O FUS 7) 96 AA 10.99 k pI 9.71
RGA-LYTKVVHYRKWIKDTIVANP (SEQ ID NO:24) Fus 7 conpep 110 AA 12.65 k
pI 9.67 RGA-LYTKVVHYRKWIKDTIVANP (SEQ ID NO:25)
[0123] Competition Analysis of Single Epitope Ubicuitin
[0124] The polyclonal antibody raised to a KLH conjugated peptide
bound to the PSA peptide in the ubiquitin fusion. This PSA
ubiquitin fusion was able to act like the native PSA by competing
with native PSA for binding to this polyclonal antibody in an elisa
assay.
[0125] In Vivo Cleavage of Double Epitope Ubicuitin Fusions
[0126] The structural authenticity of the ubiquitin scaffold in
maintaining the secondary structure of the PSA peptide inserted
internally at position 35 was probed by an in vivo assay. The assay
involved the cleavage of the C-terminal PSA peptide from the double
epitope ubiquitin fusion protein by a ubiquitin specific protease.
Bacteria were transformed with DNA expression constructs for a
double epitope ubiquitin fusion protein, UbFus7-conpep or
UbFus7-ATNAT shown above in Table 3 and a ubiquitin containing
plasmid. SDS-PAGE analysis of whole bacterial cell lysates showed
that the UBFus7-ATNAT ubiquitin double epitope fusion protein was
cleaved in vivo, liberating the C-terminal peptide from the main
body of the ubiquitin fusion protein. Following the successful
cleavage of the double epitope fusion UbFus7-ATNAT by in vivo
ubiquitin specific proteases, the portion of the ubiquitin fusion
protein which contained the internal insertion was analyzed. Based
on this cleavage activity, it was deduced that a ubiquitin fusion
protein with an internal insert would maintain its basic structure
despite the 15 amino acid insertion of the PSA peptide at position
35. On the other hand, UbFus7-conpep fusion protein, which was
modified at the C-terminus to prevent cleavage by a ubiquitin
specific protease remained intact. No ubiquitin specific protease
cleavage fragments were identified with UbFus7-conpep, as
expected.
[0127] Direct Binding of Double Epitope Ubicuitin Fusion
[0128] The proof of concept that a double epitope ubiquitin fusion
could be utilized in a sandwich assay was shown by two different
direct-binding immunoassays using methods known to those skilled in
the art. In one of these immunoassays, the quantity of the double
epitope ubiquitin fusion protein UbFus7-Flag used in the
immunoassay was kept constant, while the concentration of the
anti-PSA specific polyclonal serum was diluted out from
1.times.10-2 to 1.times.10-5. The intensity of signal for the
anti-PSA specific polyclonal serum for the ubiquitin fusion protein
as measured by ECL (IGEN, Inc.) decreased in a linear manner as the
quantity of antibody was diluted out. A similar result was found in
a second direct-binding immunoassay. In this assay, the double
epitope ubiquitin fusion protein was titered out from 10,000 ng/ml
UbFus7-Flag to 0.1 ng/ml UbFus7-Flag, while the quantity of
anti-PSA polyclonal serum was kept constant. As seen for the first
experimental assay, the intensity of signal for the anti-PSA
polyclonal serum as measured by ECL intensity decreased in a linear
manner as the quantity of UbFus7-Flag was reduced. Thus, the
anti-PSA polyclonal serum antibody showed a high degree of binding
specificity for the double epitope ubiquitin fusions. This dual
recognition supports the notion that the double epitope ubiquitin
fusions can serve as calibrators in a sandwich immunoassay.
[0129] No. 3
[0130] Results
[0131] Ubicuitin GnRH Immunogens
[0132] In order to generate an ubiquitin fusion protein which is
able to stimulate the production of self antibodies, a fusion
protein was constructed which contained a C-terminal extension to
ubiquitin with the following sequence of the GnRH dimer;
QHWSYGLRPGQHWSYGLRPG (SEQ ID NO:26) followed by a T cell epitope,
DDPKTGQFLQQINAYARPSEV (corona virus T cell epitope) (SEQ ID NO:27)
or DQVHFQPLPPAVVKLSDAL (MT epitope)(SEQ ID NO:17). This was
constructed using standard methods known to one of skill in the art
with sets of synthetic oligonucleotides. The ubiquitin used in
these constructs was also modified so that its last amino acid was
replaced by a valine to render the fusions noncleavable by
ubiquitin-specific proteases. These ubiquitin fusions were
expressed as described in Example 1 above and purified by ion
exchange chromatography and HPLC (when necessary) following
standard protocols. The ubiquitin fusion protein were purified to
greater than 90% purity.
[0133] The purified ubiquitin fusion proteins were then formulated
with adjuvants as described in Example 1 above and used to immunize
mice. The mice were re-immunized about 0.25-30 days following the
initial immunization. Sera prepared following bleeds from the mice
were tested to determine the level of epitope specific antibodies
which were induced by the specific ubiquitin fusion proteins. The
results demonstrated that the immunizations resulted in the
induction of high levels of anti-GnRH antibodies.
[0134] Other immunogens which were constructed include ubiquitin
with an internal GnRH epitope as a single and as a double epitope
at position 35 of ubiquitin and T cell epitopes attached at the
C-terminus as described above. To further increase the epitope
density, the ubiquitin fusion protein with the internal GnRH dimer
at position 35 is also fused at its C-terminus with a dimer of GnRH
followed by a T cell epitope or with MT at the C-terminus followed
by GnRH.
[0135] In further variations of the ubiquitin fusion protein design
which have been described above, the T cell epitope was attached at
the C-terminus of ubiquitin which is then fused to the dimer or
monomer sequence of GnRH.
[0136] The GnRH monomer can consist of EHWSYGLRPG (SEQ ID NO:28)
with a corresponding dimer of EHWSYGLRPGEHWSYGLRPG (SEQ ID NO:29)
or a mixed dimer of EHWSYGLRPGQHWSYGLRPG (SEQ ID NO:30) or
QHWSYGLRPGEHWSYGLRPG(SEQ ID NO:31). Alternatively, different GnRH
monomers could be used provided such monomers are able to induce
antibodies to GNRH.
[0137] No. 4
[0138] N-terminal Fusions of GnRH to Ubicuitin for
Immunocastration
[0139] Novel constructs are prepared by placing an epitope at the
N-terminus of a first ubiquitin protein to create a fusion protein
which can elicit a desired immune response. These constructs differ
from those in the prior art by allowing placement of any epitope at
the N-terminus of the first ubiquitin protein in order to produce
an effective vaccine conjugate.
[0140] One use for this type of novel N-terminal epitope
presentation is in the generation of an anti-self antibody
response. Expression vectors capable of this include those
generated for immunocastration. These vectors are based on the
vaccine constructs described above in Example 3. However, in the
present example, the vaccine constructs include a N terminal
ubiquitin protein fused to the N-terminus of the epitope attached
to the N-terminus of the C terminal ubiquitin protein. Linkage of
the N terminal ubiquitin protein to the N-terminal epitope is
through a ubiquitin specific cleavable C-terminus. For example, in
the case of GnRH, the sequence coding for (QHWSYGLRPG).sub.n (SEQ
ID NO:32), where n is from 1-8, is fused to the 3' end of the
second ubiquitin protein using synthetic oligonucleotides and
methods known to one of skill in the art. The resultant gene
sequence contains a fusion protein comprised of an epitope flanked
on its C-terminus by a C terminal ubiquitin protein and on its
N-terminus by a N terminal ubiquitin protein. The ubiquitin
proteins joined to GnRH can be used to generate a number of
possible combinations of fusion proteins containing multiple GRIRH
sequences and T cell epitopes.
[0141] The fusion between the N terminal ubiquitin protein and an
N-terminal epitope can occur via an RGG native ubiquitin C-terminus
and a Q at the N-terminus of the GnRH sequence. In this example,
the GnRH epitope sequence is comprised of from 1 to 8 copies of the
following sequence QHWSYGLRPG (SEQ ID NO:32). The fusion protein
comprising the GnRH epitope flanked on both its N- and C-terminal
ends may be fused to at least one T cell epitope such as
DQVHFQPLPPAVVKLSDAL (SEQ ID NO:33) at its C-terminus via a
non-native ubiquitin C-terminal sequence such as RGV to render it
non-cleavable by the ubiquitin specific proteases. Variations on
the basic construct described above are made using different C
terminal ubiquitin fusion proteins. Examples of these can be found
in Example 3 above. For instance, the C terminal ubiquitin protein
can be further modified to include GnRH epitopes (from 1 to 8
epitopes) inserted at position 35. In addition, the T cell
epitope(s) fused to the C-terminus of the C terminal ubiquitin
protein can be varied.
[0142] To prepare the N-terminal epitope ubiquitin fusion proteins,
these gene constructs are placed within the expression vector
described in Example 1 and used to transform E. coli for protein
expression. The expressed protein is isolated from the E. coli
cells by sonication followed by ion exchange purification to give a
preparation which can then be subjected to the action of a
ubiquitin specific protease (UBP). Digestion of the fusion protein
with the UBP results in the release of the N-terminal ubiquitin
protein from the N-terminus of the N-terminally fused epitope. This
cleavage reaction is then subjected to a further ion exchange
purification to yield a fusion protein with a GnRH epitope(s) fused
to the N-terminus of the COOH terminal ubiquitin protein. The
purified ubiquitin fusion protein, with its N-terminal and or
C-terminal epitopes, can now be formulated to generate the vaccine
for study as described in Example 6.
[0143] No. 5
[0144] Conjugation of Ubiquitin GnRH Fusion Proteins to carrier
Proteins
[0145] Ubiquitin fusion proteins containing peptide epitopes can be
efficiently coupled directly to another protein. In the present
example, two ubiquitin-GnRH fusion proteins are created which are
site specifically coupled to ovalbumin. These ubiquitin-GnRH fusion
proteins are-constructed using synthetic oligonucleotides, which
encode the GnRH sequence; QHWSYGLRPGQHWSYGLRPGQHWSYGLRPGQHWSYGLRPGC
(SEQ ID NO:34) for one construct and
QHWSYGLRPGQHWSYGLRPGQHWSYGLRPGQHWSYGLRPG (SEQ ID NO:35) for the
second construct.
[0146] These oligonucleotides are cloned into the UBP-cleavable
C-terminal site in the coding sequence of ubiquitin as described
above in Example 1. The resulting fusion constructs consist of the
coding sequence for ubiquitin fused to four copies of the GnRH
epitope, with both containing either a C-terminal Cys or not. To
regulate expression, the coding sequence was placed under the
control of a lac promoter which when induced elicits high levels of
expressed fusion protein. The resulting construct is used to
transform E. coli as described above in Example 1 and the cells
were cultured followed by induction of expression of the fusion
protein. The fusion protein was isolated from the E. coli cell
pellet by first subjecting the cells to sonication, followed by
purification of the fusion protein by ion exchange
chromatography.
[0147] Conjugation of Ubicuitin Fusions with the C terminal Cys
[0148] Ovalbumin is activated by reaction with
N-succinimidyl-3-(2-pyridyl- dithio)-propionate (SPDP) or by
succinimidyl 4-(N-maleimido-methyl) cyclohexane-1-carboxylate
(SMCC) followed by gel filtration to remove unreacted cross linking
agents. Ubiquitin fusion protein is coupled to ovalbumin by
reacting it with activated ovalbumin. The resultant reaction
between a free SH group present on the ubiquitin fusion protein and
the activated ovalbumin results in a covalent linkage through
either a thiol ether linkage with the SMCC activated ovalbumin or a
disulfide bond from the reaction with the SPDP activated ovalbumin.
The resultant conjugate is formulated with an adjuvant such as
Quil-A, complete Freunds adjuvant (CFA) or incomplete Freunds
adjuvant (IFA) and then used for immunization as described in
Example 6 below.
[0149] Conjugation of Ubicuitin Fusions Without the C Terminal
Cys
[0150] The ubiquitin fusion protein is coupled to ovalbumin by
reacting it with ovalbumin in the presence of a cross linking agent
such as disuccinimidyl suberate or gluteraldehyde (Pierce). The
resultant reaction the ubiquitin fusion protein and ovalbumin
results in a covalent linkage through amino groups on the ubiquitin
fusion protein and ovalbumin. The resultant conjugate is formulated
with an adjuvant such as Quil-A, complete Freunds adjuvant (CFA) or
incomplete Freunds adjuvant (IFA) and then used for immunization as
described in Example 6 below.
[0151] No. 6
[0152] Immunocastration of Pigs with Ubicuitin GnRH Immunogens
[0153] The ubiquitin fusion protein immunogens constructed as
described above in Examples 3, 4 and 5 were tested in piglets. Male
piglets which were between the age of 9-10 weeks were immunized
with 1-10 mg of the ubiquitin GnRH immunogens in complete Freund's
adjuvant (CFA) intramuscularly. Immunizations were repeated 8 weeks
following the initial CFA immunization, with IFA. The piglets were
slaughtered 16 weeks after the initial immunization at which time
the testicles were excised and weighed. In addition, the serum
testosterone levels of the piglets was determined along with the
androstenone levels in fat. All the animals immunized with the
ubiquitin GnRH immunogens showed significant reduction in
testicular weight, along with significantly reduced levels of
testosterone in the serum. The levels of androstenone in fat were
below 0.1 Fg/ml. These experiments have demonstrated the potential
of the ubiquitin fusion proteins to act as an immunogen for the
generation of self immune responses known more specifically as
immunocastration.
[0154] No. 7
[0155] Growth Hormone Vaccine to Enhance the Growth Rate
[0156] In order to improve the growth rate of pigs, a vaccine was
constructed which included the insertion of a growth hormone
epitpope into ubiquitin. Prior studies have shown that the epitope
encoded by amino acids 54-95 of growth hormone can be used to make
a vaccine which improves the growth rate of pigs by increasing the
activity of the endogenous growth hormone. By using ubiquitin
fusion proteins containing this growth hormone epitope, novel
vaccines can be generated which offer the advantages of enhanced
hormone activity and lower costs.
[0157] In the present example, the growth hormone epitope was
inserted into ubiquitin as described in Examples 3, 4 and 5 above,
with the growth hormone epitope inserted at the same sites
described above for the GnRH epitopes. The growth hormone epitope
can be inserted as a multimer, with up to four contiguous repeats
to enhance its immunogenicity. Constructs encoding the growth
hormone-ubiquitin fusion proteins were transformed into and
expressed in E. coli, followed by purification of the fusion
protein by methods described above.
[0158] The purified growth hormone-ubiquitin fusion proteins were
formulated with adjuvant and used to immunize pigs weighing 15-20
kg. CFA was used for the first immunization followed by two
subsequent booster injections with IPA. These subsequent booster
injections were each given at 4 week intervals following the
initial injection. Pigs were monitored until they reached a weight
of 110-120 Kg at which time the animals were killed. The resultant
weight gain by immunized pigs when compared to control animals
receiving only adjuvant or ubiquitin only and adjuvant demonstrated
the improved growth rates of the immunized pigs.
Sequence CWU 1
1
35 1 35 PRT Artificial Sequence Description of Artificial Sequence
cloning oligo 1 Cys Thr Arg Pro Asn Asn Asn Thr Arg Lys Ser Ile His
Ile Gly Pro 1 5 10 15 Gly Arg Ala Phe Tyr Thr Thr Gly Glu Ile Ile
Gly Asp Ile Arg Gln 20 25 30 Ala His Cys 35 2 15 PRT Artificial
Sequence Description of Artificial Sequence cloning oligo 2 Lys Arg
Ile His Ile Gly Pro Gly Arg Ala Phe Tyr Thr Thr Lys 1 5 10 15 3 17
PRT Artificial Sequence Description of Artificial Sequence cloning
oligo 3 Cys Lys Ser Ile His Ile Gly Pro Gly Arg Ala Phe Tyr Thr Thr
Gly 1 5 10 15 Cys 4 50 DNA Artificial Sequence Description of
Artificial Sequence cloning oligo 4 ttaagactgc gtggcggcga
ccaggttcac ttccagccgc tgccgccggc 50 5 37 DNA Artificial Sequence
Description of Artificial Sequence cloning oligo 5 tgttgttaaa
ctgtctgacg ctctgtaagc ttctgca 37 6 43 DNA Artificial Sequence
Description of Artificial Sequence cloning oligo 6 gaagcttaca
gagcgtcaga cagtttaaca acagccggcg gca 43 7 36 DNA Artificial
Sequence Description of Artificial Sequence cloning oligo 7
gcggctggaa gtgaacctgg tcgccgccac gcagtc 36 8 50 DNA Artificial
Sequence Description of Artificial Sequence cloning oligo 8
ttaagactgc gtggcgctga ccaggttcac ttccagccgc tgccgccggc 50 9 36 DNA
Artificial Sequence Description of Artificial Sequence cloning
oligo 9 gcggctggaa gtgaacctgg tcagcgccac gcagtc 36 10 55 DNA
Artificial Sequence Description of Artificial Sequence cloning
oligo 10 aagaaatcca catcggtccg ggtcgtgctt tctacaccac catcccgccg
gatca 55 11 54 DNA Artificial Sequence Description of Artificial
Sequence cloning oligo 11 atccggcggg atggtggtgt agaaagcacg
acccggaccg atgtggattt cttt 54 12 33 DNA Artificial Sequence
Description of Artificial Sequence cloning oligo 12 ttaagactgc
gtggcggcat ccacatcggt ccg 33 13 29 DNA Artificial Sequence
Description of Artificial Sequence cloning oligo 13 ggtcgtgctt
tctacaccac ctaactgca 29 14 34 DNA Artificial Sequence Description
of Artificial Sequence cloning oligo 14 gttaggtggt gtagaaagca
cgacccggac cgat 34 15 20 DNA Artificial Sequence Description of
Artificial Sequence cloning oligo 15 gtggatgccg ccacgcagtc 20 16 12
PRT HIV-1 16 Ile His Ile Gly Pro Gly Arg Ala Phe Tyr Thr Thr 1 5 10
17 19 PRT Mycobacterium tuberculosis 17 Asp Gln Val His Phe Gln Pro
Leu Pro Pro Ala Val Val Lys Leu Ser 1 5 10 15 Asp Ala Leu 18 22 PRT
Homo sapiens 18 Lys Glu Asp Val Cys Ala Gln Val His Pro Gln Lys Val
Thr Lys Phe 1 5 10 15 Met Leu Cys Ile Pro Pro 20 19 22 PRT Homo
sapiens 19 Lys Glu Asp Val Cys Ala Gln Val His Pro Gln Lys Val Thr
Lys Phe 1 5 10 15 Met Leu Cys Met Pro Pro 20 20 20 PRT Homo sapiens
20 Lys Glu Cys Ala Gln Val His Pro Gln Lys Val Thr Lys Phe Met Leu
1 5 10 15 Cys Ile Pro Pro 20 21 17 PRT Homo sapiens 21 Lys Glu Cys
Ala Gln Val His Pro Gln Lys Val Thr Lys Phe Met Pro 1 5 10 15 Pro
22 31 PRT Homo sapiens 22 Arg Gly Gly Ser Leu Arg Arg Ser Ser Cys
Phe Gly Gly Arg Met Asp 1 5 10 15 Arg Ile Gly Ala Gln Ser Gly Leu
Gly Cys Asn Ser Phe Arg Tyr 20 25 30 23 11 PRT Homo sapiens 23 Arg
Gly Gly Asp Tyr Lys Asp Asp Asp Asp Lys 1 5 10 24 23 PRT Homo
sapiens 24 Arg Gly Ala Leu Tyr Thr Lys Val Val His Tyr Arg Lys Trp
Ile Lys 1 5 10 15 Asp Thr Ile Val Ala Asn Pro 20 25 25 000 26 20
PRT Porcine 26 Gln His Trp Ser Tyr Gly Leu Arg Pro Gly Gln His Trp
Ser Tyr Gly 1 5 10 15 Leu Arg Pro Gly 20 27 21 PRT corona virus 27
Asp Asp Pro Lys Thr Gly Gln Phe Leu Gln Gln Ile Asn Ala Tyr Ala 1 5
10 15 Arg Pro Ser Glu Val 20 28 10 PRT Porcine 28 Glu His Trp Ser
Tyr Gly Leu Arg Pro Gly 1 5 10 29 20 PRT Porcine 29 Glu His Trp Ser
Tyr Gly Leu Arg Pro Gly Glu His Trp Ser Tyr Gly 1 5 10 15 Leu Arg
Pro Gly 20 30 20 PRT Porcine 30 Glu His Trp Ser Tyr Gly Leu Arg Pro
Gly Gln His Trp Ser Tyr Gly 1 5 10 15 Leu Arg Pro Gly 20 31 20 PRT
Porcine 31 Gln His Trp Ser Tyr Gly Leu Arg Pro Gly Glu His Trp Ser
Tyr Gly 1 5 10 15 Leu Arg Pro Gly 20 32 10 PRT Porcine 32 Gln His
Trp Ser Tyr Gly Leu Arg Pro Gly 1 5 10 33 33 000 34 41 PRT Porcine
34 Gln His Trp Ser Tyr Gly Leu Arg Pro Gly Gln His Trp Ser Tyr Gly
1 5 10 15 Leu Arg Pro Gly Gln His Trp Ser Tyr Gly Leu Arg Pro Gly
Gln His 20 25 30 Trp Ser Tyr Gly Leu Arg Pro Gly Cys 35 40 35 40
PRT Porcine 35 Gln His Trp Ser Tyr Gly Leu Arg Pro Gly Gln His Trp
Ser Tyr Gly 1 5 10 15 Leu Arg Pro Gly Gln His Trp Ser Tyr Gly Leu
Arg Pro Gly Gln His 20 25 30 Trp Ser Tyr Gly Leu Arg Pro Gly 35
40
* * * * *