U.S. patent application number 10/160503 was filed with the patent office on 2004-02-19 for secreted and transmembrane polypeptides and nucleic acids encoding the same.
This patent application is currently assigned to Genentech, Inc.. Invention is credited to Baker, Kevin P., Beresini, Maureen, DeForge, Laura, Desnoyers, Luc, Filvaroff, Ellen, Gao, Wei-Qiang, Gerritsen, Mary E., Goddard, Audrey, Godowski, Paul J., Gurney, Austin L., Sherwood, Steven, Smith, Victoria, Stewart, Timothy A., Tumas, Daniel, Watanabe, Colin K., Wood, William I., Zhang, Zemin.
Application Number | 20040033559 10/160503 |
Document ID | / |
Family ID | 21841414 |
Filed Date | 2004-02-19 |
United States Patent
Application |
20040033559 |
Kind Code |
A1 |
Baker, Kevin P. ; et
al. |
February 19, 2004 |
Secreted and transmembrane polypeptides and nucleic acids encoding
the same
Abstract
The present invention is directed to novel polypeptides and to
nucleic acid molecules encoding those polypeptides. Also provided
herein are vectors and host cells comprising those nucleic acid
sequences, chimeric polypeptide molecules comprising the
polypeptides of the present invention fused to heterologous
polypeptide sequences, antibodies which bind to the polypeptides of
the present invention and to methods for producing the polypeptides
of the present invention.
Inventors: |
Baker, Kevin P.;
(Darnestown, MD) ; Beresini, Maureen; (Moss Beach,
CA) ; DeForge, Laura; (Pacifica, CA) ;
Desnoyers, Luc; (San Francisco, CA) ; Filvaroff,
Ellen; (San Francisco, CA) ; Gao, Wei-Qiang;
(Palo Alto, CA) ; Gerritsen, Mary E.; (San Mateo,
CA) ; Goddard, Audrey; (San Francisco, CA) ;
Godowski, Paul J.; (Hillsborough, CA) ; Gurney,
Austin L.; (Belmont, CA) ; Sherwood, Steven;
(Los Altos, CA) ; Smith, Victoria; (Burlingame,
CA) ; Stewart, Timothy A.; (San Francisco, CA)
; Tumas, Daniel; (Orinda, CA) ; Watanabe, Colin
K.; (Moraga, CA) ; Wood, William I.;
(Hillsborough, CA) ; Zhang, Zemin; (Foster City,
CA) |
Correspondence
Address: |
Ginger R Dreger
Heller Ehrman White & McAuliffe LLP
275 Middlefield Road
Menlo Park
CA
94025
US
|
Assignee: |
Genentech, Inc.
|
Family ID: |
21841414 |
Appl. No.: |
10/160503 |
Filed: |
May 30, 2002 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
10160503 |
May 30, 2002 |
|
|
|
10028072 |
Dec 19, 2001 |
|
|
|
10028072 |
Dec 19, 2001 |
|
|
|
PCT/US00/32678 |
Dec 1, 2000 |
|
|
|
60209832 |
Jun 5, 2000 |
|
|
|
Current U.S.
Class: |
435/69.1 ;
435/183; 435/320.1; 435/325; 530/350; 530/388.1; 536/23.2 |
Current CPC
Class: |
C07K 14/70578 20130101;
C12Q 2600/158 20130101; C12Q 1/6886 20130101; G01N 33/68 20130101;
C12P 21/06 20130101; G01N 33/5008 20130101; C07K 2319/30 20130101;
C12N 9/1051 20130101; G01N 33/574 20130101; A61K 39/001102
20180801; C07K 1/00 20130101; G01N 33/5044 20130101; G01N 33/53
20130101; C07K 17/00 20130101; G01N 33/6845 20130101; Y10S 530/866
20130101; C07K 14/47 20130101; C07K 14/00 20130101; C07K 14/4748
20130101; G01N 33/5061 20130101; G01N 33/502 20130101; A61K 39/00
20130101; C12N 5/06 20130101; C07K 14/4703 20130101; C07K 16/18
20130101; C12N 15/00 20130101; Y10S 530/828 20130101; C12Q 1/68
20130101; C12Q 2600/136 20130101; G01N 33/5011 20130101; G01N
33/5014 20130101; C12N 9/00 20130101; G01N 2800/042 20130101; C12P
21/02 20130101; C07K 14/82 20130101; C07K 2317/24 20130101; G01N
33/505 20130101; C12N 2799/026 20130101; A61K 38/00 20130101; C07K
14/705 20130101; C12N 9/001 20130101; G01N 33/57484 20130101; C07K
2319/00 20130101 |
Class at
Publication: |
435/69.1 ;
435/183; 435/320.1; 435/325; 530/350; 530/388.1; 536/23.2 |
International
Class: |
C12P 021/02; C12N
005/06; C07K 014/47; C07H 021/04; C12N 009/00 |
Claims
What is claimed is:
1. Isolated nucleic acid having at least 80% nucleic acid sequence
identity to a nucleotide sequence that encodes an amino acid
sequence selected from the group consisting of the amino acid
sequence shown in FIG. 2 (SEQ ID NO:2), FIG. 4 (SEQ ID NO:4), FIG.
6 (SEQ ID NO:6), FIG. 8 (SEQ ID NO:8), FIG. 10 (SEQ ID NO: 10),
FIG. 12 (SEQ ID NO: 12), FIG. 14 (SEQ ID NO: 14), FIG. 16 (SEQ ID
NO: 16), FIG. 18 (SEQ ID NO: 18), FIG. 20 (SEQ ID NO:20), FIG. 22
(SEQ ID NO:22), FIG. 24 (SEQ ID NO:24), FIG. 26 (SEQ ID NO:26),
FIG. 28 (SEQ ID NO:28), FIG. 30 (SEQ ID NO:30), FIG. 32 (SEQ ID
NO:32), FIG. 34 (SEQ ID NO:34), FIG. 36 (SEQ ID NO:36), FIG. 38
(SEQ ID NO:38), FIG. 40 (SEQ ID NO:40), FIG. 42 (SEQ ID NO:42),
FIG. 44 (SEQ ID NO:44), FIG. 46 (SEQ ID NO:46), FIG. 48 (SEQ ID
NO:48), FIG. 50 (SEQ ID NO:50), FIG. 52 (SEQ ID NO:52), FIG. 54
(SEQ ID NO:54), FIG. 56 (SEQ ID NO:56), FIG. 58 (SEQ ID NO:58),
FIG. 60 (SEQ ID NO:60), FIG. 62 (SEQ ID NO:62), FIG. 64 (SEQ ID
NO:64), FIG. 66 (SEQ ID NO:66), FIG. 68 (SEQ ID NO:68), FIG. 70
(SEQ ID NO:70), FIG. 72 (SEQ ID NO:72), FIG. 74 (SEQ ID NO:74),
FIG. 76 (SEQ ID NO:76), FIG. 78 (SEQ ID NO:78), FIG. 80 (SEQ ID
NO:80), FIG. 82 (SEQ ID NO:82), FIG. 84 (SEQ ID NO:84), FIG. 86
(SEQ ID NO:86), FIG. 88 (SEQ ID NO:88), FIG. 90 (SEQ ID NO:90),
FIG. 92 (SEQ ID NO:92), FIG. 94 (SEQ ID NO:94), FIG. 96 (SEQ ID
NO:96), FIG. 98 (SEQ ID NO:98), FIG. 100 (SEQ ID NO:100), FIG. 102
(SEQ ID NO: 102), FIG. 104 (SEQ ID NO: 104), FIG. 106 (SEQ ID NO:
106), FIG. 108 (SEQ ID NO: 108), FIG. 110 (SEQ ID NO: 110), FIG.
112 (SEQ ID NO:112), FIG. 114 (SEQ ID NO:114), FIG. 116 (SEQ ID
NO:116), FIG. 118 (SEQ ID NO:118), FIG. 120 (SEQ ID NO:120), FIG.
122 (SEQ ID NO:122), FIG. 124 (SEQ ID NO:124), FIG. 126 (SEQ ID
NO:126), FIG. 128 (SEQ ID NO:128), FIG. 130 (SEQ ID NO:130), FIG.
132 (SEQ ID NO:132), FIG. 134 (SEQ ID NO:134), FIG. 136 (SEQ ID
NO:136), FIG. 138 (SEQ ID NO:138), FIG. 140 (SEQ ID NO: 140), FIG.
142 (SEQ ID NO: 142), FIG. 144 (SEQ ID NO: 144), FIG. 146 (SEQ ID
NO:146), FIG. 148 (SEQ ID NO: 148), FIG. 150 (SEQ ID NO:150), FIG.
152 (SEQ ID NO:152), FIG. 154 (SEQ ID NO:154), FIG. 156 (SEQ ID
NO:156), FIG. 158 (SEQ ID NO:158), FIG. 160 (SEQ ID NO:160), FIG.
162 (SEQ ID NO:162), FIG. 164 (SEQ ID NO: 164), FIG. 166 (SEQ ID
NO:166), FIG. 168 (SEQ ID NO:168), FIG. 170 (SEQ ID NO:170), FIG.
172 (SEQ ID NO:172), FIG. 174 (SEQ ID NO:174), FIG. 176 (SEQ ID
NO:176), FIG. 178 (SEQ ID NO:178), FIG. 180 (SEQ ID NO:180), FIG.
182 (SEQ ID NO:182), FIG. 184 (SEQ ID NO:184), FIG. 186 (SEQ ID
NO:186), FIG. 188 (SEQ ID NO:188), FIG. 190 (SEQ ID NO:190), FIG.
192 (SEQ ID NO: 192), FIG. 194 (SEQ ID NO: 194), FIG. 196 (SEQ ID
NO:196), FIG. 198 (SEQ ID NO:198), FIG. 200 (SEQ ID NO:200), FIG.
202 (SEQ ID NO:202), FIG. 204 (SEQ ID NO:204), FIG. 206 (SEQ ID
NO:206), FIG. 208 (SEQ ID NO:208), FIG. 210 (SEQ ID NO:210), FIG.
212 (SEQ ID NO:212), FIG. 214 (SEQ ID NO:214), FIG. 216 (SEQ ID
NO:216), FIG. 218 (SEQ ID NO:218), FIG. 220 (SEQ ID NO:220), FIG.
222 (SEQ ID NO:222), FIG. 224 (SEQ ID NO:224), FIG. 226 (SEQ ID
NO:226), FIG. 228 (SEQ ID NO:228), FIG. 230 (SEQ ID NO:230), FIG.
232 (SEQ ID NO:232), FIG. 234 (SEQ ID NO:234), FIG. 236 (SEQ ID
NO:236), FIG. 238 (SEQ ID NO:238), FIG. 240 (SEQ ID NO:240), FIG.
242 (SEQ ID NO:242), FIG. 244 (SEQ ID NO:244), FIG. 246 (SEQ ID
NO:246), FIG. 248 (SEQ ID NO:248), FIG. 250 (SEQ ID NO:250), FIG.
252 (SEQ ID NO:252), FIG. 254 (SEQ ID NO:254), FIG. 256 (SEQ ID
NO:256), FIG. 258 (SEQ ID NO:258), FIG. 260 (SEQ ID NO:260), FIG.
262 (SEQ ID NO:262), FIG. 264 (SEQ ID NO:264), FIG. 266 (SEQ ID
NO:266), FIG. 268 (SEQ ID NO:268), FIG. 270 (SEQ ID NO:270), FIG.
272 (SEQ ID NO:272), FIG. 274 (SEQ ID NO:274), FIG. 276 (SEQ ID
NO:276), FIG. 278 (SEQ ID NO:278), FIG. 280 (SEQ ID NO:280), FIG.
282 (SEQ ID NO:282), FIG. 284 (SEQ ID NO:284), FIG. 286 (SEQ ID
NO:286), FIG. 288 (SEQ ID NO:288), FIG. 290 (SEQ ID NO:290), FIG.
292 (SEQ ID NO:292), FIG. 294 (SEQ ID NO:294), FIG. 296 (SEQ ID
NO:296), FIG. 298 (SEQ ID NO:298), FIG. 300 (SEQ ID NO:300), FIG.
302 (SEQ ID NO:302), FIG. 304 (SEQ ID NO:304), FIG. 306 (SEQ ID
NO:306), FIG. 308 (SEQ ID NO:308), FIG. 310 (SEQ ID NO:310), FIG.
312 (SEQ ID NO:312), FIG. 314 (SEQ ID NO:314), FIG. 316 (SEQ ID
NO:316), FIG. 318 (SEQ ID NO:318), FIG. 320 (SEQ ID NO:320), FIG.
322 (SEQ ID NO:322), FIG. 324 (SEQ ID NO:324), FIG. 326 (SEQ ID
NO:326), FIG. 328 (SEQ ID NO:328), FIG. 330 (SEQ ID NO:330), FIG.
332 (SEQ ID NO:332), FIG. 334 (SEQ ID NO:334), FIG. 336 (SEQ ID
NO:336), FIG. 338 (SEQ ID NO:338), FIG. 340 (SEQ ID NO:340), FIG.
342 (SEQ ID NO:342), FIG. 344 (SEQ ID NO:344), FIG. 346 (SEQ ID
NO:346), FIG. 348 (SEQ ID NO:348), FIG. 350 (SEQ ID NO:350), FIG.
352 (SEQ ID NO:352), FIG. 354 (SEQ ID NO:354), FIG. 356 (SEQ ID
NO:356), FIG. 358 (SEQ ID NO:358), FIG. 360 (SEQ ID NO:360), FIG.
362 (SEQ ID NO:362), FIG. 364 (SEQ ID NO:364), FIG. 366 (SEQ ID
NO:366), FIG. 368 (SEQ ID NO:368), FIG. 370 (SEQ ID NO:370), FIG.
372 (SEQ ID NO:372), FIG. 374 (SEQ ID NO:374), FIG. 376 (SEQ ID
NO:376), FIG. 378 (SEQ ID NO:378), FIG. 380 (SEQ ID NO:380), FIG.
382 (SEQ ID NO:382), FIG. 384 (SEQ ID NO:384), FIG. 386 (SEQ ID
NO:386), FIG. 388 (SEQ ID NO:388), FIG. 390 (SEQ ID NO:390), FIG.
392 (SEQ ID NO:392), FIG. 394 (SEQ ID NO:394), FIG. 396 (SEQ ID
NO:396), FIG. 398 (SEQ ID NO:398), FIG. 400 (SEQ ID NO:400), FIG.
402 (SEQ ID NO:402), FIG. 404 (SEQ ID NO:404), FIG. 406 (SEQ ID
NO:406), FIG. 408 (SEQ ID NO:408), FIG. 410 (SEQ ID NO:410), FIG.
412 (SEQ ID NO:412), FIG. 414 (SEQ ID NO:414), FIG. 416 (SEQ ID
NO:416), FIG. 418 (SEQ ID NO:418), FIG. 420 (SEQ ID NO:420), FIG.
422 (SEQ ID NO:422), FIG. 424 (SEQ ID NO:424), FIG. 426 (SEQ ID
NO:426), FIG. 428 (SEQ ID NO:428), FIG. 430 (SEQ ID NO:430), FIG.
432 (SEQ ID NO:432), FIG. 434 (SEQ ID NO:434), FIG. 436 (SEQ ID
NO:436), FIG. 438 (SEQ ID NO:438), FIG. 440 (SEQ ID NO:440), FIG.
442 (SEQ ID NO:442), FIG. 444 (SEQ ID NO:444), FIG. 446 (SEQ ID
NO:446), FIG. 448 (SEQ ID NO:448), FIG. 450 (SEQ ID NO:450), FIG.
452 (SEQ ID NO:452), FIG. 454 (SEQ ID NO:454), FIG. 456 (SEQ ID
NO:456), FIG. 458 (SEQ ID NO:458), FIG. 460 (SEQ ID NO:460), FIG.
462 (SEQ ID NO:462), FIG. 464 (SEQ ID NO:464), FIG. 466 (SEQ ID
NO:466), FIG. 468 (SEQ ID NO:468), FIG. 470 (SEQ ID NO:470), FIG.
472 (SEQ ID NO:472), FIG. 474 (SEQ ID NO:474), FIG. 476 (SEQ ID
NO:476), FIG. 478 (SEQ ID NO:478), FIG. 480 (SEQ ID NO:480), FIG.
482 (SEQ ID NO:482), FIG. 484 (SEQ ID NO:484), FIG. 486 (SEQ ID
NO:486), FIG. 488 (SEQ ID NO:488), FIG. 490 (SEQ ID NO:490), FIG.
492 (SEQ ID NO:492), FIG. 494 (SEQ ID NO:494), FIG. 496 (SEQ ID
NO:496), FIG. 498 (SEQ ID NO:498), FIG. 500 (SEQ ID NO:500), FIG.
502 (SEQ ID NO:502), FIG. 504 (SEQ ID NO:504), FIG. 506 (SEQ ID
NO:506), FIG. 508 (SEQ ID NO:508), FIG. 510 (SEQ ID NO:510), FIG.
512 (SEQ ID NO:512), FIG. 514 (SEQ ID NO:514), FIG. 516 (SEQ ID
NO:516), FIG. 518 (SEQ ID NO:518), FIG. 520 (SEQ ID NO:520), FIG.
522 (SEQ ID NO:522), FIG. 524 (SEQ ID NO:524), FIG. 526 (SEQ ID
NO:526), FIG. 528 (SEQ ID NO:528), FIG. 530 (SEQ ID NO:530), FIG.
532 (SEQ ID NO:532), FIG. 534 (SEQ ID NO:534), FIG. 536 (SEQ ID
NO:536), FIG. 538 (SEQ ID NO:538), FIG. 540 (SEQ ID NO:540), FIG.
542 (SEQ ID NO:542), FIG. 544 (SEQ ID NO:544), FIG. 546 (SEQ ID
NO:546), FIG. 548 (SEQ ID NO:548) and FIG. 550 (SEQ ID NO:550).
2. Isolated nucleic acid having at least 80% nucleic acid sequence
identity to a nucleotide sequence selected from the group
consisting of the nucleotide sequence shown in FIG. 1 (SEQ ID
NO:1), FIG. 3 (SEQ ID NO:3), FIG. 5 (SEQ ID NO:5), FIG. 7 (SEQ ID
NO:7), FIG. 9 (SEQ ID NO:9), FIG. 11 (SEQ ID NO:11), FIG. 13 (SEQ
ID NO:13), FIG. 15 (SEQ ID NO: 15), FIG. 17 (SEQ ID NO: 17), FIG.
19 (SEQ ID NO: 19), FIG. 21 (SEQ ID NO:21), FIG. 23 (SEQ ID NO:23),
FIG. 25 (SEQ ID NO:25), FIG. 27 (SEQ ID NO:27), FIG. 29 (SEQ ID
NO:29), FIG. 31 (SEQ ID NO:3 1), FIG. 33 (SEQ ID NO:33), FIG. 35
(SEQ ID NO:35), FIG. 37 (SEQ ID NO:37), FIG. 39 (SEQ ID NO:39),
FIG. 41 (SEQ ID NO:41), FIG. 43 (SEQ ID NO:43), FIG. 45 (SEQ ID
NO:45), FIG. 47 (SEQ ID NO:47), FIG. 49 (SEQ ID NO:49), FIG. 51
(SEQ ID NO:5 1), FIG. 53 (SEQ ID NO:53), FIG. 55 (SEQ ID NO:55),
FIG. 57 (SEQ ID NO:57), FIG. 59 (SEQ ID NO:59), FIG. 61 (SEQ ID
NO:61), FIG. 63 (SEQ ID NO:63), FIG. 65 (SEQ ID NO:65), FIG. 67
(SEQ ID NO:67), FIG. 69 (SEQ ID NO:69), FIG. 71 (SEQ ID NO:7 1),
FIG. 73 (SEQ ID NO:73), FIG. 75 (SEQ ID NO:75), FIG. 77 (SEQ ID
NO:77), FIG. 79 (SEQ ID NO:79), FIG. 81 (SEQ ID NO:81), FIG. 83
(SEQ ID NO:83), FIG. 85 (SEQ ID NO:85), FIG. 87 (SEQ ID NO:87),
FIG. 89 (SEQ ID NO:89), FIG. 91 (SEQ ID NO:91), FIG. 93 (SEQ ID
NO:93), FIG. 95 (SEQ ID NO:95), FIG. 97 (SEQ ID NO:97), FIG. 99
(SEQ ID NO:99), FIG. 101 (SEQ ID NO: 101), FIG. 103 (SEQ ID NO:
103), FIG. 105 (SEQ ID NO: 105), FIG. 107 (SEQ ID NO:107), FIG. 109
(SEQ ID NO:109), FIG. 111 (SEQ ID NO:111), FIG. 113 (SEQ ID NO:
113), FIG. 115 (SEQ ID NO: 115), FIG. 117 (SEQ ID NO: 117), FIG.
119 (SEQ ID NO: 119), FIG. 121 (SEQ ID NO:121), FIG. 123 (SEQ ID
NO:123), FIG. 125 (SEQ ID NO:125), FIG. 127 (SEQ ID NO:127), FIG.
129 (SEQ ID NO:129), FIG. 131 (SEQ ID NO:131), FIG. 133 (SEQ ID
NO:133), FIG. 135 (SEQ ID NO:135), FIG. 137 (SEQ ID NO:137), FIG.
139 (SEQ ID NO:1390), FIG. 141 (SEQ ID NO: 141), FIG. 143 (SEQ ID
NO: 143), FIG. 145 (SEQ ID NO: 145), FIG. 147 (SEQ ID NO: 147),
FIG. 149 (SEQ ID NO:149), FIG. 151 (SEQ ID NO:151), FIG. 153 (SEQ
ID NO:153), FIG. 155 (SEQ ID NO: 155), FIG. 157 (SEQ ID NO:157),
FIG. 159 (SEQ ID NO:159), FIG. 161 (SEQ ID NO:161), FIG. 163 (SEQ
ID NO:163), FIG. 165 (SEQ ID NO:165), FIG. 167 (SEQ ID NO:167),
FIG. 169 (SEQ ID NO:169), FIG. 171 (SEQ ID NO:171), FIG. 173 (SEQ
ID NO: 173), FIG. 175 (SEQ ID NO:175), FIG. 177 (SEQ ID NO:177),
FIG. 179 (SEQ ID NO:179), FIG. 181 (SEQ ID NO:181), FIG. 183 (SEQ
ID NO:183), FIG. 185 (SEQ ID NO:185), FIG. 187 (SEQ ID NO:187),
FIG. 189 (SEQ ID NO:189), FIG. 191 (SEQ ID NO:191), FIG. 193 (SEQ
ID NO:193), FIG. 195 (SEQ ID NO:195), FIG. 197 (SEQ ID NO:197),
FIG. 199 (SEQ ID NO: 199), FIG. 201 (SEQ ID NO:201), FIG. 203 (SEQ
ID NO:203), FIG. 205 (SEQ ID NO:205), FIG. 207 (SEQ ID NO:207),
FIG. 209 (SEQ ID NO:209), FIG. 211 (SEQ ID NO:211), FIG. 213 (SEQ
ID NO:213), FIG. 215 (SEQ ID NO:215), FIG. 217 (SEQ ID NO:217),
FIG. 219 (SEQ ID NO:219), FIG. 221 (SEQ ID NO:221), FIG. 223 (SEQ
ID NO:223), FIG. 225 (SEQ ID NO:225), FIG. 227 (SEQ ID NO:227),
FIG. 229 (SEQ ID NO:229), FIG. 231 (SEQ ID NO:231), FIG. 233 (SEQ
ID NO:233), FIG. 235 (SEQ ID NO:235), FIG. 237 (SEQ ID NO:237),
FIG. 239 (SEQ ID NO:239), FIG. 241 (SEQ ID NO:241), FIG. 243 (SEQ
ID NO:243), FIG. 245 (SEQ ID NO:245), FIG. 247 (SEQ ID NO:247),
FIG. 249 (SEQ ID NO:249), FIG. 251 (SEQ ID NO:251), FIG. 253 (SEQ
ID NO:253), FIG. 255 (SEQ ID NO:255), FIG. 257 (SEQ ID NO:257),
FIG. 259 (SEQ ID NO:259), FIG. 261 (SEQ ID NO:261), FIG. 263 (SEQ
ID NO:263), FIG. 265 (SEQ ID NO:265), FIG. 267 (SEQ ID NO:267),
FIG. 269 (SEQ ID NO:269), FIG. 271 (SEQ ID NO:271), FIG. 273 (SEQ
ID NO:273), FIG. 275 (SEQ ID NO:275), FIG. 277 (SEQ ID NO:277),
FIG. 279 (SEQ ID NO:279), FIG. 281 (SEQ ID NO:281), FIG. 283 (SEQ
ID NO:283), FIG. 285 (SEQ ID NO:285), FIG. 287 (SEQ ID NO:287),
FIG. 289 (SEQ ID NO:289), FIG. 291 (SEQ ID NO:291), FIG. 293 (SEQ
ID NO:293), FIG. 295 (SEQ ID NO:295), FIG. 297 (SEQ ID NO:297),
FIG. 299 (SEQ ID NO:299), FIG. 301 (SEQ ID NO:301), FIG. 303 (SEQ
ID NO:303), FIG. 305 (SEQ ID NO:305), FIG. 307 (SEQ ID NO:307),
FIG. 309 (SEQ ID NO:309), FIG. 311 (SEQ ID NO:311), FIG. 313 (SEQ
ID NO:313), FIG. 315 (SEQ ID NO:315), FIG. 317 (SEQ ID NO:317),
FIG. 319 (SEQ ID NO:319), FIG. 321 (SEQ ID NO:321), FIG. 323 (SEQ
ID NO:323), FIG. 325 (SEQ ID NO:325), FIG. 327 (SEQ ID NO:327),
FIG. 329 (SEQ ID NO:329), FIG. 331 (SEQ ID NO:331), FIG. 333 (SEQ
ID NO:333), FIG. 335 (SEQ ID NO:335), FIG. 337 (SEQ ID NO:337),
FIG. 339 (SEQ ID NO:339), FIG. 341 (SEQ ID NO:341), FIG. 343 (SEQ
ID NO:343), FIG. 345 (SEQ ID NO:345), FIG. 347 (SEQ ID NO:347),
FIG. 349 (SEQ ID NO:349), FIG. 351 (SEQ ID NO:351), FIG. 353 (SEQ
ID NO:353), FIG. 355 (SEQ ID NO:355), FIG. 357 (SEQ ID NO:357),
FIG. 359 (SEQ ID NO:359), FIG. 361 (SEQ ID NO:361), FIG. 363 (SEQ
ID NO:363), FIG. 365 (SEQ ID NO:365), FIG. 367 (SEQ ID NO:367),
FIG. 369 (SEQ ID NO:369), FIG. 371 (SEQ ID NO:371), FIG. 373 (SEQ
ID NO:373), FIG. 375 (SEQ ID NO:375), FIG. 377 (SEQ ID NO:377),
FIG. 379 (SEQ ID NO:379), FIG. 381 (SEQ ID NO:381), FIG. 383 (SEQ
ID NO:383), FIG. 385 (SEQ ID NO:385), FIG. 387 (SEQ ID NO:387),
FIG. 389 (SEQ ID NO:389), FIG. 391 (SEQ ID NO:391), FIG. 393 (SEQ
ID NO:393), FIG. 395 (SEQ ID NO:395), FIG. 397 (SEQ ID NO:397),
FIG. 399 (SEQ ID NO:399), FIG. 401 (SEQ ID NO:401), FIG. 403 (SEQ
ID NO:403), FIG. 405 (SEQ ID NO:405), FIG. 407 (SEQ ID NO:407),
FIG. 409 (SEQ ID NO:409), FIG. 411 (SEQ ID NO:411), FIG. 413 (SEQ
ID NO:413), FIG. 415 (SEQ ID NO:415), FIG. 417 (SEQ ID NO:417),
FIG. 419 (SEQ ID NO:419), FIG. 421 (SEQ ID NO:421), FIG. 423 (SEQ
ID NO:423), FIG. 425 (SEQ ID NO:425), FIG. 427 (SEQ ID NO:427),
FIG. 429 (SEQ ID NO:429), FIG. 431 (SEQ ID NO:431), FIG. 433 (SEQ
ID NO:433), FIG. 435 (SEQ ID NO:435), FIG. 437 (SEQ ID NO:437),
FIG. 439 (SEQ ID NO:439), FIG. 441 (SEQ ID NO:441), FIG. 443 (SEQ
ID NO:443), FIG. 445 (SEQ ID NO:445), FIG. 447 (SEQ ID NO:447),
FIG. 449 (SEQ ID NO:449), FIG. 451 (SEQ ID NO:451), FIG. 453 (SEQ
ID NO:453), FIG. 455 (SEQ ID NO:455), FIG. 457 (SEQ ID NO:457),
FIG. 459 (SEQ ID NO:459), FIG. 461 (SEQ ID NO:461), FIG. 463 (SEQ
ID NO:463), FIG. 465 (SEQ ID NO:465), FIG. 467 (SEQ ID NO:467),
FIG. 469 (SEQ ID NO:469), FIG. 471 (SEQ ID NO:471), FIG. 473 (SEQ
ID NO:473), FIG. 475 (SEQ ID NO:475), FIG. 477 (SEQ ID NO:477),
FIG. 479 (SEQ ID NO:479), FIG. 481 (SEQ ID NO:481), FIG. 483 (SEQ
ID NO:483), FIG. 485 (SEQ ID NO:485), FIG. 487 (SEQ ID NO:487),
FIG. 489 (SEQ ID NO:489), FIG. 491 (SEQ ID NO:491), FIG. 493 (SEQ
ID NO:493), FIG. 495 (SEQ ID NO:495), FIG. 497 (SEQ ID NO:497),
FIG. 499 (SEQ ID NO:499), FIG. 501 (SEQ ID NO:501), FIG. 503 (SEQ
ID NO:503), FIG. 505 (SEQ ID NO:505), FIG. 507 (SEQ ID NO:507),
FIG. 509 (SEQ ID NO:509), FIG. 511 (SEQ ID NO:511), FIG. 513 (SEQ
ID NO:513), FIG. 515 (SEQ ID NO:515), FIG. 517 (SEQ ID NO:517),
FIG. 519 (SEQ ID NO:519), FIG. 521 (SEQ ID NO:521), FIG. 523 (SEQ
ID NO:523), FIG. 525 (SEQ ID NO:525), FIG. 527 (SEQ ID NO:527),
FIG. 529 (SEQ ID NO:529), FIG. 531 (SEQ ID NO:531), FIG. 533 (SEQ
ID NO:533), FIG. 535 (SEQ ID NO:535), FIG. 537 (SEQ ID NO:537),
FIG. 539 (SEQ ID NO:539), FIG. 541 (SEQ ID NO:541), FIG. 543 (SEQ
ID NO:543), FIG. 545 (SEQ ID NO:545), FIG. 547 (SEQ ID NO:547) and
FIG. 549 (SEQ ID NO:549).
3. Isolated nucleic acid having at least 80% nucleic acid sequence
identity to a nucleotide sequence selected from the group
consisting of the full-length coding sequence of the nucleotide
sequence shown in FIG. 1 (SEQ ID NO:1), FIG. 3 (SEQ ID NO:3), FIG.
5 (SEQ ID NO:5), FIG. 7 (SEQ ID NO:7), FIG. 9 (SEQ ID NO:9), FIG.
11 (SEQ ID NO: 11), FIG. 13 (SEQ ID NO: 13), FIG. 15 (SEQ ID NO:
15), FIG. 17 (SEQ ID NO: 17), FIG. 19 (SEQ ID NO: 19), FIG. 21 (SEQ
ID NO:21), FIG. 23 (SEQ ID NO:23), FIG. 25 (SEQ ID NO:25), FIG. 27
(SEQ ID NO:27), FIG. 29 (SEQ ID NO:29), FIG. 31 (SEQ ID NO:3 1),
FIG. 33 (SEQ ID NO:33), FIG. 35 (SEQ ID NO:35), FIG. 37 (SEQ ID
NO:37), FIG. 39 (SEQ ID NO:39), FIG. 41 (SEQ ID NO:41), FIG. 43
(SEQ ID NO:43), FIG. 45 (SEQ ID NO:45), FIG. 47 (SEQ ID NO:47),
FIG. 49 (SEQ ID NO:49), FIG. 51 (SEQ ID NO:5 1), FIG. 53 (SEQ ID
NO:53), FIG. 55 (SEQ ID NO:55), FIG. 57 (SEQ ID NO:57), FIG. 59
(SEQ ID NO:59), FIG. 61 (SEQ ID NO:61), FIG. 63 (SEQ ID NO:63),
FIG. 65 (SEQ ID NO:65), FIG. 67 (SEQ ID NO:67), FIG. 69 (SEQ ID
NO:69), FIG. 71 (SEQ ID NO:71), FIG. 73 (SEQ ID NO:73), FIG. 75
(SEQ ID NO:75), FIG. 77 (SEQ ID NO:77), FIG. 79 (SEQ ID NO:79),
FIG. 81 (SEQ ID NO:81), FIG. 83 (SEQ ID NO:83), FIG. 85 (SEQ ID
NO:85), FIG. 87 (SEQ ID NO:87), FIG. 89 (SEQ ID NO:89), FIG. 91
(SEQ ID NO:91), FIG. 93 (SEQ ID NO:93), FIG. 95 (SEQ ID NO:95),
FIG. 97 (SEQ ID NO:97), FIG. 99 (SEQ ID NO:99), FIG. 101 (SEQ ID
NO:101), FIG. 103 (SEQ ID NO:103), FIG. 105 (SEQ ID NO:105), FIG.
107 (SEQ ID NO: 107), FIG. 109 (SEQ ID NO:109), FIG. 111 (SEQ ID
NO: 111), FIG. 113 (SEQ ID NO: 113), FIG. 115 (SEQ ID NO: 115),
FIG. 117 (SEQ ID NO: 117), FIG. 119 (SEQ ID NO:119), FIG. 121 (SEQ
ID NO:121), FIG. 123 (SEQ ID NO:123), FIG. 125 (SEQ ID NO: 125),
FIG. 127 (SEQ ID NO: 127), FIG. 129 (SEQ ID NO: 129), FIG. 131 (SEQ
ID NO: 131), FIG. 133 (SEQ ID NO:133), FIG. 135 (SEQ ID NO:135),
FIG. 137 (SEQ ID NO:137), FIG. 139 (SEQ ID NO: 1390), FIG. 141 (SEQ
ID NO: 141), FIG. 143 (SEQ ID NO: 143), FIG. 145 (SEQ ID NO: 145),
FIG. 147 (SEQ ID NO:147), FIG. 149 (SEQ ID NO:149), FIG. 151 (SEQ
ID NO:151), FIG. 153 (SEQ ID NO:153), FIG. 155 (SEQ ID NO:155),
FIG. 157 (SEQ ID NO:157), FIG. 159 (SEQ ID NO: 159), FIG. 161 (SEQ
ID NO:161), FIG. 163 (SEQ ID NO:163), FIG. 165 (SEQ ID NO:165),
FIG. 167 (SEQ ID NO:167), FIG. 169 (SEQ ID NO:169), FIG. 171 (SEQ
ID NO:171), FIG. 173 (SEQ ID NO:173), FIG. 175 (SEQ ID NO:175),
FIG. 177 (SEQ ID NO: 177), FIG. 179 (SEQ ID NO:179), FIG. 181 (SEQ
ID NO:181), FIG. 183 (SEQ ID NO:183), FIG. 185 (SEQ ID NO:185),
FIG. 187 (SEQ ID NO:187), FIG. 189 (SEQ ID NO:189), FIG. 191 (SEQ
ID NO:191), FIG. 193 (SEQ ID NO:193), FIG. 195 (SEQ ID NO: 195),
FIG. 197 (SEQ ID NO:197), FIG. 199 (SEQ ID NO:199), FIG. 201 (SEQ
ID NO:201), FIG. 203 (SEQ ID NO:203), FIG. 205 (SEQ ID NO:205),
FIG. 207 (SEQ ID NO:207), FIG. 209 (SEQ ID NO:209), FIG. 211 (SEQ
ID NO:211), FIG. 213 (SEQ ID NO:213), FIG. 215 (SEQ ID NO:215),
FIG. 217 (SEQ ID NO:217), FIG. 219 (SEQ ID NO:219), FIG. 221 (SEQ
ID NO:221), FIG. 223 (SEQ ID NO:223), FIG. 225 (SEQ ID NO:225),
FIG. 227 (SEQ ID NO:227), FIG. 229 (SEQ ID NO:229), FIG. 231 (SEQ
ID NO:231), FIG. 233 (SEQ ID NO:233), FIG. 235 (SEQ ID NO:235),
FIG. 237 (SEQ ID NO:237), FIG. 239 (SEQ ID NO:239), FIG. 241 (SEQ
ID NO:241), FIG. 243 (SEQ ID NO:243), FIG. 245 (SEQ ID NO:245),
FIG. 247 (SEQ ID NO:247), FIG. 249 (SEQ ID NO:249), FIG. 251 (SEQ
ID NO:251), FIG. 253 (SEQ ID NO:253), FIG. 255 (SEQ ID NO:255),
FIG. 257 (SEQ ID NO:257), FIG. 259 (SEQ ID NO:259), FIG. 261 (SEQ
ID NO:261), FIG. 263 (SEQ ID NO:263), FIG. 265 (SEQ ID NO:265),
FIG. 267 (SEQ ID NO:267), FIG. 269 (SEQ ID NO:269), FIG. 271 (SEQ
ID NO:271), FIG. 273 (SEQ ID NO:273), FIG. 275 (SEQ ID NO:275),
FIG. 277 (SEQ ID NO:277), FIG. 279 (SEQ ID NO:279), FIG. 281 (SEQ
ID NO:281), FIG. 283 (SEQ ID NO:283), FIG. 285 (SEQ ID NO:285),
FIG. 287 (SEQ ID NO:287), FIG. 289 (SEQ ID NO:289), FIG. 291 (SEQ
ID NO:291), FIG. 293 (SEQ ID NO:293), FIG. 295 (SEQ ID NO:295),
FIG. 297 (SEQ ID NO:297), FIG. 299 (SEQ ID NO:299), FIG. 301 (SEQ
ID NO:301), FIG. 303 (SEQ ID NO:303), FIG. 305 (SEQ ID NO:305),
FIG. 307 (SEQ ID NO:307), FIG. 309 (SEQ ID NO:309), FIG. 311 (SEQ
ID NO:311), FIG. 313 (SEQ ID NO:313), FIG. 315 (SEQ ID NO:315),
FIG. 317 (SEQ ID NO:317), FIG. 319 (SEQ ID NO:319), FIG. 321 (SEQ
ID NO:321), FIG. 323 (SEQ ID NO:323), FIG. 325 (SEQ ID NO:325),
FIG. 327 (SEQ ID NO:327), FIG. 329 (SEQ ID NO:329), FIG. 331 (SEQ
ID NO:331), FIG. 333 (SEQ ID NO:333), FIG. 335 (SEQ ID NO:335),
FIG. 337 (SEQ ID NO:337), FIG. 339 (SEQ ID NO:339), FIG. 341 (SEQ
ID NO:341), FIG. 343 (SEQ ID NO:343), FIG. 345 (SEQ ID NO:345),
FIG. 347 (SEQ ID NO:347), FIG. 349 (SEQ ID NO:349), FIG. 351 (SEQ
ID NO:351), FIG. 353 (SEQ ID NO:353), FIG. 355 (SEQ ID NO:355),
FIG. 357 (SEQ ID NO:357), FIG. 359 (SEQ ID NO:359), FIG. 361 (SEQ
ID NO:361), FIG. 363 (SEQ ID NO:363), FIG. 365 (SEQ ID NO:365),
FIG. 367 (SEQ ID NO:367), FIG. 369 (SEQ ID NO:369), FIG. 371 (SEQ
ID NO:371), FIG. 373 (SEQ ID NO:373), FIG. 375 (SEQ ID NO:375),
FIG. 377 (SEQ ID NO:377), FIG. 379 (SEQ ID NO:379), FIG. 381 (SEQ
ID NO:381), FIG. 383 (SEQ ID NO:383), FIG. 385 (SEQ ID NO:385),
FIG. 387 (SEQ ID NO:387), FIG. 389 (SEQ ID NO:389), FIG. 391 (SEQ
ID NO:391), FIG. 393 (SEQ ID NO:393), FIG. 395 (SEQ ID NO:395),
FIG. 397 (SEQ ID NO:397), FIG. 399 (SEQ ID NO:399), FIG. 401 (SEQ
ID NO:401), FIG. 403 (SEQ ID NO:403), FIG. 405 (SEQ ID NO:405),
FIG. 407 (SEQ ID NO:407), FIG. 409 (SEQ ID NO:409), FIG. 411 (SEQ
ID NO:411), FIG. 413 (SEQ ID NO:413), FIG. 415 (SEQ ID NO:415),
FIG. 417 (SEQ ID NO:417), FIG. 419 (SEQ ID NO:419), FIG. 421 (SEQ
ID NO:421), FIG. 423 (SEQ ID NO:423), FIG. 425 (SEQ ID NO:425),
FIG. 427 (SEQ ID NO:427), FIG. 429 (SEQ ID NO:429), FIG. 431 (SEQ
ID NO:431), FIG. 433 (SEQ ID NO:433), FIG. 435 (SEQ ID NO:435),
FIG. 437 (SEQ ID NO:437), FIG. 439 (SEQ ID NO:439), FIG. 441 (SEQ
ID NO:441), FIG. 443 (SEQ ID NO:443), FIG. 445 (SEQ ID NO:445),
FIG. 447 (SEQ ID NO:447), FIG. 449 (SEQ ID NO:449), FIG. 451 (SEQ
ID NO:451), FIG. 453 (SEQ ID NO:453), FIG. 455 (SEQ ID NO:455),
FIG. 457 (SEQ ID NO:457), FIG. 459 (SEQ ID NO:459), FIG. 461 (SEQ
ID NO:461), FIG. 463 (SEQ ID NO:463), FIG. 465 (SEQ ID NO:465),
FIG. 467 (SEQ ID NO:467), FIG. 469 (SEQ ID NO:469), FIG. 471 (SEQ
ID NO:471), FIG. 473 (SEQ ID NO:473), FIG. 475 (SEQ ID NO:475),
FIG. 477 (SEQ ID NO:477), FIG. 479 (SEQ ID NO:479), FIG. 481 (SEQ
ID NO:481), FIG. 483 (SEQ ID NO:483), FIG. 485 (SEQ ID NO:485),
FIG. 487 (SEQ ID NO:487), FIG. 489 (SEQ ID NO:489), FIG. 491 (SEQ
ID NO:491), FIG. 493 (SEQ ID NO:493), FIG. 495 (SEQ ID NO:495),
FIG. 497 (SEQ ID NO:497), FIG. 499 (SEQ ID NO:499), FIG. 501 (SEQ
ID NO:501), FIG. 503 (SEQ ID NO:503), FIG. 505 (SEQ ID NO:505),
FIG. 507 (SEQ ID NO:507), FIG. 509 (SEQ ID NO:509), FIG. 511 (SEQ
ID NO:511), FIG. 513 (SEQ ID NO:513), FIG. 515 (SEQ ID NO:515),
FIG. 517 (SEQ ID NO:517), FIG. 519 (SEQ ID NO:519), FIG. 521 (SEQ
ID NO:521), FIG. 523 (SEQ ID NO:523), FIG. 525 (SEQ ID NO:525),
FIG. 527 (SEQ ID NO:527), FIG. 529 (SEQ ID NO:529), FIG. 531 (SEQ
ID NO:531), FIG. 533 (SEQ ID NO:533), FIG. 535 (SEQ ID NO:535),
FIG. 537 (SEQ ID NO:537), FIG. 539 (SEQ ID NO:539), FIG. 541 (SEQ
ID NO:541), FIG. 543 (SEQ ID NO:543), FIG. 545 (SEQ ID NO:545),
FIG. 547 (SEQ ID NO:547) and FIG. 549 (SEQ ID NO:549).
4. Isolated nucleic acid having at least 80% nucleic acid sequence
identity to the full-length coding sequence of the DNA deposited
under any ATCC accession number shown in Table 7.
5. A vector comprising the nucleic acid of claim 1.
6. The vector of claim 5 operably linked to control sequences
recognized by a host cell transformed with the vector.
7. A host cell comprising the vector of claim 5.
8. The host cell of claim 7, wherein said cell is a CHO cell.
9. The host cell of claim 7, wherein said cell is an E. coli.
10. The host cell of claim 7, wherein said cell is a yeast
cell.
11. A process forproducing aPRO polypeptides comprising culturing
the host cell of claim 7 under conditions suitable for expression
of said PRO polypeptide and recovering said PRO polypeptide from
the cell culture.
12. An isolated polypeptide having at least 80% arnino acid
sequence identity to an amino acid sequence selected from the group
consisting of the amino acid sequence shown in FIG. 2 (SEQ ID
NO:2), FIG. 4 (SEQ ID NO:4), FIG. 6 (SEQ ID NO:6), FIG. 8 (SEQ ID
NO:8), FIG. 10 (SEQ ID NO:10), FIG. 12 (SEQ ID NO: 12), FIG. 14
(SEQ ID NO: 14), FIG. 16 (SEQ ID NO: 16), FIG. 18 (SEQ ID NO: 18),
FIG. 20 (SEQ ID NO:20), FIG. 22 (SEQ ID NO:22), FIG. 24 (SEQ ID
NO:24), FIG. 26 (SEQ ID NO:26), FIG. 28 (SEQ ID NO:28), FIG. 30
(SEQ ID NO:30), FIG. 32 (SEQ ID NO:32), FIG. 34 (SEQ ID NO:34),
FIG. 36 (SEQ ID NO:36), FIG. 38 (SEQ ID NO:38), FIG. 40 (SEQ ID
NO:40), FIG. 42 (SEQ ID NO:42), FIG. 44 (SEQ ID NO:44), FIG. 46
(SEQ ID NO:46), FIG. 48 (SEQ ID NO:48), FIG. 50 (SEQ ID NO:50),
FIG. 52 (SEQ ID NO:52), FIG. 54 (SEQ ID NO:54), FIG. 56 (SEQ ID
NO:56), FIG. 58 (SEQ ID NO:58), FIG. 60 (SEQ ID NO:60), FIG. 62
(SEQ ID NO:62), FIG. 64 (SEQ ID NO:64), FIG. 66 (SEQ ID NO:66),
FIG. 68 (SEQ ID NO:68), FIG. 70 (SEQ ID NO:70), FIG. 72 (SEQ ID
NO:72), FIG. 74 (SEQ ID NO:74), FIG. 76 (SEQ ID NO:76), FIG. 78
(SEQ ID NO:78), FIG. 80 (SEQ ID NO:80), FIG. 82 (SEQ ID NO:82),
FIG. 84 (SEQ ID NO:84), FIG. 86 (SEQ ID NO:86), FIG. 88 (SEQ ID
NO:88), FIG. 90 (SEQ ID NO:90), FIG. 92 (SEQ ID NO:92), FIG. 94
(SEQ ID NO:94), FIG. 96 (SEQ ID NO:96), FIG. 98 (SEQ ID NO:98),
FIG. 100 (SEQ ID NO: 100), FIG. 102 (SEQ ID NO: 102), FIG. 104 (SEQ
ID NO: 104), FIG. 106 (SEQ ID NO: 106), FIG. 108 (SEQ ID NO: 108),
FIG. 110 (SEQ ID NO: 10), FIG. 112 (SEQ ID NO: 112), FIG. 114 (SEQ
ID NO:114), FIG. 116 (SEQ ID NO:116), FIG. 118 (SEQ ID NO:118),
FIG. 120 (SEQ ID NO:120), FIG. 122 (SEQ ID NO:122), FIG. 124 (SEQ
ID NO:124), FIG. 126 (SEQ ID NO: 126), FIG. 128 (SEQ ID NO:128),
FIG. 130 (SEQ ID NO:130), FIG. 132 (SEQ ID NO:132), FIG. 134 (SEQ
ID NO:134), FIG. 136 (SEQ ID NO:136), FIG. 138 (SEQ ID NO:138),
FIG. 140 (SEQ ID NO: 140), FIG. 142 (SEQ ID NO:142), FIG. 144 (SEQ
ID NO:144), FIG. 146 (SEQ ID NO: 146), FIG. 148 (SEQ ID NO:148),
FIG. 150 (SEQ ID NO:150), FIG. 152 (SEQ ID NO: 152), FIG. 154 (SEQ
ID NO: 154), FIG. 156 (SEQ ID NO:156), FIG. 158 (SEQ ID NO:158),
FIG. 160 (SEQ ID NO:160), FIG. 162 (SEQ ID NO:162), FIG. 164 (SEQ
ID NO:164), FIG. 166 (SEQ ID NO:166), FIG. 168 (SEQ ID NO:168),
FIG. 170 (SEQ ID NO:170), FIG. 172 (SEQ ID NO:172), FIG. 174 (SEQ
ID NO:174), FIG. 176 (SEQ ID NO:176), FIG. 178 (SEQ ID NO:178),
FIG. 180 (SEQ ID NO:180), FIG. 182 (SEQ ID NO:182), FIG. 184 (SEQ
ID NO:184), FIG. 186 (SEQ ID NO:186), FIG. 188 (SEQ ID NO:188),
FIG. 190 (SEQ ID NO:190), FIG. 192 (SEQ ID NO:192), FIG. 194 (SEQ
ID NO: 194), FIG. 196 (SEQ ID NO:196), FIG. 198 (SEQ ID NO: 198),
FIG. 200 (SEQ ID NO:200), FIG. 202 (SEQ ID NO:202), FIG. 204 (SEQ
ID NO:204), FIG. 206 (SEQ ID NO:206), FIG. 208 (SEQ ID NO:208),
FIG. 210 (SEQ ID NO:210), FIG. 212 (SEQ ID NO:212), FIG. 214 (SEQ
ID NO:214), FIG. 216 (SEQ ID NO:216), FIG. 218 (SEQ ID NO:218),
FIG. 220 (SEQ ID NO:220), FIG. 222 (SEQ ID NO:222), FIG. 224 (SEQ
ID NO:224), FIG. 226 (SEQ ID NO:226), FIG. 228 (SEQ ID NO:228),
FIG. 230 (SEQ ID NO:230), FIG. 232 (SEQ ID NO:232), FIG. 234 (SEQ
ID NO:234), FIG. 236 (SEQ ID NO:236), FIG. 238 (SEQ ID NO:238),
FIG. 240 (SEQ ID NO:240), FIG. 242 (SEQ ID NO:242), FIG. 244 (SEQ
ID NO:244), FIG. 246 (SEQ ID NO:246), FIG. 248 (SEQ ID NO:248),
FIG. 250 (SEQ ID NO:250), FIG. 252 (SEQ ID NO:252), FIG. 254 (SEQ
ID NO:254), FIG. 256 (SEQ ID NO:256), FIG. 258 (SEQ ID NO:258),
FIG. 260 (SEQ ID NO:260), FIG. 262 (SEQ ID NO:262), FIG. 264 (SEQ
ID NO:264), FIG. 266 (SEQ ID NO:266), FIG. 268 (SEQ ID NO:268),
FIG. 270 (SEQ ID NO:270), FIG. 272 (SEQ ID NO:272), FIG. 274 (SEQ
ID NO:274), FIG. 276 (SEQ ID NO:276), FIG. 278 (SEQ ID NO:278),
FIG. 280 (SEQ ID NO:280), FIG. 282 (SEQ ID NO:282), FIG. 284 (SEQ
ID NO:284), FIG. 286 (SEQ ID NO:286), FIG. 288 (SEQ ID NO:288),
FIG. 290 (SEQ ID NO:290), FIG. 292 (SEQ ID NO:292), FIG. 294 (SEQ
ID NO:294), FIG. 296 (SEQ ID NO:296), FIG. 298 (SEQ ID NO:298),
FIG. 300 (SEQ ID NO:300), FIG. 302 (SEQ ID NO:302), FIG. 304 (SEQ
ID NO:304), FIG. 306 (SEQ ID NO:306), FIG. 308 (SEQ ID NO:308),
FIG. 310 (SEQ ID NO:310), FIG. 312 (SEQ ID NO:312), FIG. 314 (SEQ
ID NO:314), FIG. 316 (SEQ ID NO:316), FIG. 318 (SEQ ID NO:318),
FIG. 320 (SEQ ID NO:320), FIG. 322 (SEQ ID NO:322), FIG. 324 (SEQ
ID NO:324), FIG. 326 (SEQ ID NO:326), FIG. 328 (SEQ ID NO:328),
FIG. 330 (SEQ ID NO:330), FIG. 332 (SEQ ID NO:332), FIG. 334 (SEQ
ID NO:334), FIG. 336 (SEQ ID NO:336), FIG. 338 (SEQ ID NO:338),
FIG. 340 (SEQ ID NO:340), FIG. 342 (SEQ ID NO:342), FIG. 344 (SEQ
ID NO:344), FIG. 346 (SEQ ID NO:346), FIG. 348 (SEQ ID NO:348),
FIG. 350 (SEQ ID NO:350), FIG. 352 (SEQ ID NO:352), FIG. 354 (SEQ
ID NO:354), FIG. 356 (SEQ ID NO:356), FIG. 358 (SEQ ID NO:358),
FIG. 360 (SEQ ID NO:360), FIG. 362 (SEQ ID NO:362), FIG. 364 (SEQ
ID NO:364), FIG. 366 (SEQ ID NO:366), FIG. 368 (SEQ ID NO:368),
FIG. 370 (SEQ ID NO:370), FIG. 372 (SEQ ID NO:372), FIG. 374 (SEQ
ID NO:374), FIG. 376 (SEQ ID NO:376), FIG. 378 (SEQ ID NO:378),
FIG. 380 (SEQ ID NO:380), FIG. 382 (SEQ ID NO:382), FIG. 384 (SEQ
ID NO:384), FIG. 386 (SEQ ID NO:386), FIG. 388 (SEQ ID NO:388),
FIG. 390 (SEQ ID NO:390), FIG. 392 (SEQ ID NO:392), FIG. 394 (SEQ
ID NO:394), FIG. 396 (SEQ ID NO:396), FIG. 398 (SEQ ID NO:398),
FIG. 400 (SEQ ID NO:400), FIG. 402 (SEQ ID NO:402), FIG. 404 (SEQ
ID NO:404), FIG. 406 (SEQ ID NO:406), FIG. 408 (SEQ ID NO:408),
FIG. 410 (SEQ ID NO:410), FIG. 412 (SEQ ID NO:412), FIG. 414 (SEQ
ID NO:414), FIG. 416 (SEQ ID NO:416), FIG. 418 (SEQ ID NO:418),
FIG. 420 (SEQ ID NO:420), FIG. 422 (SEQ ID NO:422), FIG. 424 (SEQ
ID NO:424), FIG. 426 (SEQ ID NO:426), FIG. 428 (SEQ ID NO:428),
FIG. 430 (SEQ ID NO:430), FIG. 432 (SEQ ID NO:432), FIG. 434 (SEQ
ID NO:434), FIG. 436 (SEQ ID NO:436), FIG. 438 (SEQ ID NO:438),
FIG. 440 (SEQ ID NO:440), FIG. 442 (SEQ ID NO:442), FIG. 444 (SEQ
ID NO:444), FIG. 446 (SEQ ID NO:446), FIG. 448 (SEQ ID NO:448),
FIG. 450 (SEQ ID NO:450), FIG. 452 (SEQ ID NO:452), FIG. 454 (SEQ
ID NO:454), FIG. 456 (SEQ ID NO:456), FIG. 458 (SEQ ID NO:458),
FIG. 460 (SEQ ID NO:460), FIG. 462 (SEQ ID NO:462), FIG. 464 (SEQ
ID NO:464), FIG. 466 (SEQ ID NO:466), FIG. 468 (SEQ ID NO:468),
FIG. 470 (SEQ ID NO:470), FIG. 472 (SEQ ID NO:472), FIG. 474 (SEQ
ID NO:474), FIG. 476 (SEQ ID NO:476), FIG. 478 (SEQ ID NO:478),
FIG. 480 (SEQ ID NO:480), FIG. 482 (SEQ ID NO:482), FIG. 484 (SEQ
ID NO:484), FIG. 486 (SEQ ID NO:486), FIG. 488 (SEQ ID NO:488),
FIG. 490 (SEQ ID NO:490), FIG. 492 (SEQ ID NO:492), FIG. 494 (SEQ
ID NO:494), FIG. 496 (SEQ ID NO:496), FIG. 498 (SEQ ID NO:498),
FIG. 500 (SEQ ID NO:500), FIG. 502 (SEQ ID NO:502), FIG. 504 (SEQ
ID NO:504), FIG. 506 (SEQ ID NO:506), FIG. 508 (SEQ ID NO:508),
FIG. 510 (SEQ ID NO:510), FIG. 512 (SEQ ID NO:512), FIG. 514 (SEQ
ID NO:514), FIG. 516 (SEQ ID NO:516), FIG. 518 (SEQ ID NO:518),
FIG. 520 (SEQ ID NO:520), FIG. 522 (SEQ ID NO:522), FIG. 524 (SEQ
ID NO:524), FIG. 526 (SEQ ID NO:526), FIG. 528 (SEQ ID NO:528),
FIG. 530 (SEQ ID NO:530), FIG. 532 (SEQ ID NO:532), FIG. 534 (SEQ
ID NO:534), FIG. 536 (SEQ ID NO:536), FIG. 538 (SEQ ID NO:538),
FIG. 540 (SEQ ID NO:540), FIG. 542 (SEQ ID NO:542), FIG. 544 (SEQ
ID NO:544), FIG. 546 (SEQ ID NO:546), FIG. 548 (SEQ ID NO:548) and
FIG. 550 (SEQ ID NO:550).
13. An isolated polypeptide having at least 80% amino acid sequence
identity to an amino acid sequence encoded by the full-length
coding sequence of the DNA deposited under any ATCC accession
number shown in Table 7.
14. A chimeric molecule comprising a polypeptide according to claim
12 fused to a heterologous amino acid sequence.
15. The chimeric molecule of claim 14, wherein said heterologous
amino acid sequence is an epitope tag sequence.
16. The chimeric molecule of claim 14, wherein said heterologous
amino acid sequence is a Fc region of an immunoglobulin.
17. An antibody which specifically binds to a polypeptide according
to claim 12.
18. The antibody of claim 17, wherein said antibody is a monoclonal
antibody, a humanized antibody or a single-chain antibody.
19. Isolated nucleic acid having at least 80% nucleic acid sequence
identity to: (a) a nucleotide sequence encoding the polypeptide
shown in FIG. 2 (SEQ ID NO:2), FIG. 4 (SEQ ID NO:4), FIG. 6 (SEQ ID
NO:6), FIG. 8 (SEQ ID NO:8), FIG. 10 (SEQ ID NO: 10), FIG. 12 (SEQ
ID NO: 12), FIG. 14 (SEQ ID NO: 14), FIG. 16 (SEQ ID NO: 16), FIG.
18 (SEQ ID NO: 18), FIG. 20 (SEQ ID NO:20), FIG. 22 (SEQ ID NO:22),
FIG. 24 (SEQ ID NO:24), FIG. 26 (SEQ ID NO:26), FIG. 28 (SEQ ID
NO:28), FIG. 30 (SEQ ID NO:30), FIG. 32 (SEQ ID NO:32), FIG. 34
(SEQ ID NO:34), FIG. 36 (SEQ ID NO:36), FIG. 38 (SEQ ID NO:38),
FIG. 40 (SEQ ID NO:40), FIG. 42 (SEQ ID NO:42), FIG. 44 (SEQ ID
NO:44), FIG. 46 (SEQ ID NO:46), FIG. 48 (SEQ ID NO:48), FIG. 50
(SEQ ID NO:50), FIG. 52 (SEQ ID NO:52), FIG. 54 (SEQ ID NO:54),
FIG. 56 (SEQ ID NO:56), FIG. 58 (SEQ ID NO:58), FIG. 60 (SEQ ID
NO:60), FIG. 62 (SEQ ID NO:62), FIG. 64 (SEQ ID NO:64), FIG. 66
(SEQ ID NO:66), FIG. 68 (SEQ ID NO:68), FIG. 70 (SEQ ID NO:70),
FIG. 72 (SEQ ID NO:72), FIG. 74 (SEQ ID NO:74), FIG. 76 (SEQ ID
NO:76), FIG. 78 (SEQ ID NO:78), FIG. 80 (SEQ ID NO:80), FIG. 82
(SEQ ID NO:82), FIG. 84 (SEQ ID NO:84), FIG. 86 (SEQ ID NO:86),
FIG. 88 (SEQ ID NO:88), FIG. 90 (SEQ ID NO:90), FIG. 92 (SEQ ID
NO:92), FIG. 94 (SEQ ID NO:94), FIG. 96 (SEQ ID NO:96), FIG. 98
(SEQ ID NO:98), FIG. 100 (SEQ ID NO:100), FIG. 102 (SEQ ID NO:102),
FIG. 104 (SEQ ID NO:104), FIG. 106 (SEQ ID NO:106), FIG. 108 (SEQ
ID NO:108), FIG. 110 (SEQ ID NO:l10), FIG. 112 (SEQ ID NO:112),
FIG. 114 (SEQ ID NO:114), FIG. 116 (SEQ ID NO:116), FIG. 118 (SEQ
ID NO:118), FIG. 120 (SEQ ID NO:120), FIG. 122 (SEQ ID NO:122),
FIG. 124 (SEQ ID NO: 124), FIG. 126 (SEQ ID NO:126), FIG. 128 (SEQ
ID NO:128), FIG. 130 (SEQ ID NO:130), FIG. 132 (SEQ ID NO:132),
FIG. 134 (SEQ ID NO:134), FIG. 136 (SEQ ID NO:136), FIG. 138 (SEQ
ID NO:138), FIG. 140 (SEQ ID NO:140), FIG. 142 (SEQ ID NO: 142),
FIG. 144 (SEQ ID NO: 144), FIG. 146 (SEQ ID NO: 146), FIG. 148 (SEQ
ID NO:148), FIG. 150 (SEQ ID NO:150), FIG. 152 (SEQ ID NO:152),
FIG. 154 (SEQ ID NO:154), FIG. 156 (SEQ ID NO:156), FIG. 158 (SEQ
ID NO:158), FIG. 160 (SEQ ID NO:160), FIG. 162 (SEQ ID NO:162),
FIG. 164 (SEQ ID NO: 164), FIG. 166 (SEQ ID NO:166), FIG. 168 (SEQ
ID NO:168), FIG. 170 (SEQ ID NO:170), FIG. 172 (SEQ ID NO:172),
FIG. 174 (SEQ ID NO:174), FIG. 176 (SEQ ID NO: 176), FIG. 178 (SEQ
ID NO:178), FIG. 180 (SEQ ID NO:180), FIG. 182 (SEQ ID NO:182),
FIG. 184 (SEQ ID NO:184), FIG. 186 (SEQ ID NO:186), FIG. 188 (SEQ
ID NO:188), FIG. 190 (SEQ ID NO: 190), FIG. 192 (SEQ ID NO: 192),
FIG. 194 (SEQ ID NO: 194), FIG. 196 (SEQ ID NO:196), FIG. 198 (SEQ
ID NO:198), FIG. 200 (SEQ ID NO:200), FIG. 202 (SEQ ID NO:202),
FIG. 204 (SEQ ID NO:204), FIG. 206 (SEQ ID NO:206), FIG. 208 (SEQ
ID NO:208), FIG. 210 (SEQ ID NO:210), FIG. 212 (SEQ ID NO:212),
FIG. 214 (SEQ ID NO:214), FIG. 216 (SEQ ID NO:216), FIG. 218 (SEQ
ID NO:218), FIG. 220 (SEQ ID NO:220), FIG. 222 (SEQ ID NO:222),
FIG. 224 (SEQ ID NO:224), FIG. 226 (SEQ ID NO:226), FIG. 228 (SEQ
ID NO:228), FIG. 230 (SEQ ID NO:230), FIG. 232 (SEQ ID NO:232),
FIG. 234 (SEQ ID NO:234), FIG. 236 (SEQ ID NO:236), FIG. 238 (SEQ
ID NO:238), FIG. 240 (SEQ ID NO:240), FIG. 242 (SEQ ID NO:242),
FIG. 244 (SEQ ID NO:244), FIG. 246 (SEQ ID NO:246), FIG. 248 (SEQ
ID NO:248), FIG. 250 (SEQ ID NO:250), FIG. 252 (SEQ ID NO:252),
FIG. 254 (SEQ ID NO:254), FIG. 256 (SEQ ID NO:256), FIG. 258 (SEQ
ID NO:258), FIG. 260 (SEQ ID NO:260), FIG. 262 (SEQ ID NO:262),
FIG. 264 (SEQ ID NO:264), FIG. 266 (SEQ ID NO:266), FIG. 268 (SEQ
ID NO:268), FIG. 270 (SEQ ID NO:270), FIG. 272 (SEQ ID NO:272),
FIG. 274 (SEQ ID NO:274), FIG. 276 (SEQ ID NO:276), FIG. 278 (SEQ
ID NO:278), FIG. 280 (SEQ ID NO:280), FIG. 282 (SEQ ID NO:282),
FIG. 284 (SEQ ID NO:284), FIG. 286 (SEQ ID NO:286), FIG. 288 (SEQ
ID NO:288), FIG. 290 (SEQ ID NO:290), FIG. 292 (SEQ ID NO:292),
FIG. 294 (SEQ ID NO:294), FIG. 296 (SEQ ID NO:296), FIG. 298 (SEQ
ID NO:298), FIG. 300 (SEQ ID NO:300), FIG. 302 (SEQ ID NO:302),
FIG. 304 (SEQ ID NO:304), FIG. 306 (SEQ ID NO:306), FIG. 308 (SEQ
ID NO:308), FIG. 310 (SEQ ID NO:310), FIG. 312 (SEQ ID NO:312),
FIG. 314 (SEQ ID NO:314), FIG. 316 (SEQ ID NO:316), FIG. 318 (SEQ
ID NO:318), FIG. 320 (SEQ ID NO:320), FIG. 322 (SEQ ID NO:322),
FIG. 324 (SEQ ID NO:324), FIG. 326 (SEQ ID NO:326), FIG. 328 (SEQ
ID NO:328), FIG. 330 (SEQ ID NO:330), FIG. 332 (SEQ ID NO:332),
FIG. 334 (SEQ ID NO:334), FIG. 336 (SEQ ID NO:336), FIG. 338 (SEQ
ID NO:338), FIG. 340 (SEQ ID NO:340), FIG. 342 (SEQ ID NO:342),
FIG. 344 (SEQ ID NO:344), FIG. 346 (SEQ ID NO:346), FIG. 348 (SEQ
ID NO:348), FIG. 350 (SEQ ID NO:350), FIG. 352 (SEQ ID NO:352),
FIG. 354 (SEQ ID NO:354), FIG. 356 (SEQ ID NO:356), FIG. 358 (SEQ
ID NO:358), FIG. 360 (SEQ ID NO:360), FIG. 362 (SEQ ID NO:362),
FIG. 364 (SEQ ID NO:364), FIG. 366 (SEQ ID NO:366), FIG. 368 (SEQ
ID NO:368), FIG. 370 (SEQ ID NO:370), FIG. 372 (SEQ ID NO:372),
FIG. 374 (SEQ ID NO:374), FIG. 376 (SEQ ID NO:376), FIG. 378 (SEQ
ID NO:378), FIG. 380 (SEQ ID NO:380), FIG. 382 (SEQ ID NO:382),
FIG. 384 (SEQ ID NO:384), FIG. 386 (SEQ ID NO:386), FIG. 388 (SEQ
ID NO:388), FIG. 390 (SEQ ID NO:390), FIG. 392 (SEQ ID NO:392),
FIG. 394 (SEQ ID NO:394), FIG. 396 (SEQ ID NO:396), FIG. 398 (SEQ
ID NO:398), FIG. 400 (SEQ ID NO:400), FIG. 402 (SEQ ID NO:402),
FIG. 404 (SEQ ID NO:404), FIG. 406 (SEQ ID NO:406), FIG. 408 (SEQ
ID NO:408), FIG. 410 (SEQ ID NO:410), FIG. 412 (SEQ ID NO:412),
FIG. 414 (SEQ ID NO:414), FIG. 416 (SEQ ID NO:416), FIG. 418 (SEQ
ID NO:418), FIG. 420 (SEQ ID NO:420), FIG. 422 (SEQ ID NO:422),
FIG. 424 (SEQ ID NO:424), FIG. 426 (SEQ ID NO:426), FIG. 428 (SEQ
ID NO:428), FIG. 430 (SEQ ID NO:430), FIG. 432 (SEQ ID NO:432),
FIG. 434 (SEQ ID NO:434), FIG. 436 (SEQ ID NO:436), FIG. 438 (SEQ
ID NO:438), FIG. 440 (SEQ ID NO:440), FIG. 442 (SEQ ID NO:442),
FIG. 444 (SEQ ID NO:444), FIG. 446 (SEQ ID NO:446), FIG. 448 (SEQ
ID NO:448), FIG. 450 (SEQ ID NO:450), FIG. 452 (SEQ ID NO:452),
FIG. 454 (SEQ ID NO:454), FIG. 456 (SEQ ID NO:456), FIG. 458 (SEQ
ID NO:458), FIG. 460 (SEQ ID NO:460), FIG. 462 (SEQ ID NO:462),
FIG. 464 (SEQ ID NO:464), FIG. 466 (SEQ ID NO:466), FIG. 468 (SEQ
ID NO:468), FIG. 470 (SEQ ID NO:470), FIG. 472 (SEQ ID NO:472),
FIG. 474 (SEQ ID NO:474), FIG. 476 (SEQ ID NO:476), FIG. 478 (SEQ
ID NO:478), FIG. 480 (SEQ ID NO:480), FIG. 482 (SEQ ID NO:482),
FIG. 484 (SEQ ID NO:484), FIG. 486 (SEQ ID NO:486), FIG. 488 (SEQ
ID NO:488), FIG. 490 (SEQ ID NO:490), FIG. 492 (SEQ ID NO:492),
FIG. 494 (SEQ ID NO:494), FIG. 496 (SEQ ID NO:496), FIG. 498 (SEQ
ID NO:498), FIG. 500 (SEQ ID NO:500), FIG. 502 (SEQ ID NO:502),
FIG. 504 (SEQ ID NO:504), FIG. 506 (SEQ ID NO:506), FIG. 508 (SEQ
ID NO:508), FIG. 510 (SEQ ID NO:510), FIG. 512 (SEQ ID NO:512),
FIG. 514 (SEQ ID NO:514), FIG. 516 (SEQ ID NO:516), FIG. 518 (SEQ
ID NO:518), FIG. 520 (SEQ ID NO:520), FIG. 522 (SEQ ID NO:522),
FIG. 524 (SEQ ID NO:524), FIG. 526 (SEQ ID NO:526), FIG. 528 (SEQ
ID NO:528), FIG. 530 (SEQ ID NO:530), FIG. 532 (SEQ ID NO:532),
FIG. 534 (SEQ ID NO:534), FIG. 536 (SEQ ID NO:536), FIG. 538 (SEQ
ID NO:538), FIG. 540 (SEQ ID NO:540), FIG. 542 (SEQ ID NO:542),
FIG. 544 (SEQ ID NO:544), FIG. 546 (SEQ ID NO:546), FIG. 548 (SEQ
ID NO:548) or FIG. 550 (SEQ ID NO:550), lacking its associated
signal peptide; (b) a nucleotide sequence encoding an extracellular
domain of the polypeptide shown in FIG. 2 (SEQ ID NO:2), FIG. 4
(SEQ ID NO:4), FIG. 6 (SEQ ID NO:6), FIG. 8 (SEQ ID NO:8), FIG. 10
(SEQ ID NO: 10), FIG. 12 (SEQ ID NO: 12), FIG. 14 (SEQ ID NO: 14),
FIG. 16 (SEQ ID NO: 16), FIG. 18 (SEQ ID NO: 18), FIG. 20 (SEQ ID
NO:20), FIG. 22 (SEQ ID NO:22), FIG. 24 (SEQ ID NO:24), FIG. 26
(SEQ ID NO:26), FIG. 28 (SEQ ID NO:28), FIG. 30 (SEQ ID NO:30),
FIG. 32 (SEQ ID NO:32), FIG. 34 (SEQ ID NO:34), FIG. 36 (SEQ ID
NO:36), FIG. 38 (SEQ ID NO:38), FIG. 40 (SEQ ID NO:40), FIG. 42
(SEQ ID NO:42), FIG. 44 (SEQ ID NO:44), FIG. 46 (SEQ ID NO:46),
FIG. 48 (SEQ ID NO:48), FIG. 50 (SEQ ID NO:50), FIG. 52 (SEQ ID
NO:52), FIG. 54 (SEQ ID NO:54), FIG. 56 (SEQ ID NO:56), FIG. 58
(SEQ ID NO:58), FIG. 60 (SEQ ID NO:60), FIG. 62 (SEQ ID NO:62),
FIG. 64 (SEQ ID NO:64), FIG. 66 (SEQ ID NO:66), FIG. 68 (SEQ ID
NO:68), FIG. 70 (SEQ ID NO:70), FIG. 72 (SEQ ID NO:72), FIG. 74
(SEQ ID NO:74), FIG. 76 (SEQ ID NO:76), FIG. 78 (SEQ ID NO:78),
FIG. 80 (SEQ ID NO:80), FIG. 82 (SEQ ID NO:82), FIG. 84 (SEQ ID
NO:84), FIG. 86 (SEQ ID NO:86), FIG. 88 (SEQ ID NO:88), FIG. 90
(SEQ ID NO:90), FIG. 92 (SEQ ID NO:92), FIG. 94 (SEQ ID NO:94),
FIG. 96 (SEQ ID NO:96), FIG. 98 (SEQ ID NO:98), FIG. 100 (SEQ ID
NO: 100), FIG. 102 (SEQ ID NO: 102), FIG. 104 (SEQ ID NO: 104),
FIG. 106 (SEQ ID NO: 106), FIG. 108 (SEQ ID NO: 108), FIG. 110 (SEQ
ID NO: 110), FIG. 112 (SEQ ID NO: 112), FIG. 114 (SEQ ID NO: 114),
FIG. 116 (SEQ ID NO:116), FIG. 118 (SEQ ID NO:118), FIG. 120 (SEQ
ID NO:120), FIG. 122 (SEQ ID NO:122), FIG. 124 (SEQ ID NO:124),
FIG. 126 (SEQ ID NO:126), FIG. 128 (SEQ ID NO:128), FIG. 130 (SEQ
ID NO:130), FIG. 132 (SEQ ID NO:132), FIG. 134 (SEQ ID NO:134),
FIG. 136 (SEQ ID.NO:136), FIG. 138 (SEQ ID NO:138), FIG. 140 (SEQ
ID NO: 140), FIG. 142 (SEQ ID NO: 142), FIG. 144 (SEQ ID NO: 144),
FIG. 146 (SEQ ID NO: 146), FIG. 148 (SEQ ID NO: 148), FIG. 150 (SEQ
ID NO:150), FIG. 152 (SEQ ID NO:152), FIG. 154 (SEQ ID NO:154),
FIG. 156 (SEQ ID NO:156), FIG. 158 (SEQ ID NO:158), FIG. 160 (SEQ
ID NO:160), FIG. 162 (SEQ ID NO:162), FIG. 164 (SEQ ID NO:164),
FIG. 166 (SEQ ID NO:166), FIG. 168 (SEQ ID NO:168), FIG. 170 (SEQ
ID NO:170), FIG. 172 (SEQ ID NO:172), FIG. 174 (SEQ ID NO: 174),
FIG. 176 (SEQ ID NO:176), FIG. 178 (SEQ ID NO:178), FIG. 180 (SEQ
ID NO:180), FIG. 182 (SEQ ID NO:182), FIG. 184 (SEQ ID NO:184),
FIG. 186 (SEQ ID NO:186), FIG. 188 (SEQ ID NO:188), FIG. 190 (SEQ
ID NO:190), FIG. 192 (SEQ ID NO: 192), FIG. 194 (SEQ ID NO:194),
FIG. 196 (SEQ ID NO: 196), FIG. 198 (SEQ ID NO: 198), FIG. 200 (SEQ
ID NO:200), FIG. 202 (SEQ ID NO:202), FIG. 204 (SEQ ID NO:204),
FIG. 206 (SEQ ID NO:206), FIG. 208 (SEQ ID NO:208), FIG. 210 (SEQ
ID NO:210), FIG. 212 (SEQ ID NO:212), FIG. 214 (SEQ ID NO:214),
FIG. 216 (SEQ ID NO:216), FIG. 218 (SEQ ID NO:218), FIG. 220 (SEQ
ID NO:220), FIG. 222 (SEQ ID NO:222), FIG. 224 (SEQ ID NO:224),
FIG. 226 (SEQ ID NO:226), FIG. 228 (SEQ ID NO:228), FIG. 230 (SEQ
ID NO:230), FIG. 232 (SEQ ID NO:232), FIG. 234 (SEQ ID NO:234),
FIG. 236 (SEQ ID NO:236), FIG. 238 (SEQ ID NO:238), FIG. 240 (SEQ
ID NO:240), FIG. 242 (SEQ ID NO:242), FIG. 244 (SEQ ID NO:244),
FIG. 246 (SEQ ID NO:246), FIG. 248 (SEQ ID NO:248), FIG. 250 (SEQ
ID NO:250), FIG. 252 (SEQ ID NO:252), FIG. 254 (SEQ ID NO:254),
FIG. 256 (SEQ ID NO:256), FIG. 258 (SEQ ID NO:258), FIG. 260 (SEQ
ID NO:260), FIG. 262 (SEQ ID NO:262), FIG. 264 (SEQ ID NO:264),
FIG. 266 (SEQ ID NO:266), FIG. 268 (SEQ ID NO:268), FIG. 270 (SEQ
ID NO:270), FIG. 272 (SEQ ID NO:272), FIG. 274 (SEQ ID NO:274),
FIG. 276 (SEQ ID NO:276), FIG. 278 (SEQ ID NO:278), FIG. 280 (SEQ
ID NO:280), FIG. 282 (SEQ ID NO:282), FIG. 284 (SEQ ID NO:284),
FIG. 286 (SEQ ID NO:286), FIG. 288 (SEQ ID NO:288), FIG. 290 (SEQ
ID NO:290), FIG. 292 (SEQ ID NO:292), FIG. 294 (SEQ ID NO:294),
FIG. 296 (SEQ ID NO:296), FIG. 298 (SEQ ID NO:298), FIG. 300 (SEQ
ID NO:300), FIG. 302 (SEQ ID NO:302), FIG. 304 (SEQ ID NO:304),
FIG. 306 (SEQ ID NO:306), FIG. 308 (SEQ ID NO:308), FIG. 310 (SEQ
ID NO:310), FIG. 312 (SEQ ID NO:312), FIG. 314 (SEQ ID NO:314),
FIG. 316 (SEQ ID NO:316), FIG. 318 (SEQ ID NO:318), FIG. 320 (SEQ
ID NO:320), FIG. 322 (SEQ ID NO:322), FIG. 324 (SEQ ID NO:324),
FIG. 326 (SEQ ID NO:326), FIG. 328 (SEQ ID NO:328), FIG. 330 (SEQ
ID NO:330), FIG. 332 (SEQ ID NO:332), FIG. 334 (SEQ ID NO:334),
FIG. 336 (SEQ ID NO:336), FIG. 338 (SEQ ID NO:338), FIG. 340 (SEQ
ID NO:340), FIG. 342 (SEQ ID NO:342), FIG. 344 (SEQ ID NO:344),
FIG. 346 (SEQ ID NO:346), FIG. 348 (SEQ ID NO:348), FIG. 350 (SEQ
ID NO:350), FIG. 352 (SEQ ID NO:352), FIG. 354 (SEQ ID NO:354),
FIG. 356 (SEQ ID NO:356), FIG. 358 (SEQ ID NO:358), FIG. 360 (SEQ
ID NO:360), FIG. 362 (SEQ ID NO:362), FIG. 364 (SEQ ID NO:364),
FIG. 366 (SEQ ID NO:366), FIG. 368 (SEQ ID NO:368), FIG. 370 (SEQ
ID NO:370), FIG. 372 (SEQ ID NO:372), FIG. 374 (SEQ ID NO:374),
FIG. 376 (SEQ ID NO:376), FIG. 378 (SEQ ID NO:378), FIG. 380 (SEQ
ID NO:380), FIG. 382 (SEQ ID NO:382), FIG. 384 (SEQ ID NO:384),
FIG. 386 (SEQ ID NO:386), FIG. 388 (SEQ ID NO:388), FIG. 390 (SEQ
ID NO:390), FIG. 392 (SEQ ID NO:392), FIG. 394 (SEQ ID NO:394),
FIG. 396 (SEQ ID NO:396), FIG. 398 (SEQ ID NO:398), FIG. 400 (SEQ
ID NO:400), FIG. 402 (SEQ ID NO:402), FIG. 404 (SEQ ID NO:404),
FIG. 406 (SEQ ID NO:406), FIG. 408 (SEQ ID NO:408), FIG. 410 (SEQ
ID NO:410), FIG. 412 (SEQ ID NO:412), FIG. 414 (SEQ ID NO:414),
FIG. 416 (SEQ ID NO:416), FIG. 418 (SEQ ID NO:418), FIG. 420 (SEQ
ID NO:420), FIG. 422 (SEQ ID NO:422), FIG. 424 (SEQ ID NO:424),
FIG. 426 (SEQ ID NO:426), FIG. 428 (SEQ ID NO:428), FIG. 430 (SEQ
ID NO:430), FIG. 432 (SEQ ID NO:432), FIG. 434 (SEQ ID NO:434),
FIG. 436 (SEQ ID NO:436), FIG. 438 (SEQ ID NO:438), FIG. 440 (SEQ
ID NO:440), FIG. 442 (SEQ ID NO:442), FIG. 444 (SEQ ID NO:444),
FIG. 446 (SEQ ID NO:446), FIG. 448 (SEQ ID NO:448), FIG. 450 (SEQ
ID NO:450), FIG. 452 (SEQ ID NO:452), FIG. 454 (SEQ ID NO:454),
FIG. 456 (SEQ ID NO:456), FIG. 458 (SEQ ID NO:458), FIG. 460 (SEQ
ID NO:460), FIG. 462 (SEQ ID NO:462), FIG. 464 (SEQ ID NO:464),
FIG. 466 (SEQ ID NO:466), FIG. 468 (SEQ ID NO:468), FIG. 470 (SEQ
ID NO:470), FIG. 472 (SEQ ID NO:472), FIG. 474 (SEQ ID NO:474),
FIG. 476 (SEQ ID NO:476), FIG. 478 (SEQ ID NO:478), FIG. 480 (SEQ
ID NO:480), FIG. 482 (SEQ ID NO:482), FIG. 484 (SEQ ID NO:484),
FIG. 486 (SEQ ID NO:486), FIG. 488 (SEQ ID NO:488), FIG. 490 (SEQ
ID NO:490), FIG. 492 (SEQ ID NO:492), FIG. 494 (SEQ ID NO:494),
FIG. 496 (SEQ ID NO:496), FIG. 498 (SEQ ID NO:498), FIG. 500 (SEQ
ID NO:500), FIG. 502 (SEQ ID NO:502), FIG. 504 (SEQ ID NO:504),
FIG. 506 (SEQ ID NO:506), FIG. 508 (SEQ ID NO:508), FIG. 510 (SEQ
ID NO:510), FIG. 512 (SEQ ID NO:512), FIG. 514 (SEQ ID NO:514),
FIG. 516 (SEQ ID NO:516), FIG. 518 (SEQ ID NO:518), FIG. 520 (SEQ
ID NO:520), FIG. 522 (SEQ ID NO:522), FIG. 524 (SEQ ID NO:524),
FIG. 526 (SEQ ID NO:526), FIG. 528 (SEQ ID NO:528), FIG. 530 (SEQ
ID NO:530), FIG. 532 (SEQ ID NO:532), FIG. 534 (SEQ ID NO:534),
FIG. 536 (SEQ ID NO:536), FIG. 538 (SEQ ID NO:538), FIG. 540 (SEQ
ID NO:540), FIG. 542 (SEQ ID NO:542), FIG. 544 (SEQ ID NO:544),
FIG. 546 (SEQ ID NO:546), FIG. 548 (SEQ ID NO:548) or FIG. 550 (SEQ
ID NO:550), with its associated signal peptide; or (c) a nucleotide
sequence encoding an extracellular domain of the polypeptide shown
in FIG. 2 (SEQ ID NO:2), FIG. 4 (SEQ ID NO:4), FIG. 6 (SEQ ID
NO:6), FIG. 8 (SEQ ID NO:8), FIG. 10 (SEQ ID NO: 10), FIG. 12 (SEQ
ID NO: 12), FIG. 14 (SEQ ID NO:14), FIG. 16 (SEQ ID NO: 16), FIG.
18 (SEQ ID NO: 18), FIG. 20 (SEQ ID NO:20), FIG. 22 (SEQ ID NO:22),
FIG. 24 (SEQ ID NO:24), FIG. 26 (SEQ ID NO:26), FIG. 28 (SEQ ID
NO:28), FIG. 30 (SEQ ID NO:30), FIG. 32 (SEQ ID NO:32), FIG. 34
(SEQ ID NO:34), FIG. 36 (SEQ ID NO:36), FIG. 38 (SEQ ID NO:38),
FIG. 40 (SEQ ID NO:40), FIG. 42 (SEQ ID NO:42), FIG. 44 (SEQ ID
NO:44), FIG. 46 (SEQ ID NO:46), FIG. 48 (SEQ ID NO:48), FIG. 50
(SEQ ID NO:50), FIG. 52 (SEQ ID NO:52), FIG. 54 (SEQ ID NO:54),
FIG. 56 (SEQ ID NO:56), FIG. 58 (SEQ ID NO:58), FIG. 60 (SEQ ID
NO:60), FIG. 62 (SEQ ID NO:62), FIG. 64 (SEQ ID NO:64), FIG. 66
(SEQ ID NO:66), FIG. 68 (SEQ ID NO:68), FIG. 70 (SEQ ID NO:70),
FIG. 72 (SEQ ID NO:72), FIG. 74 (SEQ ID NO:74), FIG. 76 (SEQ ID
NO:76), FIG. 78 (SEQ ID NO:78), FIG. 80 (SEQ ID NO:80), FIG. 82
(SEQ ID NO:82), FIG. 84 (SEQ ID NO:84), FIG. 86 (SEQ ID NO:86),
FIG. 88 (SEQ ID NO:88), FIG. 90 (SEQ ID NO:90), FIG. 92 (SEQ ID
NO:92), FIG. 94 (SEQ ID NO:94), FIG. 96 (SEQ ID NO:96), FIG. 98
(SEQ ID NO:98), FIG. 100 (SEQ ID NO: 100), FIG. 102 (SEQ ID NO:
102), FIG. 104 (SEQ ID NO: 104), FIG. 106 (SEQ ID NO:106), FIG. 108
(SEQ ID NO:108), FIG. 110 (SEQ ID NO:110), FIG. 112 (SEQ ID NO:
112), FIG. 114 (SEQ ID NO: 114), FIG. 116 (SEQ ID NO: 116), FIG.
118 (SEQ ID NO: 118), FIG. 120 (SEQ ID NO:120), FIG. 122 (SEQ ID
NO:122), FIG. 124 (SEQ ID NO:124), FIG. 126 (SEQ ID NO:126), FIG.
128 (SEQ ID NO:128), FIG. 130 (SEQ ID NO:130), FIG. 132 (SEQ ID
NO:132), FIG. 134 (SEQ ID NO:134), FIG. 136 (SEQ ID NO:136), FIG.
138 (SEQ ID NO:138), FIG. 140 (SEQ ID NO: 140), FIG. 142 (SEQ ID
NO:142), FIG. 144 (SEQ ID NO: 144), FIG. 146 (SEQ ID NO: 146), FIG.
148 (SEQ ID NO: 148), FIG. 150 (SEQ ID NO: 150), FIG. 152 (SEQ ID
NO:152), FIG. 154 (SEQ ID NO:154), FIG. 156 (SEQ ID NO:156), FIG.
158 (SEQ ID NO:158), FIG. 160 (SEQ ID NO:160), FIG. 162 (SEQ ID
NO:162), FIG. 164 (SEQ ID NO:164), FIG. 166 (SEQ ID NO:166), FIG.
168 (SEQ ID NO:168), FIG. 170 (SEQ ID NO:170), FIG. 172 (SEQ ID
NO:172), FIG. 174 (SEQ ID NO:174), FIG. 176 (SEQ ID NO:176), FIG.
178 (SEQ ID NO: 178), FIG. 180 (SEQ ID NO:180), FIG. 182 (SEQ ID
NO:182), FIG. 184 (SEQ ID NO:184), FIG. 186 (SEQ ID NO:186), FIG.
188 (SEQ ID NO:188), FIG. 190 (SEQ ID NO:190), FIG. 192 (SEQ ID NO:
192), FIG. 194 (SEQ ID NO:194), FIG. 196 (SEQ ID NO:196), FIG. 198
(SEQ ID NO:198), FIG. 200 (SEQ ID NO:200), FIG. 202 (SEQ ID
NO:202), FIG. 204 (SEQ ID NO:204), FIG. 206 (SEQ ID NO:206), FIG.
208 (SEQ ID NO:208), FIG. 210 (SEQ ID NO:210), FIG. 212 (SEQ ID
NO:212), FIG. 214 (SEQ ID NO:214), FIG. 216 (SEQ ID NO:216), FIG.
218 (SEQ ID NO:218), FIG. 220 (SEQ ID NO:220), FIG. 222 (SEQ ID
NO:222), FIG. 224 (SEQ ID NO:224), FIG. 226 (SEQ ID NO:226), FIG.
228 (SEQ ID NO:228), FIG. 230 (SEQ ID NO:230), FIG. 232 (SEQ ID
NO:232), FIG. 234 (SEQ ID NO:234), FIG. 236 (SEQ ID NO:236), FIG.
238 (SEQ ID NO:238), FIG. 240 (SEQ ID NO:240), FIG. 242 (SEQ ID
NO:242), FIG. 244 (SEQ ID NO:244), FIG. 246 (SEQ ID NO:246), FIG.
248 (SEQ ID NO:248), FIG. 250 (SEQ ID NO:250), FIG. 252 (SEQ ID
NO:252), FIG. 254 (SEQ ID NO:254), FIG. 256 (SEQ ID NO:256), FIG.
258 (SEQ ID NO:258), FIG. 260 (SEQ ID NO:260), FIG. 262 (SEQ ID
NO:262), FIG. 264 (SEQ ID NO:264), FIG. 266 (SEQ ID NO:266), FIG.
268 (SEQ ID NO:268), FIG. 270 (SEQ ID NO:270), FIG. 272 (SEQ ID
NO:272), FIG. 274
(SEQ ID NO:274), FIG. 276 (SEQ ID NO:276), FIG. 278 (SEQ ID
NO:278), FIG. 280 (SEQ ID NO:280), FIG. 282 (SEQ ID NO:282), FIG.
284 (SEQ ID NO:284), FIG. 286 (SEQ ID NO:286), FIG. 288 (SEQ ID
NO:288), FIG. 290 (SEQ ID NO:290), FIG. 292 (SEQ ID NO:292), FIG.
294 (SEQ ID NO:294), FIG. 296 (SEQ ID NO:296), FIG. 298 (SEQ ID
NO:298), FIG. 300 (SEQ ID NO:300), FIG. 302 (SEQ ID NO:302), FIG.
304 (SEQ ID NO:304), FIG. 306 (SEQ ID NO:306), FIG. 308 (SEQ ID
NO:308), FIG. 310 (SEQ ID NO:310), FIG. 312 (SEQ ID NO:312), FIG.
314 (SEQ ID NO:314), FIG. 316 (SEQ ID NO:316), FIG. 318 (SEQ ID
NO:318), FIG. 320 (SEQ ID NO:320), FIG. 322 (SEQ ID NO:322), FIG.
324 (SEQ ID NO:324), FIG. 326 (SEQ ID NO:326), FIG. 328 (SEQ ID
NO:328), FIG. 330 (SEQ ID NO:330), FIG. 332 (SEQ ID NO:332), FIG.
334 (SEQ ID NO:334), FIG. 336 (SEQ ID NO:336), FIG. 338 (SEQ ID
NO:338), FIG. 340 (SEQ ID NO:340), FIG. 342 (SEQ ID NO:342), FIG.
344 (SEQ ID NO:344), FIG. 346 (SEQ ID NO:346), FIG. 348 (SEQ ID
NO:348), FIG. 350 (SEQ ID NO:350), FIG. 352 (SEQ ID NO:352), FIG.
354 (SEQ ID NO:354), FIG. 356 (SEQ ID NO:356), FIG. 358 (SEQ ID
NO:358), FIG. 360 (SEQ ID NO:360), FIG. 362 (SEQ ID NO:362), FIG.
364 (SEQ ID NO:364), FIG. 366 (SEQ ID NO:366), FIG. 368 (SEQ ID
NO:368), FIG. 370 (SEQ ID NO:370), FIG. 372 (SEQ ID NO:372), FIG.
374 (SEQ ID NO:374), FIG. 376 (SEQ ID NO:376), FIG. 378 (SEQ ID
NO:378), FIG. 380 (SEQ ID NO:380), FIG. 382 (SEQ ID NO:382), FIG.
384 (SEQ ID NO:384), FIG. 386 (SEQ ID NO:386), FIG. 388 (SEQ ID
NO:388), FIG. 390 (SEQ ID NO:390), FIG. 392 (SEQ ID NO:392), FIG.
394 (SEQ ID NO:394), FIG. 396 (SEQ ID NO:396), FIG. 398 (SEQ ID
NO:398), FIG. 400 (SEQ ID NO:400), FIG. 402 (SEQ ID NO:402), FIG.
404 (SEQ ID NO:404), FIG. 406 (SEQ ID NO:406), FIG. 408 (SEQ ID
NO:408), FIG. 410 (SEQ ID NO:410), FIG. 412 (SEQ ID NO:412), FIG.
414 (SEQ ID NO:414), FIG. 416 (SEQ ID NO:416), FIG. 418 (SEQ ID
NO:418), FIG. 420 (SEQ ID NO:420), FIG. 422 (SEQ ID NO:422), FIG.
424 (SEQ ID NO:424), FIG. 426 (SEQ ID NO:426), FIG. 428 (SEQ ID
NO:428), FIG. 430 (SEQ ID NO:430), FIG. 432 (SEQ ID NO:432), FIG.
434 (SEQ ID NO:434), FIG. 436 (SEQ ID NO:436), FIG. 438 (SEQ ID
NO:438), FIG. 440 (SEQ ID NO:440), FIG. 442 (SEQ ID NO:442), FIG.
444 (SEQ ID NO:444), FIG. 446 (SEQ ID NO:446), FIG. 448 (SEQ ID
NO:448), FIG. 450 (SEQ ID NO:450), FIG. 452 (SEQ ID NO:452), FIG.
454 (SEQ ID NO:454), FIG. 456 (SEQ ID NO:456), FIG. 458 (SEQ ID
NO:458), FIG. 460 (SEQ ID NO:460), FIG. 462 (SEQ ID NO:462), FIG.
464 (SEQ ID NO:464), FIG. 466 (SEQ ID NO:466), FIG. 468 (SEQ ID
NO:468), FIG. 470 (SEQ ID NO:470), FIG. 472 (SEQ ID NO:472), FIG.
474 (SEQ ID NO:474), FIG. 476 (SEQ ID NO:476), FIG. 478 (SEQ ID
NO:478), FIG. 480 (SEQ ID NO:480), FIG. 482 (SEQ ID NO:482), FIG.
484 (SEQ ID NO:484), FIG. 486 (SEQ ID NO:486), FIG. 488 (SEQ ID
NO:488), FIG. 490 (SEQ ID NO:490), FIG. 492 (SEQ ID NO:492), FIG.
494 (SEQ ID NO:494), FIG. 496 (SEQ ID NO:496), FIG. 498 (SEQ ID
NO:498), FIG. 500 (SEQ ID NO:500), FIG. 502 (SEQ ID NO:502), FIG.
504 (SEQ ID NO:504), FIG. 506 (SEQ ID NO:506), FIG. 508 (SEQ ID
NO:508), FIG. 510 (SEQ ID NO:510), FIG. 512 (SEQ ID NO:512), FIG.
514 (SEQ ID NO:514), FIG. 516 (SEQ ID NO:516), FIG. 518 (SEQ ID
NO:518), FIG. 520 (SEQ ID NO:520), FIG. 522 (SEQ ID NO:522), FIG.
524 (SEQ ID NO:524), FIG. 526 (SEQ ID NO:526), FIG. 528 (SEQ ID
NO:528), FIG. 530 (SEQ ID NO:530), FIG. 532 (SEQ ID NO:532), FIG.
534 (SEQ ID NO:534), FIG. 536 (SEQ ID NO:536), FIG. 538 (SEQ ID
NO:538), FIG. 540 (SEQ ID NO:540), FIG. 542 (SEQ ID NO:542), FIG.
544 (SEQ ID NO:544), FIG. 546 (SEQ ID NO:546), FIG. 548 (SEQ ID
NO:548) or FIG. 550 (SEQ ID NO:550), lacking its associated signal
peptide.
20. An isolated polypeptide having at least 80% amino acid sequence
identity to: (a) an amino acid sequence of the polypeptide shown in
FIG. 2 (SEQ ID NO:2), FIG. 4 (SEQ ID NO:4), FIG. 6 (SEQ ID NO:6),
FIG. 8 (SEQ ID NO:8), FIG. 10 (SEQ ID NO: 10), FIG. 12 (SEQ ID
NO:12), FIG. 14 (SEQ ID NO:14), FIG. 16 (SEQ ID NO:16), FIG. 18
(SEQ ID NO:18), FIG. 20 (SEQ ]D NO:20), FIG. 22 (SEQ ID NO:22),
FIG. 24 (SEQ ID NO:24), FIG. 26 (SEQ ID NO:26), FIG. 28 (SEQ ID
NO:28), FIG. 30 (SEQ ID NO:30), FIG. 32 (SEQ ID NO:32), FIG. 34
(SEQ ID NO:34), FIG. 36 (SEQ ID NO:36), FIG. 38 (SEQ ID NO:38),
FIG. 40 (SEQ ID NO:40), FIG. 42 (SEQ ID NO:42), FIG. 44 (SEQ ID
NO:44), FIG. 46 (SEQ ID NO:46), FIG. 48 (SEQ ID NO:48), FIG. 50
(SEQ ID NO:50), FIG. 52 (SEQ ID NO:52), FIG. 54 (SEQ ID NO:54),
FIG. 56 (SEQ ID NO:56), FIG. 58 (SEQ ID NO:58), FIG. 60 (SEQ ID
NO:60), FIG. 62 (SEQ ID NO:62), FIG. 64 (SEQ ID NO:64), FIG. 66
(SEQ ID NO:66), FIG. 68 (SEQ ID NO:68), FIG. 70 (SEQ ID NO:70),
FIG. 72 (SEQ ID NO:72), FIG. 74 (SEQ ID NO:74), FIG. 76 (SEQ ID
NO:76), FIG. 78 (SEQ ID NO:78), FIG. 80 (SEQ ID NO:80), FIG. 82
(SEQ ID NO:82), FIG. 84 (SEQ ID NO:84), FIG. 86 (SEQ ID NO:86),
FIG. 88 (SEQ ID NO:88), FIG. 90 (SEQ ID NO:90), FIG. 92 (SEQ ID
NO:92), FIG. 94 (SEQ ID NO:94), FIG. 96 (SEQ ID NO:96), FIG. 98
(SEQ ID NO:98), FIG. 100 (SEQ ID NO: 100), FIG. 102 (SEQ ID
NO:102), FIG. 104 (SEQ ID NO:104), FIG. 106 (SEQ ID NO:106), FIG.
108 (SEQ ID NO:108), FIG. 110 (SEQ ID NO:110), FIG. 112 (SEQ ID
N0:112), FIG. 114 (SEQ ID NO:114), FIG. 116 (SEQ ID NO:116), FIG.
118 (SEQ ID NO:118), FIG. 120 (SEQ ID NO:120), FIG. 122 (SEQ ID
NO:122), FIG. 124 (SEQ ID NO:124), FIG. 126 (SEQ ID NO:126), FIG.
128 (SEQ ID NO:128), FIG. 130 (SEQ ID NO:130), FIG. 132 (SEQ ID
NO:132), FIG. 134 (SEQ ID NO:134), FIG. 136 (SEQ ID NO:136), FIG.
138 (SEQ ID NO:138), FIG. 140 (SEQ ID NO: 140), FIG. 142 (SEQ ID
NO: 142), FIG. 144 (SEQ ID NO:144), FIG. 146 (SEQ ID NO: 146), FIG.
148 (SEQ ID NO: 148), FIG. 150 (SEQ ID NO:150), FIG. 152 (SEQ ID
NO:152), FIG. 154 (SEQ ID NO:154), FIG. 156 (SEQ ID NO:156), FIG.
158 (SEQ ID NO:158), FIG. 160 (SEQ ID NO:160), FIG. 162 (SEQ ID
NO:162), FIG. 164 (SEQ ID NO:164), FIG. 166 (SEQ ID NO:166), FIG.
168 (SEQ ID NO:168), FIG. 170 (SEQ ID NO:170), FIG. 172 (SEQ ID
NO:172), FIG. 174 (SEQ ID NO:174), FIG. 176 (SEQ ID NO:176), FIG.
178 (SEQ ID NO:178), FIG. 180 (SEQ ID NO:180), FIG. 182 (SEQ ID
NO:182), FIG. 184 (SEQ ID NO:184), FIG. 186 (SEQ ID NO:186), FIG.
188 (SEQ ID NO:188), FIG. 190 (SEQ ID NO:190), FIG. 192 (SEQ ID NO:
192), FIG. 194 (SEQ ID NO:194), FIG. 196 (SEQ ID NO:196), FIG. 198
(SEQ ID NO: 198), FIG. 200 (SEQ ID NO:200), FIG. 202 (SEQ ID
NO:202), FIG. 204 (SEQ ID NO:204), FIG. 206 (SEQ ID NO:206), FIG.
208 (SEQ ID NO:208), FIG. 210 (SEQ ID NO:210), FIG. 212 (SEQ ID
NO:212), FIG. 214 (SEQ ID NO:214), FIG. 216 (SEQ ID NO:216), FIG.
218 (SEQ ID NO:218), FIG. 220 (SEQ ID NO:220), FIG. 222 (SEQ ID
NO:222), FIG. 224 (SEQ ID NO:224), FIG. 226 (SEQ ID NO:226), FIG.
228 (SEQ ID NO:228), FIG. 230 (SEQ ID NO:230), FIG. 232 (SEQ ID
NO:232), FIG. 234 (SEQ ID NO:234), FIG. 236 (SEQ ID NO:236), FIG.
238 (SEQ ID NO:238), FIG. 240 (SEQ ID NO:240), FIG. 242 (SEQ ID
NO:242), FIG. 244 (SEQ ID NO:244), FIG. 246 (SEQ ID NO:246), FIG.
248 (SEQ ID NO:248), FIG. 250 (SEQ ID NO:250), FIG. 252 (SEQ ID
NO:252), FIG. 254 (SEQ ID NO:254), FIG. 256 (SEQ ID NO:256), FIG.
258 (SEQ ID NO:258), FIG. 260 (SEQ ID NO:260), FIG. 262 (SEQ ID NO
262), FIG. 264 (SEQ ID NO:264), FIG. 266 (SEQ ID NO:266), FIG. 268
(SEQ ID NO:268), FIG. 270 (SEQ ID NO:270), FIG. 272 (SEQ ID
NO:272), FIG. 274 (SEQ ID NO:274), FIG. 276 (SEQ ID NO:276), FIG.
278 (SEQ ID NO:278), FIG. 280 (SEQ ID NO:280), FIG. 282 (SEQ ID
NO:282), FIG. 284 (SEQ ID NO:284), FIG. 286 (SEQ ID NO:286), FIG.
288 (SEQ ID NO:288), FIG. 290 (SEQ ID NO:290), FIG. 292 (SEQ ID
NO:292), FIG. 294 (SEQ ID NO:294), FIG. 296 (SEQ ID NO:296), FIG.
298 (SEQ ID NO:298), FIG. 300 (SEQ ID NO:300), FIG. 302 (SEQ ID
NO:302), FIG. 304 (SEQ ID NO:304), FIG. 306 (SEQ ID NO:306), FIG.
308 (SEQ ID NO:308), FIG. 310 (SEQ ID NO:310), FIG. 312 (SEQ ID
NO:312), FIG. 314 (SEQ ID NO:314), FIG. 316 (SEQ ID NO:316), FIG.
318 (SEQ ID NO:318), FIG. 320 (SEQ ID NO:320), FIG. 322 (SEQ ID
NO:322), FIG. 324 (SEQ ID NO:324), FIG. 326 (SEQ ID NO:326), FIG.
328 (SEQ ID NO:328), FIG. 330 (SEQ ID NO:330), FIG. 332 (SEQ ID
NO:332), FIG. 334 (SEQ ID NO:334), FIG. 336 (SEQ ID NO:336), FIG.
338 (SEQ ID NO:338), FIG. 340 (SEQ ID NO:340), FIG. 342 (SEQ ID
NO:342), FIG. 344 (SEQ ID NO:344), FIG. 346 (SEQ ID NO:346), FIG.
348 (SEQ ID NO:348), FIG. 350 (SEQ ID NO:350), FIG. 352 (SEQ ID
NO:352), FIG. 354 (SEQ ID NO:354), FIG. 356 (SEQ ID NO:356), FIG.
358 (SEQ ID NO:358), FIG. 360 (SEQ ID NO:360), FIG. 362 (SEQ ID
NO:362), FIG. 364 (SEQ ID NO:364), FIG. 366 (SEQ ID NO:366), FIG.
368 (SEQ ID NO:368), FIG. 370 (SEQ ID NO:370), FIG. 372 (SEQ ID
NO:372), FIG. 374 (SEQ ID NO:374), FIG. 376 (SEQ ID NO:376), FIG.
378 (SEQ ID NO:378), FIG. 380 (SEQ ID NO:380), FIG. 382 (SEQ ID
NO:382), FIG. 384 (SEQ ID NO:384), FIG. 386 (SEQ ID NO:386), FIG.
388 (SEQ ID NO:388), FIG. 390 (SEQ ID NO:390), FIG. 392 (SEQ ID
NO:392), FIG. 394 (SEQ ID NO:394), FIG. 396 (SEQ ID NO:396), FIG.
398 (SEQ ID NO:398), FIG. 400 (SEQ ID NO:400), FIG. 402 (SEQ ID
NO:402), FIG. 404 (SEQ ID NO:404), FIG. 406 (SEQ ID NO:406), FIG.
408 (SEQ ID NO:408), FIG. 410 (SEQ ID NO:410), FIG. 412 (SEQ ID
NO:412), FIG. 414 (SEQ ID NO:414), FIG. 416 (SEQ ID NO:416), FIG.
418 (SEQ ID NO:418), FIG. 420 (SEQ ID NO:420), FIG. 422 (SEQ ID
NO:422), FIG. 424 (SEQ ID NO:424), FIG. 426 (SEQ ID NO:426), FIG.
428 (SEQ ID NO:428), FIG. 430 (SEQ ID NO:430), FIG. 432 (SEQ ID
NO:432), FIG. 434 (SEQ ID NO:434), FIG. 436 (SEQ ID NO:436), FIG.
438 (SEQ ID NO:438), FIG. 440 (SEQ ID NO:440), FIG. 442 (SEQ ID
NO:442), FIG. 444 (SEQ ID NO:444), FIG. 446 (SEQ ID NO:446), FIG.
448 (SEQ ID NO:448), FIG. 450 (SEQ ID NO:450), FIG. 452 (SEQ ID
NO:452), FIG. 454 (SEQ ID NO:454), FIG. 456 (SEQ ID NO:456), FIG.
458 (SEQ ID NO:458), FIG. 460 (SEQ ID NO:460), FIG. 462 (SEQ ID
NO:462), FIG. 464 (SEQ ID NO:464), FIG. 466 (SEQ ID NO:466), FIG.
468 (SEQ ID NO:468), FIG. 470 (SEQ ID NO:470), FIG. 472 (SEQ ID
NO:472), FIG. 474 (SEQ ID NO:474), FIG. 476 (SEQ ID NO:476), FIG.
478 (SEQ ID NO:478), FIG. 480 (SEQ ID NO:480), FIG. 482 (SEQ ID
NO:482), FIG. 484 (SEQ ID NO:484), FIG. 486 (SEQ ID NO:486), FIG.
488 (SEQ ID NO:488), FIG. 490 (SEQ ID NO:490), FIG. 492 (SEQ ID
NO:492), FIG. 494 (SEQ ID NO:494), FIG. 496 (SEQ ID NO:496), FIG.
498 (SEQ ID NO:498), FIG. 500 (SEQ ID NO:500), FIG. 502 (SEQ ID
NO:502), FIG. 504 (SEQ ID NO:504), FIG. 506 (SEQ ID NO:506), FIG.
508 (SEQ ID NO:508), FIG. 510 (SEQ ID NO:510), FIG. 512 (SEQ ID
NO:512), FIG. 514 (SEQ ID NO:514), FIG. 516 (SEQ ID NO:516), FIG.
518 (SEQ ID NO:518), FIG. 520 (SEQ ID NO:520), FIG. 522 (SEQ ID
NO:522), FIG. 524 (SEQ ID NO:524), FIG. 526 (SEQ ID NO:526), FIG.
528 (SEQ ID NO:528), FIG. 530 (SEQ ID NO:530), FIG. 532 (SEQ ID
NO:532), FIG. 534 (SEQ ID NO:534), FIG. 536 (SEQ ID NO:536), FIG.
538 (SEQ ID NO:538), FIG. 540 (SEQ ID NO:540), FIG. 542 (SEQ ID
NO:542), FIG. 544 (SEQ ID NO:544), FIG. 546 (SEQ ID NO:546), FIG.
548 (SEQ ID NO:548) or FIG. 550 (SEQ ID NO:550), lacking its
associated signal peptide; (b) an amino acid sequence of an
extracellular domain of the polypeptide shown in FIG. 2 (SEQ ID
NO:2), FIG. 4 (SEQ ID NO:4), FIG. 6 (SEQ ID NO:6), FIG. 8 (SEQ ID
NO:8), FIG. 10 (SEQ ID NO:10), FIG. 12 (SEQ ID NO:12), FIG. 14 (SEQ
ID NO: 14), FIG. 16 (SEQ ID NO:16), FIG. 18 (SEQ ID NO: 18), FIG.
20 (SEQ ID NO:20), FIG. 22 (SEQ ID NO:22), FIG. 24 (SEQ ID NO:24),
FIG. 26 (SEQ ID NO:26), FIG. 28 (SEQ ID NO:28), FIG. 30 (SEQ ID
NO:30), FIG. 32 (SEQ ID NO:32), FIG. 34 (SEQ ID NO:34), FIG. 36
(SEQ ID NO:36), FIG. 38 (SEQ ID NO:38), FIG. 40 (SEQ ID NO:40),
FIG. 42 (SEQ ID NO:42), FIG. 44 (SEQ ID NO:44), FIG. 46 (SEQ ID
NO:46), FIG. 48 (SEQ ID NO:48), FIG. 50 (SEQ ID NO:50), FIG. 52
(SEQ ID NO:52), FIG. 54 (SEQ ID NO:54), FIG. 56 (SEQ ID NO:56),
FIG. 58 (SEQ ID NO:58), FIG. 60 (SEQ ID NO:60), FIG. 62 (SEQ ID
NO:62), FIG. 64 (SEQ ID NO:64), FIG. 66 (SEQ ID NO:66), FIG. 68
(SEQ ID NO:68), FIG. 70 (SEQ ID NO:70), FIG. 72 (SEQ ID NO:72),
FIG. 74 (SEQ ID NO:74), FIG. 76 (SEQ ID NO:76), FIG. 78 (SEQ ID
NO:78), FIG. 80 (SEQ ID NO:80), FIG. 82 (SEQ ID NO:82), FIG. 84
(SEQ ID NO:84), FIG. 86 (SEQ ID NO:86), FIG. 88 (SEQ ID NO:88),
FIG. 90 (SEQ ID NO:90), FIG. 92 (SEQ ID NO:92), FIG. 94 (SEQ ID
NO:94), FIG. 96 (SEQ ID NO:96), FIG. 98 (SEQ ID NO:98), FIG. 100
(SEQ ID NO: 100), FIG. 102 (SEQ ID NO: 102), FIG. 104 (SEQ ID NO:
104), FIG. 106 (SEQ ID NO:106), FIG. 108 (SEQ ID NO:108), FIG. 110
(SEQ ID NO:l0), FIG. 112 (SEQ ID NO: 112), FIG. 114 (SEQ ID NO:
114), FIG. 116 (SEQ ID NO: 116), FIG. 118 (SEQ ID NO: 118), FIG.
120 (SEQ ID NO:120), FIG. 122 (SEQ ID NO:122), FIG. 124 (SEQ ID
NO:124), FIG. 126 (SEQ ID NO:126), FIG. 128 (SEQ ID NO:128), FIG.
130 (SEQ ID NO:130), FIG. 132 (SEQ ID NO:132), FIG. 134 (SEQ ID
NO:134), FIG. 136 (SEQ ID NO:136), FIG. 138 (SEQ ID NO:138), FIG.
140 (SEQ ID NO: 140), FIG. 142 (SEQ ID NO: 142), FIG. 144 (SEQ ID
NO: 144), FIG. 146 (SEQ ID NO: 146), FIG. 148 (SEQ ID NO: 148),
FIG. 150 (SEQ ID NO:150), FIG. 152 (SEQ ID NO: 152), FIG. 154 (SEQ
ID NO:154), FIG. 156 (SEQ ID NO: 156), FIG. 158 (SEQ ID NO:158),
FIG. 160 (SEQ ID NO:160), FIG. 162 (SEQ ID NO:162), FIG. 164 (SEQ
ID NO:164), FIG. 166 (SEQ ID NO:166), FIG. 168 (SEQ ID NO:168),
FIG. 170 (SEQ ID NO:170), FIG. 172 (SEQ ID NO:172), FIG. 174 (SEQ
ID NO: 174), FIG. 176 (SEQ ID NO:176), FIG. 178 (SEQ ID NO:178),
FIG. 180 (SEQ ID NO:180), FIG. 182 (SEQ ID NO:182), FIG. 184 (SEQ
ID NO:184), FIG. 186 (SEQ ID NO:186), FIG. 188 (SEQ ID NO:188),
FIG. 190 (SEQ ID NO: 190), FIG. 192 (SEQ ID NO:192), FIG. 194 (SEQ
ID NO:194), FIG. 196 (SEQ ID NO:196), FIG. 198 (SEQ ID NO:198),
FIG. 200 (SEQ ID NO:200), FIG. 202 (SEQ ID NO:202), FIG. 204 (SEQ
ID NO:204), FIG. 206 (SEQ ID NO:206), FIG. 208 (SEQ ID NO:208),
FIG. 210 (SEQ ID NO:210), FIG. 212 (SEQ ID NO:212), FIG. 214 (SEQ
ID NO:214), FIG. 216 (SEQ ID NO:216), FIG. 218 (SEQ ID NO:218),
FIG. 220 (SEQ ID NO:220), FIG. 222 (SEQ ID NO:222), FIG. 224 (SEQ
ID NO:224), FIG. 226 (SEQ ID NO:226), FIG. 228 (SEQ ID NO:228),
FIG. 230 (SEQ ID NO:230), FIG. 232 (SEQ ID NO:232), FIG. 234 (SEQ
ID NO:234), FIG. 236 (SEQ ID NO:236), FIG. 238 (SEQ ID NO:238),
FIG. 240 (SEQ ID NO:240), FIG. 242 (SEQ ID NO:242), FIG. 244 (SEQ
ID NO:244), FIG. 246 (SEQ ID NO:246), FIG. 248 (SEQ ID NO:248),
FIG. 250 (SEQ ID NO:250), FIG. 252 (SEQ ID NO:252), FIG. 254 (SEQ
ID NO:254), FIG. 256 (SEQ ID NO:256), FIG. 258 (SEQ ID NO:258),
FIG. 260 (SEQ ID NO:260), FIG. 262 (SEQ ID NO:262), FIG. 264 (SEQ
ID NO:264), FIG. 266 (SEQ ID NO:266), FIG. 268 (SEQ ID NO:268),
FIG. 270 (SEQ ID NO:270), FIG. 272 (SEQ ID NO:272), FIG. 274 (SEQ
ID NO:274), FIG. 276 (SEQ ID NO:276), FIG. 278 (SEQ ID NO:278),
FIG. 280 (SEQ ID NO:280), FIG. 282 (SEQ ID NO:282), FIG. 284 (SEQ
ID NO:284), FIG. 286 (SEQ ID NO:286), FIG. 288 (SEQ ID NO:288),
FIG. 290 (SEQ ID NO:290), FIG. 292 (SEQ ID NO:292), FIG. 294 (SEQ
ID NO:294), FIG. 296 (SEQ ID NO:296), FIG. 298 (SEQ ID NO:298),
FIG. 300 (SEQ ID NO:300), FIG. 302 (SEQ ID NO:302), FIG. 304 (SEQ
ID NO:304), FIG. 306 (SEQ ID NO:306), FIG. 308 (SEQ ID NO:308),
FIG. 310 (SEQ ID NO:310), FIG. 312 (SEQ ID NO:312), FIG. 314 (SEQ
ID NO:314), FIG. 316 (SEQ ID NO:316), FIG. 318 (SEQ ID NO:318),
FIG. 320 (SEQ ID NO:320), FIG. 322 (SEQ ID NO:322), FIG. 324 (SEQ
ID NO:324), FIG. 326 (SEQ ID NO:326), FIG. 328 (SEQ ID NO:328),
FIG. 330 (SEQ ID NO:330), FIG. 332 (SEQ ID NO:332), FIG. 334 (SEQ
ID NO:334), FIG. 336 (SEQ ID NO:336), FIG. 338 (SEQ ID NO:338),
FIG. 340 (SEQ ID NO:340), FIG. 342 (SEQ ID NO:342), FIG. 344 (SEQ
ID NO:344), FIG. 346 (SEQ ID NO:346), FIG. 348 (SEQ ID NO:348),
FIG. 350 (SEQ ID NO:350), FIG. 352 (SEQ ID NO:352), FIG. 354 (SEQ
ID NO:354), FIG. 356 (SEQ ID NO:356), FIG. 358 (SEQ ID NO:358),
FIG. 360 (SEQ ID NO:360), FIG. 362 (SEQ ID NO:362), FIG. 364 (SEQ
ID NO:364), FIG. 366 (SEQ ID NO:366), FIG. 368 (SEQ ID NO:368),
FIG. 370 (SEQ ID NO:370), FIG. 372 (SEQ ID NO:372), FIG. 374 (SEQ
ID NO:374), FIG. 376 (SEQ ID NO:376), FIG. 378 (SEQ ID NO:378),
FIG. 380 (SEQ ID NO:380), FIG. 382 (SEQ ID NO:382), FIG. 384 (SEQ
ID NO:384), FIG. 386 (SEQ ID NO:386), FIG. 388 (SEQ ID NO:388),
FIG. 390 (SEQ ID NO:390), FIG. 392 (SEQ ID NO:392), FIG. 394 (SEQ
ID NO:394), FIG. 396 (SEQ ID NO:396), FIG. 398 (SEQ ID NO:398),
FIG. 400 (SEQ ID NO:400), FIG. 402 (SEQ ID NO:402), FIG. 404 (SEQ
ID NO:404), FIG. 406 (SEQ ID NO:406), FIG. 408 (SEQ ID NO:408),
FIG. 410 (SEQ ID NO:410), FIG. 412 (SEQ ID NO:412), FIG. 414 (SEQ
ID NO:414), FIG. 416 (SEQ ID NO:416), FIG. 418 (SEQ ID NO:418),
FIG. 420 (SEQ ID NO:420), FIG. 422 (SEQ ID NO:422), FIG. 424 (SEQ
ID NO:424), FIG. 426 (SEQ ID NO:426), FIG. 428 (SEQ ID NO:428),
FIG. 430 (SEQ ID NO:430), FIG. 432 (SEQ ID NO:432), FIG. 434 (SEQ
ID NO:434), FIG. 436 (SEQ ID NO:436), FIG. 438 (SEQ ID NO:438),
FIG. 440 (SEQ ID NO:440), FIG. 442 (SEQ ID NO:442), FIG. 444 (SEQ
ID NO:444), FIG. 446 (SEQ ID NO:446), FIG. 448 (SEQ ID NO:448),
FIG. 450 (SEQ ID NO:450), FIG. 452 (SEQ ID NO:452), FIG. 454 (SEQ
ID NO:454), FIG. 456 (SEQ ID NO:456), FIG. 458 (SEQ ID NO:458),
FIG. 460 (SEQ ID NO:460), FIG. 462 (SEQ ID NO:462), FIG. 464 (SEQ
ID NO:464), FIG. 466 (SEQ ID NO:466), FIG. 468 (SEQ ID NO:468),
FIG. 470 (SEQ ID NO:470), FIG. 472 (SEQ ID NO:472), FIG. 474 (SEQ
ID NO:474), FIG. 476 (SEQ ID NO:476), FIG. 478 (SEQ ID NO:478),
FIG. 480 (SEQ ID NO:480), FIG. 482 (SEQ ID NO:482), FIG. 484 (SEQ
ID NO:484), FIG. 486 (SEQ ID NO:486), FIG. 488 (SEQ ID NO:488),
FIG. 490 (SEQ ID NO:490), FIG. 492 (SEQ ID NO:492), FIG. 494 (SEQ
ID NO:494), FIG. 496 (SEQ ID NO:496), FIG. 498 (SEQ ID NO:498),
FIG. 500 (SEQ ID NO:500), FIG. 502 (SEQ ID NO:502), FIG. 504 (SEQ
ID NO:504), FIG. 506 (SEQ ID NO:506), FIG. 508 (SEQ ID NO:508),
FIG. 510 (SEQ ID NO:510), FIG. 512 (SEQ ID NO:512), FIG. 514 (SEQ
ID NO:514), FIG. 516 (SEQ ID NO:516), FIG. 518 (SEQ ID NO:518),
FIG. 520 (SEQ ID NO:520), FIG. 522 (SEQ ID NO:522), FIG. 524 (SEQ
ID NO:524), FIG. 526 (SEQ ID NO:526), FIG. 528 (SEQ ID NO:528),
FIG. 530 (SEQ ID NO:530), FIG. 532 (SEQ ID NO:532), FIG. 534 (SEQ
ID NO:534), FIG. 536 (SEQ ID NO:536), FIG. 538 (SEQ ID NO:538),
FIG. 540 (SEQ ID NO:540), FIG. 542 (SEQ ID NO:542), FIG. 544 (SEQ
ID NO:544), FIG. 546 (SEQ ID NO:546), FIG. 548 (SEQ ID NO:548) or
FIG. 550 (SEQ ID NO:550), with its associated signal peptide; or
(c) an amino acid sequence of an extracellular domain of the
polypeptide shown in FIG. 2 (SEQ ID NO:2), FIG. 4 (SEQ ID NO:4),
FIG. 6 (SEQ ID NO:6), FIG. 8 (SEQ ID NO:8), FIG. 10 (SEQ ID NO:
10), FIG. 12 (SEQ ID NO:12), FIG. 14 (SEQ ID NO: 14), FIG. 16 (SEQ
ID NO:16), FIG. 18 (SEQ ID NO: 18), FIG. 20 (SEQ ID NO:20), FIG. 22
(SEQ ID NO:22), FIG. 24 (SEQ ID NO:24), FIG. 26 (SEQ ID NO:26),
FIG. 28 (SEQ ID NO:28), FIG. 30 (SEQ ID NO:30), FIG. 32 (SEQ ID
NO:32), FIG. 34 (SEQ ID NO:34), FIG. 36 (SEQ ID NO:36), FIG. 38
(SEQ ID NO:38), FIG. 40 (SEQ ID NO:40), FIG. 42 (SEQ ID NO:42),
FIG. 44 (SEQ ID NO:44), FIG. 46 (SEQ ID NO:46), FIG. 48 (SEQ ID
NO:48), FIG. 50 (SEQ ID NO:50), FIG. 52 (SEQ ID NO:52), FIG. 54
(SEQ ID NO:54), FIG. 56 (SEQ ID NO:56), FIG. 58 (SEQ ID NO:58),
FIG. 60 (SEQ ID NO:60), FIG. 62 (SEQ ID NO:62), FIG. 64 (SEQ ID
NO:64), FIG. 66 (SEQ ID NO:66), FIG. 68 (SEQ ID NO:68), FIG. 70
(SEQ ID NO:70), FIG. 72 (SEQ ID NO:72), FIG. 74 (SEQ ID NO:74),
FIG. 76 (SEQ ID NO:76), FIG. 78 (SEQ ID NO:78), FIG. 80 (SEQ ID
NO:80), FIG. 82 (SEQ ID NO:82), FIG. 84 (SEQ ID NO:84), FIG. 86
(SEQ ID NO:86), FIG. 88 (SEQ ID NO:88), FIG. 90 (SEQ ID NO:90),
FIG. 92 (SEQ ID NO:92), FIG. 94 (SEQ ID NO:94), FIG. 96 (SEQ ID
NO:96), FIG. 98 (SEQ ID NO:98), FIG. 100 (SEQ ID NO: 100), FIG. 102
(SEQ ID NO: 102), FIG. 104 (SEQ ID NO: 104), FIG. 106 (SEQ ID
NO:106), FIG. 108 (SEQ ID NO:108), FIG. 110 (SEQ ID NO:110), FIG.
112 (SEQ ID NO: 112), FIG. 114 (SEQ ID NO: 114), FIG. 116 (SEQ ID
NO: 116), FIG. 118 (SEQ ID NO: 118), FIG. 120 (SEQ ID NO:120), FIG.
122 (SEQ ID NO:122), FIG. 124 (SEQ ID NO:124), FIG. 126 (SEQ ID
NO:126), FIG. 128 (SEQ ID NO:128), FIG. 130 (SEQ ID NO:130), FIG.
132 (SEQ ID NO:132), FIG. 134 (SEQ ID NO:134), FIG. 136 (SEQ ID
NO:136), FIG. 138 (SEQ ID NO:138), FIG. 140 (SEQ ID NO: 140), FIG.
142 (SEQ ID NO: 142), FIG. 144 (SEQ ID NO: 144), FIG. 146 (SEQ ID
NO: 146), FIG. 148 (SEQ ID NO:148), FIG. 150 (SEQ ID NO:150), FIG.
152 (SEQ ID NO:152), FIG. 154 (SEQ ID NO: 154), FIG. 156 (SEQ ID
NO: 156), FIG. 158 (SEQ ID NO: 158), FIG. 160 (SEQ ID NO: 160),
FIG. 162 (SEQ ID NO: 162), FIG. 164 (SEQ ID NO:164), FIG. 166 (SEQ
ID NO:166), FIG. 168 (SEQ ID NO:168), FIG. 170 (SEQ ID NO:170),
FIG. 172 (SEQ ID NO: 172), FIG. 174 (SEQ ID NO:174), FIG. 176 (SEQ
ID NO:176), FIG. 178 (SEQ ID NO: 178), FIG. 180 (SEQ ID NO:180),
FIG. 182 (SEQ ID NO:182), FIG. 184 (SEQ ID NO:184), FIG. 186 (SEQ
ID NO:186), FIG. 188 (SEQ ID NO:188), FIG. 190 (SEQ ID NO: 190),
FIG. 192 (SEQ ID NO:192), FIG. 194 (SEQ ID NO: 194), FIG. 196 (SEQ
ID NO: 196), FIG. 198 (SEQ ID NO: 198), FIG. 200 (SEQ ID NO:200),
FIG. 202 (SEQ ID NO:202), FIG. 204 (SEQ ID NO:204), FIG. 206 (SEQ
ID NO:206), FIG. 208 (SEQ ID NO:208), FIG. 210 (SEQ ID NO:210),
FIG. 212 (SEQ ID NO:212), FIG. 214 (SEQ ID NO:214), FIG. 216 (SEQ
ID NO:216), FIG. 218 (SEQ ID NO:218), FIG. 220 (SEQ ID NO:220),
FIG. 222 (SEQ ID NO:222), FIG. 224 (SEQ ID NO:224), FIG. 226 (SEQ
ID NO:226), FIG. 228 (SEQ ID NO:228), FIG. 230 (SEQ ID NO:230),
FIG. 232 (SEQ ID NO:232), FIG. 234 (SEQ ID NO:234), FIG. 236 (SEQ
ID NO:236), FIG. 238 (SEQ ID NO:238), FIG. 240 (SEQ ID NO:240),
FIG. 242 (SEQ ID NO:242), FIG. 244 (SEQ ID NO:244), FIG. 246 (SEQ
ID NO:246), FIG. 248 (SEQ ID NO:248), FIG. 250 (SEQ ID NO:250),
FIG. 252 (SEQ ID NO:252), FIG. 254 (SEQ ID NO:254), FIG. 256 (SEQ
ID NO:256), FIG. 258 (SEQ ID NO:258), FIG. 260 (SEQ ID NO:260),
FIG. 262 (SEQ ID NO:262), FIG. 264 (SEQ ID NO:264), FIG. 266 (SEQ
ID NO:266), FIG. 268 (SEQ ID NO:268), FIG. 270 (SEQ ID NO:270),
FIG. 272 (SEQ ID NO:272), FIG. 274 (SEQ ID NO:274), FIG.
276 (SEQ ID NO:276), FIG. 278 (SEQ ID NO:278), FIG. 280 (SEQ ID
NO:280), FIG. 282 (SEQ ID NO:282), FIG. 284 (SEQ ID NO:284), FIG.
286 (SEQ ID NO:286), FIG. 288 (SEQ ID NO:288), FIG. 290 (SEQ ID
NO:290), FIG. 292 (SEQ ID NO:292), FIG. 294 (SEQ ID NO:294), FIG.
296 (SEQ ID NO:296), FIG. 298 (SEQ ID NO:298), FIG. 300 (SEQ ID
NO:300), FIG. 302 (SEQ ID NO:302), FIG. 304 (SEQ ID NO:304), FIG.
306 (SEQ ID NO:306), FIG. 308 (SEQ ID NO:308), FIG. 310 (SEQ ID
NO:310), FIG. 312 (SEQ ID NO:312), FIG. 314 (SEQ ID NO:314), FIG.
316 (SEQ ID NO:316), FIG. 318 (SEQ ID NO:318), FIG. 320 (SEQ ID
NO:320), FIG. 322 (SEQ ID NO:322), FIG. 324 (SEQ ID NO:324), FIG.
326 (SEQ ID NO:326), FIG. 328 (SEQ ID NO:328), FIG. 330 (SEQ ID
NO:330), FIG. 332 (SEQ ID NO:332), FIG. 334 (SEQ ID NO:334), FIG.
336 (SEQ ID NO:336), FIG. 338 (SEQ ID NO:338), FIG. 340 (SEQ ID
NO:340), FIG. 342 (SEQ ID NO:342), FIG. 344 (SEQ ID NO:344), FIG.
346 (SEQ ID NO:346), FIG. 348 (SEQ ID NO:348), FIG. 350 (SEQ ID
NO:350), FIG. 352 (SEQ ID NO:352), FIG. 354 (SEQ ID NO:354), FIG.
356 (SEQ ID NO:356), FIG. 358 (SEQ ID NO:358), FIG. 360 (SEQ ID
NO:360), FIG. 362 (SEQ ID NO:362), FIG. 364 (SEQ ID NO:364), FIG.
366 (SEQ ID NO:366), FIG. 368 (SEQ ID NO:368), FIG. 370 (SEQ ID
NO:370), FIG. 372 (SEQ ID NO:372), FIG. 374 (SEQ ID NO:374), FIG.
376 (SEQ ID NO:376), FIG. 378 (SEQ ID NO:378), FIG. 380 (SEQ ID
NO:380), FIG. 382 (SEQ ID NO:382), FIG. 384 (SEQ ID NO:384), FIG.
386 (SEQ ID NO:386), FIG. 388 (SEQ ID NO:388), FIG. 390 (SEQ ID
NO:390), FIG. 392 (SEQ ID NO:392), FIG. 394 (SEQ ID NO:394), FIG.
396 (SEQ ID NO:396), FIG. 398 (SEQ ID NO:398), FIG. 400 (SEQ ID
NO:400), FIG. 402 (SEQ ID NO:402), FIG. 404 (SEQ ID NO:404), FIG.
406 (SEQ ID NO:406), FIG. 408 (SEQ ID NO:408), FIG. 410 (SEQ ID
NO:410), FIG. 412 (SEQ ID NO:412), FIG. 414 (SEQ ID NO:414), FIG.
416 (SEQ ID NO:416), FIG. 418 (SEQ ID NO:418), FIG. 420 (SEQ ID
NO:420), FIG. 422 (SEQ ID NO:422), FIG. 424 (SEQ ID NO:424), FIG.
426 (SEQ ID NO:426), FIG. 428 (SEQ ID NO:428), FIG. 430 (SEQ ID
NO:430), FIG. 432 (SEQ ID NO:432), FIG. 434 (SEQ ID NO:434), FIG.
436 (SEQ ID NO:436), FIG. 438 (SEQ ID NO:438), FIG. 440 (SEQ ID
NO:440), FIG. 442 (SEQ ID NO:442), FIG. 444 (SEQ ID NO:444), FIG.
446 (SEQ ID NO:446), FIG. 448 (SEQ ID NO:448), FIG. 450 (SEQ ID
NO:450), FIG. 452 (SEQ ID NO:452), FIG. 454 (SEQ ID NO:454), FIG.
456 (SEQ ID NO:456), FIG. 458 (SEQ ID NO:458), FIG. 460 (SEQ ID
NO:460), FIG. 462 (SEQ ID NO:462), FIG. 464 (SEQ ID NO:464), FIG.
466 (SEQ ID NO:466), FIG. 468 (SEQ ID NO:468), FIG. 470 (SEQ ID
NO:470), FIG. 472 (SEQ ID NO:472), FIG. 474 (SEQ ID NO:474), FIG.
476 (SEQ ID NO:476), FIG. 478 (SEQ ID NO:478), FIG. 480 (SEQ ID
NO:480), FIG. 482 (SEQ ID NO:482), FIG. 484 (SEQ ID NO:484), FIG.
486 (SEQ ID NO:486), FIG. 488 (SEQ ID NO:488), FIG. 490 (SEQ ID
NO:490), FIG. 492 (SEQ ID NO:492), FIG. 494 (SEQ ID NO:494), FIG.
496 (SEQ ID NO:496), FIG. 498 (SEQ ID NO:498), FIG. 500 (SEQ ID
NO:500), FIG. 502 (SEQ ID NO:502), FIG. 504 (SEQ ID NO:504), FIG.
506 (SEQ ID NO:506), FIG. 508 (SEQ ID NO:508), FIG. 510 (SEQ ID
NO:510), FIG. 512 (SEQ ID NO:512), FIG. 514 (SEQ ID NO:514), FIG.
516 (SEQ ID NO:516), FIG. 518 (SEQ ID NO:518), FIG. 520 (SEQ ID
NO:520), FIG. 522 (SEQ ID NO:522), FIG. 524 (SEQ ID NO:524), FIG.
526 (SEQ ID NO:526), FIG. 528 (SEQ ID NO:528), FIG. 530 (SEQ ID
NO:530), FIG. 532 (SEQ ID NO:532), FIG. 534 (SEQ ID NO:534), FIG.
536 (SEQ ID NO:536), FIG. 538 (SEQ ID NO:538), FIG. 540 (SEQ ID
NO:540), FIG. 542 (SEQ ID NO:542), FIG. 544 (SEQ ID NO:544), FIG.
546 (SEQ ID NO:546), FIG. 548 (SEQ ID NO:548) or FIG. 550 (SEQ ID
NO:550), lacking its associated signal peptide.
21. A method of detecting aPRO1801 polypeptide in a sample
suspected of containing a PRO1801 polypeptide, said method
comprising contacting said sample with a PRO1114 or PRO4978
polypeptide and determining the formation of aPRO1801/PRO1114 or
PRO1801/PRO4978 polypeptide conjugate in said sample, wherein the
formation of said conjugate is indicative of the presence of a
PRO1801 polypeptide in said sample.
22. The method according to claim 21, wherein said sample comprises
cells suspected of expressing said PRO1801 polypeptide.
23. The method according to claim 21, wherein said PRO1114 or
PRO4978 polypeptide is labeled with a detectable label.
24. The method according to claim 21, wherein said PRO1114 or
PRO4978 polypeptide is attached to a solid support.
25. A method of detecting a PRO1114 or PRO4978 polypeptide in a
sample suspected of containing a PRO1114 or PRO4978 polypeptide,
said method comprising contacting said sample with a PRO1801
polypeptide and determining the formation of a PRO1801/PRO1114 or
PRO1801/PRO4978 polypeptide conjugate in said sample, wherein the
formation of said conjugate is indicative of the presence of a
PRO1114 or PRO4978 polypeptide in said sample.
26. The method according to claim 25, wherein said sample comprises
cells suspected of expressing said PRO1114 or PRO4978
polypeptide.
27. The method according to claim 25, wherein said PRO1801
polypeptide is labeled with a detectable label.
28. The method according to claim 25, wherein said PRO1801
polypeptide is attached to a solid support.
29. A method of linking a bioactive molecule to a cell expressing a
PRO1801 polypeptide, said method comprising contacting said cell
with aPRO1114 or PRO4978 polypeptide that is bound to said
bioactive molecule and allowing said PRO1801 and said PRO1114 or
PRO4978 polypeptides to bind to one another, thereby linking said
bioactive molecules to said cell.
30. The method according to claim 29, wherein said bioactive
molecule is a toxin, a radiolabel or an antibody.
31. The method according to claim 29, wherein said bioactive
molecule causes the death of said cell.
32. A method of linking a bioactive molecule to a cell expressing a
PRO1114 or PRO4978 polypeptide, said method comprising contacting
said cell with a PRO1801 polypeptide that is bound to said
bioactive molecule and allowing said PRO1801 and said PRO1114 or
PRO4978 polypeptides to bind to one another, thereby linking said
bioactive molecules to said cell.
33. The method according to claim 32, wherein said bioactive
molecule is a toxin, a radiolabel or an antibody.
34. The method according to claim 32, wherein said bioactive
molecule causes the death of said cell.
35. A method of modulating at least one biological activity of a
cell expressing a PRO1801 polypeptide, said method comprising
contacting said cell with a PRO1114 or PRO4978 polypeptide or an
anti-PRO1801 polypeptide antibody, whereby said PRO1114 or PRO4978
polypeptide or anti-PRO1801 polypeptide antibody binds to said
PRO1801 polypeptide, thereby modulating at least one biological
activity of said cell.
36. The method according to claim 35, wherein said cell is
killed.
37. A method of modulating at least one biological activity of a
cell expressing a PRO1114 or PRO4978 polypeptide, said method
comprising contacting said cell with a PRO1801 polypeptide or an
anti-PRO1114 or anti-PRO4978 polypeptide antibody, whereby said
PRO1801 polypeptide or anti-PRO1114 or anti-PRO4978 polypeptide
antibody binds to said PRO1114 or PRO4978 polypeptide, there by
modulating at least one biological activity of said cell.
38. The method according to claim 37, wherein said cell is
killed.
39. A method of detecting aPRO1114polypeptide in a sample suspected
of containing aPRO1114 polypeptide, said method comprising
contacting said sample with a PRO100 polypeptide and determining
the formation of a PRO100/PRO1114 polypeptide conjugate in said
sample, wherein the formation of said conjugate is indicative of
the presence of a PRO1114 polypeptide in said sample.
40. The method according to claim 39, wherein said sample comprises
cells suspected of expressing said PRO1114 polypeptide.
41. The method according to claim 39, wherein said PRO100
polypeptide is labeled with a detectable label.
42. The method according to claim 39, wherein said PRO100
polypeptide is attached to a solid support.
43. A method of detecting a PRO100 polypeptide in a sample
suspected of containing a PRO100 polypeptide, said method
comprising contacting said sample with a PRO1114 polypeptide and
determining the formation of a PRO100/PRO1114 polypeptide conjugate
in said sample, wherein the formation of said conjugate is
indicative of the presence of a PRO100 polypeptide in said
sample.
44. The method according to claim 43, wherein said sample comprises
cells suspected of expressing said PRO100 polypeptide.
45. The method according to claim 43, wherein said PRO1114
polypeptide is labeled with a detectable label.
46. The method according to claim 43, wherein said PRO1114
polypeptide is attached to a solid support.
47. A method of linking a bioactive molecule to a cell expressing a
PRO100 polypeptide, said method comprising contacting said cell
with a PRO1114 polypeptide that is bound to said bioactive molecule
and allowing said PRO100 and said PRO1114 polypeptides to bind to
one another, thereby linking said bioactive molecules to said
cell.
48. The method according to claim 47, wherein said bioactive
molecule is a toxin, a radiolabel or an antibody.
49. The method according to claim 47, wherein said bioactive
molecule causes the death of said cell.
50. A method of linking a bioactive molecule to a cell expressing a
PRO1114 polypeptide, said method comprising contacting said cell
with a PRO100 polypeptide that is bound to said bioactive molecule
and allowing said PRO100 and said PRO1114 polypeptides to bind to
one another, thereby linking said bioactive molecules to said
cell.
51. The method according to claim 50, wherein said bioactive
molecule is a toxin, a radiolabel or an antibody.
52. The method according to claim 50, wherein said bioactive
molecule causes the death of said cell.
53. A method of modulating at least one biological activity of a
cell expressing a PRO100 polypeptide, said method comprising
contacting said cell with a PRO1114 polypeptide or an anti-PRO100
polypeptide antibody, whereby said PRO1114 polypeptide or
anti-PRO100 polypeptide antibody binds to said PRO100 polypeptide,
thereby modulating at least one biological activity of said
cell.
54. The method according to claim 53, wherein said cell is
killed.
55. A method of modulating at least one biological activity of a
cell expressing a PRO1114 polypeptide, said method comprising
contacting said cell with a PRO100 polypeptide or an anti-PRO1114
polypeptide antibody, whereby said PRO100 polypeptide or
anti-PRO1114 polypeptide antibody binds to said PRO1114
polypeptide, thereby modulating at least one biological activity of
said cell.
56. The method according to claim 55, wherein said cell is
killed.
57. A method for stimulating the release of TNF-.alpha. from human
blood, said method comprising contacting said blood with a PRO195,
PRO202, PRO215, PRO221, PRO217, PRO222, PRO198, PRO245, PRO172,
PRO265, PRO266, PRO344, PRO337, PRO322, PRO1286, PRO1279, PRO1338
or PRO1343 polypeptide, wherein the release of TNF-.alpha. from
said blood is stimulated.
58. A method for modulating the uptake of glucose or FFA by
skeletal muscle cells, said method comprising contacting said cells
with a PRO182, PRO366, PRO198, PRO172 or PRO719 polypeptide,
wherein the uptake of glucose or FFA by said cells is
modulated.
59. A method for stimulating the proliferation or differentiation
of chondrocyte cells, said method comprising contacting said cells
with a PRO182, PRO366, PRO198, PRO1868, PRO202, PRO224, PRO172,
PRO301 or PRO1312 polypeptide, wherein the proliferation or
differentiation of said cells is stimulated.
60. A method for modulating the uptake of glucose or FFA by
adipocyte cells, said method comprising contacting said cells with
a PRO202, PRO211, PRO344 or PRO1338 polypeptide, wherein the uptake
of glucose or FFA by said cells is modulated.
61. A method for stimulating the proliferation of or gene
expression in pericyte cells, said method comprising contacting
said cells with a PRO366 polypeptide, wherein the proliferation of
or gene expression in said cells is stimulated.
62. A method for stimulating the release of proteoglycans from
cartilage, said method comprising contacting said cartilage with a
PRO216 polypeptide, wherein the release of proteoglycans from said
cartilage is stimulated.
63. A method for stimulating the proliferation of inner ear
utricular supporting cells, said method comprising contacting said
cells with a PRO172 polypeptide, wherein the proliferation of said
cells is stimulated.
64. A method for stimulating the proliferation of T-lymphocyte
cells, said method comprising contacting said cells with a PRO344
polypeptide, wherein the proliferation of said cells is
stimulated.
65. A method for stimulating the release of a cytokine from PBMC
cells, said method comprising contacting said cells with a PRO526
or PRO1343 polypeptide, wherein the release of a cytokine from said
cells is stimulated.
66. A method for inhibiting the binding of A-peptide to factor
VIIA, said method comprising contacting a composition comprising
said A-peptide and said factor VIIA with a PRO182 polypeptide,
wherein the binding of said A-peptide to said factor VIIA is
inhibited.
67. A method for inhibiting the differentiation of adipocyte cells,
said method comprising contacting said cells with a PRO185 or
PRO198 polypeptide, wherein the differentiation of said cells is
inhibited.
68. A method for stimulating the proliferation of endothelial
cells, said method comprising contacting said cells with a PRO222
polypeptide, wherein the proliferation of said cells is
inhibited.
69. A method for detecting the presence of tumor in an mammal, said
method comprising comparing the level of expression of any PRO
polypeptide shown in Table 8 in (a) a test sample of cells taken
from said mammal and (b) a control sample of normal cells of the
same cell type, wherein a higher level of expression of said PRO
polypeptide in the test sample as compared to the control sample is
indicative of the presence of tumor in said mammal.
70. The method of claim 69, wherein said tumor is lung tumor, colon
tumor, breast tumor, prostate tumor, rectal tumor, cervical tumor
or liver tumor.
71. An oligonucleotide probe derived from any of the nucleotide
sequences shown in the accompanying figures.
Description
FIELD OF THE INVENTION
[0001] The present invention relates generally to the
identification and isolation of novel DNA and to the recombinant
production of novel polypeptides.
BACKGROUND OF THE INVENTION
[0002] Extracellular proteins play important roles in, among other
things, the formation, differentiation and maintenance of
multicellular organisms. The fate of many individual cells, e.g.,
proliferation, migration, differentiation, or interaction with
other cells, is typically governed by information received from
other cells and/or the immediate environment. This information is
often transmitted by secreted polypeptides (for instance, mitogenic
factors, survival factors, cytotoxic factors, differentiation
factors, neuropeptides, and hormones) which are, in turn, received
and interpreted by diverse cell receptors or membrane-bound
proteins. These secreted polypeptides or signaling molecules
normally pass through the cellular secretory pathway to reach their
site of action in the extracellular environment.
[0003] Secreted proteins have various industrial applications,
including as pharmaceuticals, diagnostics, biosensors and
bioreactors. Most protein drugs available at present, such as
thrombolytic agents, interferons, interleukins, erythropoietins,
colony stimulating factors, and various other cytokines, are
secretory proteins. Their receptors, which are membrane proteins,
also have potential as therapeutic or diagnostic agents. Efforts
are being undertaken by both industry and academia to identify new,
native secreted proteins. Many efforts are focused on the screening
of mammalian recombinant DNA libraries to identify the coding
sequences for novel secreted proteins. Examples of screening
methods and techniques are described in the literature [see, for
example, Klein et al., Proc. Natl. Acad. Sci. 93:7108-7113 (1996);
U.S. Pat. No. 5,536,637)].
[0004] Membrane-bound proteins and receptors can play important
roles in, among other things, the formation, differentiation and
maintenance of multicellular organisms. The fate of many individual
cells, e.g., proliferation, migration, differentiation, or
interaction with other cells, is typically governed by information
received from other cells and/or the immediate environment. This
information is often transmitted by secreted polypeptides (for
instance, mitogenic factors, survival factors, cytotoxic factors,
differentiation factors, neuropeptides, and hormones) which are, in
turn, received and interpreted by diverse cell receptors or
membrane-bound proteins. Such membrane-bound proteins and cell
receptors include, but are not limited to, cytokine receptors,
receptor kinases, receptor phosphatases, receptors involved in
cell-cell interactions, and cellular adhesin molecules like
selectins and integrins. For instance, transduction of signals that
regulate cell growth and differentiation is regulated in part by
phosphorylation of various cellular proteins. Protein tyrosine
kinases, enzymes that catalyze that process, can also act as growth
factor receptors. Examples include fibroblast growth factor
receptor and nerve growth factor receptor.
[0005] Membrane-bound proteins and receptor molecules have various
industrial applications, including as pharmaceutical and diagnostic
agents. Receptor immunoadhesins, for instance, can be employed as
therapeutic agents to block receptor-ligand interactions. The
membrane-bound proteins can also be employed for screening of
potential peptide or small molecule inhibitors of the relevant
receptor/ligand interaction.
[0006] Efforts are being undertaken by both industry and academia
to identify new, native receptor or membrane-bound proteins. Many
efforts are focused on the screening of mammalian recombinant DNA
libraries to identify the coding sequences for novel receptor or
membrane-bound proteins.
SUMMARY OF THE INVENTION
[0007] In one embodiment, the invention provides an isolated
nucleic acid molecule comprising a nucleotide sequence that encodes
a PRO polypeptide.
[0008] In one aspect, the isolated nucleic acid molecule comprises
a nucleotide sequence having at least about 80% nucleic acid
sequence identity, alternatively at least about 81% nucleic acid
sequence identity, alternatively at least about 82% nucleic acid
sequence identity, alternatively at least about 83% nucleic acid
sequence identity, alternatively at least about 84% nucleic acid
sequence identity, alternatively at least about 85% nucleic acid
sequence identity, alternatively at least about 86% nucleic acid
sequence identity, alternatively at least about 87% nucleic acid
sequence identity, alternatively at least about 88% nucleic acid
sequence identity, alternatively at least about 89% nucleic acid
sequence identity, alternatively at least about 90% nucleic acid
sequence identity, alternatively at least about 91% nucleic acid
sequence identity, alternatively at least about 92% nucleic acid
sequence identity, alternatively at least about 93% nucleic acid
sequence identity, alternatively at least about 94% nucleic acid
sequence identity, alternatively at least about 95% nucleic acid
sequence identity, alternatively at least about 96% nucleic acid
sequence identity, alternatively at least about 97% nucleic acid
sequence identity, alternatively at least about 98% nucleic acid
sequence identity and alternatively at least about 99% nucleic acid
sequence identity to (a) a DNA molecule encoding a PRO polypeptide
having a full-length amino acid sequence as disclosed herein, an
amino acid sequence lacking the signal peptide as disclosed herein,
an extracellular domain of a transmembrane protein, with or without
the signal peptide, as disclosed herein or any other specifically
defined fragment of the full-length amino acid sequence as
disclosed herein, or (b) the complement of the DNA molecule of
(a).
[0009] In other aspects, the isolated nucleic acid molecule
comprises a nucleotide sequence having at least about 80% nucleic
acid sequence identity, alternatively at least about 81% nucleic
acid sequence identity, alternatively at least about 82% nucleic
acid sequence identity, alternatively at least about 83% nucleic
acid sequence identity, alternatively at least about 84% nucleic
acid sequence identity, alternatively at least about 85% nucleic
acid sequence identity, alternatively at least about 86% nucleic
acid sequence identity, alternatively at least about 87% nucleic
acid sequence identity, alternatively at least about 88% nucleic
acid sequence identity, alternatively at least about 89% nucleic
acid sequence identity, alternatively at least about 90% nucleic
acid sequence identity, alternatively at least about 91% nucleic
acid sequence identity, alternatively at least about 92% nucleic
acid sequence identity, alternatively at least about 93% nucleic
acid sequence identity, alternatively at least about 94% nucleic
acid sequence identity, alternatively at least about 95% nucleic
acid sequence identity, alternatively at least about 96% nucleic
acid sequence identity, alternatively at least about 97% nucleic
acid sequence identity, alternatively at least about 98% nucleic
acid sequence identity and alternatively at least about 99% nucleic
acid sequence identity to (a) aDNA molecule comprising the coding
sequence of a full-length PRO polypeptide cDNA as disclosed herein,
the coding sequence of a PRO polypeptide lacking the signal peptide
as disclosed herein, the coding sequence of an extracellular domain
of a transmembrane PRO polypeptide, with or without the signal
peptide, as disclosed herein or the coding sequence of any other
specifically defined fragment of the full-length amino acid
sequence as disclosed herein, or (b) the complement of the DNA
molecule of (a).
[0010] In a further aspect, the invention concerns an isolated
nucleic acid molecule comprising a nucleotide sequence having at
least about 80% nucleic acid sequence identity, alternatively at
least about 81% nucleic acid sequence identity, alternatively at
least about 82% nucleic acid sequence identity, alternatively at
least about 83% nucleic acid sequence identity, alternatively at
least about 84% nucleic acid sequence identity, alternatively at
least about 85% nucleic acid sequence identity, alternatively at
least about 86% nucleic acid sequence identity, alternatively at
least about 87% nucleic acid sequence identity, alternatively at
least about 88% nucleic acid sequence identity, alternatively at
least about 89% nucleic acid sequence identity, alternatively at
least about 90% nucleic acid sequence identity, alternatively at
least about 91% nucleic acid sequence identity, alternatively at
least about 92% nucleic acid sequence identity, alternatively at
least about 93% nucleic acid sequence identity, alternatively at
least about 94% nucleic acid sequence identity, alternatively at
least about 95% nucleic acid sequence identity, alternatively at
least about 96% nucleic acid sequence identity, alternatively at
least about 97% nucleic acid sequence identity, alternatively at
least about 98% nucleic acid sequence identity and alternatively at
least about 99% nucleic acid sequence identity to (a) a DNA
molecule that encodes the same mature polypeptide encoded by any of
the human protein cDNAs deposited with the ATCC as disclosed
herein, or (b) the complement of the DNA molecule of (a).
[0011] Another aspect the invention provides an isolated nucleic
acid molecule comprising a nucleotide sequence encoding a PRO
polypeptide which is either transmembrane domain-deleted or
transmembrane domain-inactivated, or is complementary to such
encoding nucleotide sequence, wherein the transmembrane domain(s)
of such polypeptide are disclosed herein. Therefore, soluble
extracellular domains of the herein described PRO polypeptides are
contemplated.
[0012] Another embodiment is directed to fragments of a PRO
polypeptide coding sequence, or the complement thereof, that may
find use as, for example, hybridization probes, for encoding
fragments of a PRO polypeptide that may optionally encode a
polypeptide comprising a binding site for an anti-PRO antibody or
as antisense oligonucleotide probes. Such nucleic acid fragments
are usually at least about 10 nucleotides in length, alternatively
at least about 15 nucleotides in length, alternatively at least
about 20 nucleotides in length, alternatively at least about 30
nucleotides in length, alternatively at least about 40 nucleotides
in length, alternatively at least about 50 nucleotides in length,
alternatively at least about 60 nucleotides in length,
alternatively at least about 70 nucleotides in length,
alternatively at least about 80 nucleotides in length,
alternatively at least about 90 nucleotides in length,
alternatively at least about 100 nucleotides in length,
alternatively at least about 110 nucleotides in length,
alternatively at least about 120 nucleotides in length,
alternatively at least about 130 nucleotides in length,
alternatively at least about 140 nucleotides in length,
alternatively at least about 150 nucleotides in length,
alternatively at least about 160 nucleotides in length,
alternatively at least about 170 nucleotides in length,
alternatively at least about 180 nucleotides in length,
alternatively at least about 190 nucleotides in length,
alternatively at least about 200 nucleotides in length,
alternatively at least about 250 nucleotides in length,
alternatively at least about 300 nucleotides in length,
alternatively at least about 350 nucleotides in length,
alternatively at least about 400 nucleotides in length,
alternatively at least about 450 nucleotides in length,
alternatively at least about 500 nucleotides in length,
alternatively at least about 600 nucleotides in length,
alternatively at least about 700 nucleotides in length,
alternatively at least about 800 nucleotides in length,
alternatively at least about 900 nucleotides in length and
alternatively at least about 1000 nucleotides in length, wherein in
this context the term "about" means the referenced nucleotide
sequence length plus or minus 10% of that referenced length. It is
noted that novel fragments of a PRO polypeptide-encoding nucleotide
sequence may be determined in a routine manner by aligning the PRO
polypeptide-encoding nucleotide sequence with other known
nucleotide sequences using any of a number of well known sequence
alignment programs and determining which PRO polypeptide-encoding
nucleotide sequence fragment(s) are novel. All of such PRO
polypeptide-encoding nucleotide sequences are contemplated herein.
Also contemplated are the PRO polypeptide fragments encoded by
these nucleotide molecule fragments, preferably those PRO
polypeptide fragments that comprise a binding site for an anti-PRO
antibody.
[0013] In another embodiment, the invention provides isolated PRO
polypeptide encoded by any of the isolated nucleic acid sequences
hereinabove identified.
[0014] In a certain aspect, the invention concerns an isolated PRO
polypeptide, comprising an amino acid sequence having at least
about 80% amino acid sequence identity, alternatively at least
about 81% amino acid sequence identity, alternatively at least
about 82% amino acid sequence identity, alternatively at least
about 83% amino acid sequence identity, alternatively at least
about 84% amino acid sequence identity, alternatively at least
about 85% amino acid sequence identity, alternatively at least
about 86% amino acid sequence identity, alternatively at least
about 87% amino acid sequence identity, alternatively at least
about 88% amino acid sequence identity, alternatively at least
about 89% amino acid sequence identity, alternatively at least
about 90% amino acid sequence identity, alternatively at least
about 91% amino acid sequence identity, alternatively at least
about 92% amino acid sequence identity, alternatively at least
about 93% amino acid sequence identity, alternatively at least
about 94% amino acid sequence identity, alternatively at least
about 95% amino acid sequence identity, alternatively at least
about 96% amino acid sequence identity, alternatively at least
about 97% amino acid sequence identity, alternatively at least
about 98% amino acid sequence identity and alternatively at least
about 99% amino acid sequence identity to a PRO polypeptide having
a full-length amino acid sequence as disclosed herein, an amino
acid sequence lacking the signal peptide as disclosed herein, an
extracellular domain of a transmembrane protein, with or without
the signal peptide, as disclosed herein or any other specifically
defined fragment of the full-length amino acid sequence as
disclosed herein.
[0015] In a further aspect, the invention concerns an isolated PRO
polypeptide comprising an amino acid sequence having at least about
80% amino acid sequence identity, alternatively at least about 81%
amino acid sequence identity, alternatively at least about 82%
amino acid sequence identity, alternatively at least about 83%
amino acid sequence identity, alternatively at least about 84%
amino acid sequence identity, alternatively at least about 85%
amino acid sequence identity, alternatively at least about 86%
amino acid sequence identity, alternatively at least about 87%
amino acid sequence identity, alternatively at least about 88%
amino acid sequence identity, alternatively at least about 89%
amino acid sequence identity, alternatively at least about 90%
amino acid sequence identity, alternatively at least about 91% a
mino acid sequence identity, alternatively at least about 92% amino
acid sequence identity, alternatively at least about 93% amino acid
sequence identity, alternatively at least about 94% amino acid
sequence identity, alternatively at least about 95% amino acid
sequence identity, alternatively at least about 96% amino acid
sequence identity, alternatively at least about 97% amino acid
sequence identity, alternatively at least about 9 8% a mino acid
sequence identity and alternatively at least about 99% amino acid
sequence identity to an amino acid sequence encoded by any of the
human protein cDNAs deposited with the ATCC as disclosed
herein.
[0016] In a specific aspect, the invention provides an isolated PRO
polypeptide without the N-terminal signal sequence and/or the
initiating methionine and is encoded by a nucleotide sequence that
encodes such an amino acid sequence as hereinbefore described.
Processes for producing the same are also herein described, wherein
those processes comprise culturing a host cell comprising a vector
which comprises the appropriate encoding nucleic acid molecule
under conditions suitable for expression of the PRO polypeptide and
recovering the PRO polypeptide from the cell culture.
[0017] Another aspect the invention provides an isolated PRO
polypeptide which is either transmembrane domain-deleted or
transmembrane domain-inactivated. Processes for producing the same
are also herein described, wherein those processes comprise
culturing a host cell comprising a vector which comprises the
appropriate encoding nucleic acid molecule under conditions
suitable for expression of the PRO polypeptide and recovering the
PRO polypeptide from the cell culture.
[0018] In yet another embodiment, the invention concerns agonists
and antagonists of a native PRO polypeptide as defined herein. In a
particular embodiment, the agonist or antagonist is an anti-PRO
antibody or a small molecule.
[0019] In a further embodiment, the invention concerns a method of
identifying agonists or antagonists to a PRO polypeptide which
comprise contacting the PRO polypeptide with a candidate molecule
and monitoring a biological activity mediated by said PRO
polypeptide. Preferably, the PRO polypeptide is a native PRO
polypeptide.
[0020] In a still further embodiment, the invention concerns a
composition of matter comprising a PRO polypeptide, or an agonist
or antagonist of a PRO polypeptide as herein described, or an
anti-PRO antibody, in combination with a carrier. Optionally, the
carrier is a pharmaceutically acceptable carrier.
[0021] Another embodiment of the present invention is directed to
the use of a PRO polypeptide, or an agonist or antagonist thereof
as hereinbefore described, or an anti-PRO antibody, for the
preparation of a medicament useful in the treatment of a condition
which is responsive to the PRO polypeptide, an agonist or
antagonist thereof or an anti-PRO antibody.
[0022] In other embodiments of the present invention, the invention
provides vectors comprising DNA encoding any of the herein
described polypeptides. Host cell comprising any such vector are
also provided. By way of example, the host cells may be CHO cells,
E. coli, or yeast. A process for producing any of the herein
described polypeptides is further provided and comprises culturing
host cells under conditions suitable for expression of the desired
polypeptide and recovering the desired polypeptide from the cell
culture.
[0023] In other embodiments, the invention provides chimeric
molecules comprising any of the herein described polypeptides fused
to a heterologous polypeptide or amino acid sequence. Example of
such chimeric molecules comprise any of the herein described
polypeptides fused to an epitope tag sequence or a Fc region of an
immunoglobulin.
[0024] In another embodiment, the invention provides an antibody
which binds, preferably specifically, to any of the above or below
described polypeptides. Optionally, the antibody is a monoclonal
antibody, humanized antibody, antibody fragment or single-chain
antibody.
[0025] In yet other embodiments, the invention provides
oligonucleotide probes which may be useful for isolating genomic
and cDNA nucleotide sequences, measuring or detecting expression of
an associated gene or as antisense probes, wherein those probes may
be derived from any of the above or below described nucleotide
sequences. Preferred probe lengths are described above.
[0026] In yet other embodiments, the present invention is directed
to methods of using the PRO polypeptides of the present invention
for a variety of uses based upon the functional biological assay
data presented in the Examples below.
BRIEF DESCRIPTION OF THE DRAWINGS
[0027] FIG. 1 shows a nucleotide sequence (SEQ ID NO: 1) of a
native sequence PRO177 cDNA, wherein SEQ ID NO:1 is a clone
designated herein as "DNA16438-1387".
[0028] FIG. 2 shows the amino acid sequence (SEQ ID NO:2) derived
from the coding sequence of SEQ ID NO: 1 shown in FIG. 1.
[0029] FIG. 3 shows a nucleotide sequence (SEQ ID NO:3) of a native
sequence PRO3574 cDNA, wherein SEQ ID NO:3 is a clone designated
herein as "DNA19360-2552".
[0030] FIG. 4 shows the amino acid sequence (SEQ ID NO:4) derived
from the coding sequence of SEQ ID NO:3 shown in FIG. 3.
[0031] FIG. 5 shows a nucleotide sequence (SEQ ID NO:5) of a native
sequence PRO1280 cDNA, wherein SEQ ID NO:5 is a clone designated
herein as "DNA33455-1548".
[0032] FIG. 6 shows the amino acid sequence (SEQ ID NO:6) derived
from the coding sequence of SEQ ID NO:5 shown in FIG. 5.
[0033] FIG. 7 shows a nucleotide sequence (SEQ ID NO:7) of a native
sequence PRO4984 cDNA, wherein SEQ ID NO:7 is a clone designated
herein as "DNA37155-2651".
[0034] FIG. 8 shows the amino acid sequence (SEQ ID NO:8) derived
from the coding sequence of SEQ ID NO:7 shown in FIG. 7.
[0035] FIG. 9 shows a nucleotide sequence (SEQ ID NO:9) of a native
sequence PRO4988 cDNA, wherein SEQ ID NO:9 is a clone designated
herein as "DNA38269-2654".
[0036] FIG. 10 shows the amino acid sequence (SEQ ID NO: 10)
derived from the coding sequence of SEQ ID NO:9 shown in FIG.
9.
[0037] FIG. 11 shows a nucleotide sequence (SEQ ID NO:i 1) of a
native sequence PRO305 cDNA, wherein SEQ ID NO: 11 is a clone
designated herein as "DNA40619-1220".
[0038] FIG. 12 shows the amino acid sequence (SEQ ID NO: 12)
derived from the coding sequence of SEQ ID NO: 11 shown in FIG.
11.
[0039] FIG. 13 shows a nucleotide sequence (SEQ ID NO: 13) of a
native sequence PRO1866 cDNA, wherein SEQ ID NO:13 is a clone
designated herein as "DNA44174-2513".
[0040] FIG. 14 shows the amino acid sequence (SEQ ID NO: 14)
derived from the coding sequence of SEQ ID NO: 13 shown in FIG.
13.
[0041] FIG. 15 shows a nucleotide sequence (SEQ ID NO: 15) of a
native sequence PRO4996 cDNA, wherein SEQ ID NO: 15 is a clone
designated herein as "DNA44675-2662".
[0042] FIG. 16 shows the amino acid sequence (SEQ ID NO: 16)
derived from the coding sequence of SEQ ID NO:15 shown in FIG.
15.
[0043] FIG. 17 shows anucleotide sequence (SEQ ID NO: 17) of a
native sequence PRO4406 cDNA, wherein SEQ ID NO: 17 is a clone
designated herein as "DNA45408-2615".
[0044] FIG. 18 shows the amino acid sequence (SEQ ID NO:18) derived
from the coding sequence of SEQ ID NO:17 shown in FIG. 17.
[0045] FIG. 19 shows a nucleotide sequence (SEQ ID NO: 19) of a
native sequence PRO1120 cDNA, wherein SEQ ID NO:19 is a clone
designated herein as "DNA48606-1479".
[0046] FIG. 20 shows the amino acid sequence (SEQ ID NO:20) derived
from the coding sequence of SEQ ID NO:19 shown in FIG. 19.
[0047] FIG. 21 shows a nucleotide sequence (SEQ ID NO:21) of a
native sequence PRO4990 cDNA, wherein SEQ ID NO:21 is a clone
designated herein as "DNA52753-2656".
[0048] FIG. 22 shows the amino acid sequence (SEQ ID NO:22) derived
from the coding sequence of SEQ ID NO:21 shown in FIG. 21.
[0049] FIG. 23 shows a nucleotide sequence (SEQ ID NO:23) of a
native sequence PRO738 cDNA, wherein SEQ ID NO:23 is a clone
designated herein as "DNA53915-1258".
[0050] FIG. 24 shows the amino acid sequence (SEQ ID NO:24) derived
from the coding sequence of SEQ ID NO:23 shown in FIG. 23.
[0051] FIG. 25 shows anucleotide sequence (SEQ ID NO:25) of a
native sequence PRO3577 cDNA, wherein SEQ ID NO:25 is a clone
designated herein as "DNA53991-2553".
[0052] FIG. 26 shows the amino acid sequence (SEQ ID NO:26) derived
from the coding sequence of SEQ ID NO:25 shown in FIG. 25.
[0053] FIG. 27 shows a nucleotide sequence (SEQ ID NO:27) of a
native sequence PRO1879 cDNA, wherein SEQ ID NO:27 is a clone
designated herein as "DNA54009-2517".
[0054] FIG. 28 shows the amino acid sequence (SEQ ID NO:28) derived
from the coding sequence of SEQ ID NO:27 shown in FIG. 27.
[0055] FIG. 29 shows a nucleotide sequence (SEQ ID NO:29) of a
native sequence PRO1471 cDNA, wherein SEQ ID NO:29 is a clone
designated herein as "DNA56055-1643".
[0056] FIG. 30 shows the amino acid sequence (SEQ ID NO:30) derived
from the coding sequence of SEQ ID NO:29 shown in FIG. 29. 1 FIG.
31 shows a nucleotide sequence (SEQ ID NO:3 1) of a native sequence
PRO1114 cDNA, wherein SEQ ID NO:31 is a clone designated herein as
"DNA57033-1403".
[0057] FIG. 32 shows the amino acid sequence (SEQ ID NO:32) derived
from the coding sequence of SEQ ID NO:31 shown in FIG. 31.
[0058] FIG. 33 shows a nucleotide sequence (SEQ ID NO:33) of
anative sequence PRO1076 cDNA, wherein SEQ ID NO:33 is a clone
designated herein as "DNA57252-1453".
[0059] FIG. 34 shows the amino acid sequence (SEQ ID NO:34) derived
from the coding sequence of SEQ ID NO:33 shown in FIG. 33.
[0060] FIG. 35 shows a nucleotide sequence (SEQ ID NO:35) of a
native sequence PRO1483 cDNA, wherein SEQ ID NO:35 is a clone
designated herein as "DNA58799-1652".
[0061] FIG. 36 shows the amino acid sequence (SEQ ID NO:36) derived
from the coding sequence of SEQ ID NO:35 shown in FIG. 35.
[0062] FIG. 37 shows a nucleotide sequence (SEQ ID NO:37) of a
native sequence PRO4985 cDNA, wherein SEQ ID NO:37 is a clone
designated herein as "DNA59770-2652".
[0063] FIG. 38 shows the amino acid sequence (SEQ ID NO:38) derived
from the coding sequence of SEQ ID NO:37 shown in FIG. 37.
[0064] FIG. 39 shows a nucleotide sequence (SEQ ID NO:39) of a
native sequence PRO5000 cDNA, wherein SEQ ID NO:39 is a clone
designated herein as "DNA59774-2665".
[0065] FIG. 40 shows the amino acid sequence (SEQ ID NO:40) derived
from the coding sequence of SEQ ID NO:39 shown in FIG. 39.
[0066] FIG. 41 shows anucleotide sequence (SEQ ID NO:41) of a
native sequence PRO1881 cDNA, wherein SEQ ID NO:41 is a clone
designated herein as "DNA60281-2518".
[0067] FIG. 42 shows the amino acid sequence (SEQ ID NO:42) derived
from the coding sequence of SEQ ID NO:41 shown in FIG. 41.
[0068] FIG. 43 shows a nucleotide sequence (SEQ ID NO:43) of a
native sequence PRO4314 cDNA, wherein SEQ ID NO:43 is a clone
designated herein as "DNA60736-2559".
[0069] FIG. 44 shows the amino acid sequence (SEQ ID NO:44) derived
from the coding sequence of SEQ ID NO:43 shown in FIG. 43.
[0070] FIG. 45 shows a nucleotide sequence (SEQ ID NO:45) of a
native sequence PRO4987 cDNA, wherein SEQ ID NO:45 is a clone
designated herein as "DNA61875-2653".
[0071] FIG. 46 shows the amino acid sequence (SEQ ID NO:46) derived
from the coding sequence of SEQ ID NO:45 shown in FIG. 45.
[0072] FIG. 47 shows a nucleotide sequence (SEQ ID NO:47) of a
native sequence PRO4313 cDNA, wherein SEQ ID NO:47 is a clone
designated herein as "DNA62312-2558".
[0073] FIG. 48 shows the amino acid sequence (SEQ ID NO:48) derived
from the coding sequence of SEQ ID NO:47 shown in FIG. 47.
[0074] FIG. 49 shows a nucleotide sequence (SEQ ID NO:49) of a
native sequence PRO4799 cDNA, wherein SEQ ID NO:49 is a clone
designated herein as "DNA62849-1604".
[0075] FIG. 50 shows the amino acid sequence (SEQ ID NO:50) derived
from the coding sequence of SEQ ID NO:49 shown in FIG. 49.
[0076] FIG. 51 shows a nucleotide sequence (SEQ ID NO:51) of a
native sequence PRO4995 cDNA, wherein SEQ ID NO:51 is a clone
designated herein as "DNA66307-2661".
[0077] FIG. 52 shows the amino acid sequence (SEQ ID NO:52) derived
from the coding sequence of SEQ ID NO:51 shown in FIG. 51.
[0078] FIG. 53 shows anucleotide sequence (SEQ ID NO:53) of a
native sequence PRO1341 cDNA, wherein SEQ ID NO:53 is a clone
designated herein as "DNA66677-2535".
[0079] FIG. 54 shows the amino acid sequence (SEQ ID NO:54) derived
from the coding sequence of SEQ ID NO:53 shown in FIG. 53.
[0080] FIG. 55 shows anucleotide sequence (SEQ ID NO:55) of a
native sequence PRO1777 cDNA, wherein SEQ ID NO:55 is a clone
designated herein as "DNA71235-1706".
[0081] FIG. 56 shows the amino acid sequence (SEQ ID NO:56) derived
from the coding sequence of SEQ ID NO:55 shown in FIG. 55.
[0082] FIG. 57 shows a nucleotide sequence (SEQ ID NO:57) of a
native sequence PRO3580 cDNA, wherein SEQ ID NO:57 is a clone
designated herein as "DNA71289-2547".
[0083] FIG. 58 shows the amino acid sequence (SEQ ID NO:58) derived
from the coding sequence of SEQ ID NO:57 shown in FIG. 57.
[0084] FIG. 59 shows a nucleotide sequence (SEQ ID NO:59) of a
native sequence PRO1779 cDNA, wherein SEQ ID NO:59 is a clone
designated herein as "DNA73775-1707".
[0085] FIG. 60 shows the amino acid sequence (SEQ ID NO:60) derived
from the coding sequence of SEQ ID NO:59 shown in FIG. 59.
[0086] FIG. 61 shows a nucleotide sequence (SEQ ID NO:61) of
anative sequencePRO1754 cDNA, wherein SEQ ID NO:61 is a clone
designated herein as "DNA76385-1692".
[0087] FIG. 62 shows the amino acid sequence (SEQ ID NO:62) derived
from the coding sequence of SEQ ID NO:61 shown in FIG. 61.
[0088] FIG. 63 shows a nucleotide sequence (SEQ ID NO:63) of a
native sequencePRO1906 cDNA, wherein SEQ ID NO:63 is a clone
designated herein as "DNA76395-2527".
[0089] FIG. 64 shows the amino acid sequence (SEQ ID NO:64) derived
from the coding sequence of SEQ ID NO:63 shown in FIG. 63.
[0090] FIG. 65 shows a nucleotide sequence (SEQ ID NO:65) of
anative sequence PRO1870 cDNA, wherein SEQ ID NO:65 is a clone
designated herein as "DNA77622-2516".
[0091] FIG. 66 shows the amino acid sequence (SEQ ID NO:66) derived
from the coding sequence of SEQ ID NO:65 shown in FIG. 65.
[0092] FIG. 67 shows a nucleotide sequence (SEQ ID NO:67) of a
native sequence PRO4329 cDNA, wherein SEQ ID NO:67 is a clone
designated herein as "DNA77629-2573".
[0093] FIG. 68 shows the amino acid sequence (SEQ ID NO:68) derived
from the coding sequence of SEQ ID NO:67 shown in FIG. 67.
[0094] FIG. 69 shows a nucleotide sequence (SEQ ID NO:69) of a
native sequence PRO4979 cDNA, wherein SEQ ID NO:69 is a clone
designated herein as "DNA77645-2648".
[0095] FIG. 70 shows the amino acid sequence (SEQ ID NO:70) derived
from the coding sequence of SEQ ID NO:69 shown in FIG. 69.
[0096] FIG. 71 shows a nucleotide sequence (SEQ ID NO:71) of a
native sequence PRO1885 cDNA, wherein SEQ ID NO:71 is a clone
designated herein as "DNA79302-2521".
[0097] FIG. 72 shows the amino acid sequence (SEQ ID NO:72) derived
from the coding sequence of SEQ ID NO:71 shown in FIG. 71.
[0098] FIG. 73 shows anucleotide sequence (SEQ ID NO:73) of a
native sequencePRO1882 cDNA, wherein SEQ ID NO:73 is a clone
designated herein as "DNA79865-2519".
[0099] FIG. 74 shows the amino acid sequence (SEQ ID NO:74) derived
from the coding sequence of SEQ ID NO:73 shown in FIG. 73.
[0100] FIG. 75 shows a nucleotide sequence (SEQ ID NO:75) of a
native sequence PRO4989 cDNA, wherein SEQ ID NO:75 is a clone
designated herein as "DNA80135-2655".
[0101] FIG. 76 shows the amino acid sequence (SEQ ID NO:76) derived
from the coding sequence of SEQ ID NO:75 shown in FIG. 75.
[0102] FIG. 77 shows anucleotide sequence (SEQ ID NO:77) of a
native sequence PRO4323 cDNA, wherein SEQ ID NO:77 is a clone
designated herein as "DNA80794-2568".
[0103] FIG. 78 shows the amino acid sequence (SEQ ID NO:78) derived
from the coding sequence of SEQ ID NO:77 shown in FIG. 77.
[0104] FIG. 79 shows anucleotide sequence (SEQ ID NO:79) of anative
sequence PRO1886 cDNA, wherein SEQ ID NO:79 is a clone designated
herein as "DNA80796-2523".
[0105] FIG. 80 shows the amino acid sequence (SEQ ID NO:80) derived
from the coding sequence of SEQ ID NO:79 shown in FIG. 79.
[0106] FIG. 81 shows anucleotide sequence (SEQ ID NO:81) of a
native sequence PRO4395 cDNA, wherein SEQ ID NO:81 is a clone
designated herein as "DNA80840-2605".
[0107] FIG. 82 shows the amino acid sequence (SEQ ID NO:82) derived
from the coding sequence of SEQ ID NO:81 shown in FIG. 81.
[0108] FIG. 83 shows a nucleotide sequence (SEQ ID NO:83) of a
native sequence PRO1782 cDNA, wherein SEQ ID NO:83 is a clone
designated herein as "DNA80899-2501 ".
[0109] FIG. 84 shows the amino acid sequence (SEQ ID NO:84) derived
from the coding sequence of SEQ ID NO:83 shown in FIG. 83.
[0110] FIG. 85 shows a nucleotide sequence (SEQ Ip NO:85) of a
native sequence PRO4338 cDNA, wherein SEQ ID NO:85 is a clone
designated herein as "DNA81228-2580".
[0111] FIG. 86 shows the amino acid sequence (SEQ ID NO:86) derived
from the coding sequence of SEQ ID NO:85 shown in FIG. 85.
[0112] FIG. 87 shows a nucleotide sequence (SEQ ID NO:87) of a
native sequence PRO4341 cDNA, wherein SEQ ID NO:87 is a clone
designated herein as "DNA81761-2583".
[0113] FIG. 88 shows the amino acid sequence (SEQ ID NO:88) derived
from the coding sequence of SEQ ID NO:87 shown in FIG. 87.
[0114] FIG. 89 shows a nucleotide sequence (SEQ ID NO:89) of a
native sequence PRO5990 cDNA, wherein SEQ ID NO:89 is a clone
designated herein as "DNA96042-2682".
[0115] FIG. 90 shows the amino acid sequence (SEQ ID NO:90) derived
from the coding sequence of SEQ ID NO:89 shown in FIG. 89.
[0116] FIG. 91 shows a nucleotide sequence (SEQ ID NO:91) of a
native sequence PRO3438 cDNA, wherein SEQ ID NO:91 is a clone
designated herein as "DNA82364-2538".
[0117] FIG. 92 shows the amino acid sequence (SEQ ID NO:92) derived
from the coding sequence of SEQ ID NO:91 shown in FIG. 91.
[0118] FIG. 93 shows a nucleotide sequence (SEQ ID NO:93) of a
native sequence PRO4321 cDNA, wherein SEQ ID NO:93 is a clone
designated herein as "DNA82424-2566".
[0119] FIG. 94 shows the amino acid sequence (SEQ ID NO:94) derived
from the coding sequence of SEQ ID NO:93 shown in FIG. 93.
[0120] FIG. 95 shows a nucleotide sequence (SEQ ID NO:95) of a
native sequence PRO4304 cDNA, wherein SEQ ID NO:95 is a clone
designated herein as "DNA82430-2557".
[0121] FIG. 96 shows the amino acid sequence (SEQ ID NO:96) derived
from the coding sequence of SEQ ID NO:95 shown in FIG. 95.
[0122] FIG. 97 shows a nucleotide sequence (SEQ ID NO:97) of a
native sequence PRO1801 cDNA, wherein SEQ ID NO:97 is a clone
designated herein as "DNA83500-2506".
[0123] FIG. 98 shows the amino acid sequence (SEQ ID NO:98) derived
from the coding sequence of SEQ ID NO:97 shown in FIG. 97.
[0124] FIG. 99 shows a nucleotide sequence (SEQ ID NO:99) of a
native sequence PRO4403 cDNA, wherein SEQ ID NO:99 is a clone
designated herein as "DNA83509-2612".
[0125] FIG. 100 shows the amino acid sequence (SEQ ID NO: 100)
derived from the coding sequence of SEQ ID NO:99 shown in FIG.
99.
[0126] FIG. 101 shows a nucleotide sequence (SEQ ID NO: 101) of a
native sequence PRO4324 cDNA, wherein SEQ ID NO: 101 is a clone
designated herein as "DNA83560-2569".
[0127] FIG. 102 shows the amino acid sequence (SEQ ID NO: 102)
derived from the coding sequence of SEQ ID NO:101 shown in FIG.
101.
[0128] FIG. 103 shows a nucleotide sequence (SEQ ID NO: 103) of a
native sequence PRO4303 cDNA, wherein SEQ ID NO: 103 is a clone
designated herein as "DNA84139-2555".
[0129] FIG. 104 shows the amino acid sequence (SEQ ID NO: 104)
derived from the coding sequence of SEQ ID NO:103 shown in FIG.
103.
[0130] FIG. 105 shows a nucleotide sequence (SEQ ID NO: 105) of a
native sequence PRO4305 cDNA, wherein SEQ ID NO: 105 is a clone
designated herein as "DNA84141-2556".
[0131] FIG. 106 shows the amino acid sequence (SEQ ID NO:106)
derived from the coding sequence of SEQ ID NO: 105 shown in FIG.
105.
[0132] FIG. 107 shows a nucleotide sequence (SEQ ID NO: 107) of a
native sequence PRO4404 cDNA, wherein SEQ ID NO:107 is a clone
designated herein as "DNA84142-2613".
[0133] FIG. 108 shows the amino acid sequence (SEQ ID NO: 108)
derived from the coding sequence of SEQ ID NO: 107 shown in FIG.
107.
[0134] FIG. 109 shows a nucleotide sequence (SEQ ID NO:109) of a
native sequence PRO1884 cDNA, wherein SEQ ID NO: 109 is a clone
designated herein as "DNA84318-2520".
[0135] FIG. 110 shows the amino acid sequence (SEQ ID NO: 110)
derived from the coding sequence of SEQ ID NO: 109 shown in FIG.
109.
[0136] FIG. 111 shows a nucleotide sequence (SEQ ID NO: 111) of a
native sequence PRO4349 cDNA, wherein SEQ ID NO: 111 is a clone
designated herein as "DNA84909-2590".
[0137] FIG. 112 shows the amino acid sequence (SEQ ID NO: 112)
derived from the coding sequence of SEQ ID NO: 111 shown in FIG.
111.
[0138] FIG. 113 shows a nucleotide sequence (SEQ ID NO:113) of a
native sequence PRO4401 cDNA, wherein SEQ ID NO: 113 is a clone
designated herein as "DNA84912-2610".
[0139] FIG. 114 shows the amino acid sequence (SEQ ID NO: 114)
derived from the coding sequence of SEQ IDNO:113 shown in FIG.
113.
[0140] FIG. 115 shows a nucleotide sequence (SEQ ID NO: 115) of a
native sequence PRO1867 cDNA, wherein SEQ ID NO: 115 is a clone
designated herein as "DNA84925-2514".
[0141] FIG. 116 shows the amino acid sequence (SEQ ID NO: 116)
derived from the coding sequence of SEQ ID NO: 115 shown in FIG.
115.
[0142] FIG. 117 shows a nucleotide sequence (SEQ ID NO:117) of a
native sequence PRO4319 cDNA, wherein SEQ ID NO: 117 is a clone
designated herein as "DNA84928-2564".
[0143] FIG. 118 shows the amino acid sequence (SEQ ID NO: 118)
derived from the coding sequence of SEQ ID NO: 117 shown in FIG.
117.
[0144] FIG. 119 shows a nucleotide sequence (SEQ ID NO:119) of a
native sequence PRO4991 cDNA, wherein SEQ ID NO: 119 is a clone
designated herein as "DNA84932-2657".
[0145] FIG. 120 shows the amino acid sequence (SEQ ID NO: 120)
derived from the coding sequence of SEQ ID NO:119 shown in FIG.
119.
[0146] FIG. 121 shows a nucleotide sequence (SEQ ID NO: 121) of a
native sequence PRO4398 cDNA, wherein SEQ ID NO:121 is a clone
designated herein as "DNA86592-2607".
[0147] FIG. 122 shows the amino acid sequence (SEQ ID NO: 122)
derived from the coding sequence of SEQ ID NO:121 shown in FIG.
121.
[0148] FIG. 123 shows a nucleotide sequence (SEQ ID NO: 123) of a
native sequence PRO4346 cDNA, wherein SEQ ID NO: 123 is a clone
designated herein as "DNA86594-2587".
[0149] FIG. 124 shows the amino acid sequence (SEQ ID NO:124)
derived from the coding sequence of SEQ ID NO: 123 shown in FIG.
123.
[0150] FIG. 125 shows a nucleotide sequence (SEQ ID NO: 125) of a
native sequence PRO4350 cDNA, wherein SEQ ID NO: 125 is a clone
designated herein as "DNA86647-2591".
[0151] FIG. 126 shows the amino acid sequence (SEQ ID NO:126)
derived from the coding sequence of SEQ ID NO:125 shown in FIG.
125.
[0152] FIG. 127 shows a nucleotide sequence (SEQ ID NO: 127) of a
native sequence PRO4318 cDNA, wherein SEQ ID NO: 127 is a clone
designated herein as "DNA87185-2563".
[0153] FIG. 128 shows the amino acid sequence (SEQ ID NO: 128)
derived from the coding sequence of SEQ ID NO:127 shown in FIG.
127.
[0154] FIG. 129 shows a nucleotide sequence (SEQ ID NO: 129) of a
native sequence PRO4340 cDNA, wherein SEQ ID NO: 129 is a clone
designated herein as "DNA87656-2582".
[0155] FIG. 130 shows the amino acid sequence (SEQ ID NO: 130)
derived from the coding sequence of SEQ ID NO:129 shown in FIG.
129.
[0156] FIG. 131 shows a nucleotide sequence (SEQ ID NO: 131) of a
native sequence PRO4400 cDNA, wherein SEQ ID NO: 131 is a clone
designated herein as "DNA87974-2609".
[0157] FIG. 132 shows the amino acid sequence (SEQ ID NO: 132)
derived from the coding sequence of SEQ ID NO: 131 shown in FIG.
131.
[0158] FIG. 133 shows a nucleotide sequence (SEQ ID NO: 133) of a
native sequence PRO4320 cDNA, wherein SEQ ID NO: 133 is a clone
designated herein as "DNA88001-2565".
[0159] FIG. 134 shows the amino acid sequence (SEQ ID NO: 134)
derived from the coding sequence of SEQ ID NO:133 shown in FIG.
133.
[0160] FIG. 135 shows a nucleotide sequence (SEQ ID NO: 135) of a
native sequence PRO4409 cDNA, wherein SEQ ID NO: 135 is a clone
designated herein as "DNA88004-2575".
[0161] FIG. 136 shows the amino acid sequence (SEQ ID NO: 136)
derived from the coding sequence of SEQ ID NO:135 shown in FIG.
135.
[0162] FIG. 137 shows a nucleotide sequence (SEQ ID NO: 137) of a
native sequence PRO4399 cDNA, wherein SEQ ID NO: 137 is a clone
designated herein as "DNA89220-2608".
[0163] FIG. 138 shows the amino acid sequence (SEQ ID NO: 138)
derived from the coding sequence of SEQ ID NO:137 shown in FIG.
137.
[0164] FIG. 139 shows a nucleotide sequence (SEQ ID NO: 139) of a
native sequence PRO4418 cDNA, wherein SEQ ID NO: 139 is a clone
designated herein as "DNA89947-2618".
[0165] FIG. 140 shows the amino acid sequence (SEQ ID NO: 140)
derived from the coding sequence of SEQ ID NO:139 shown in FIG.
139.
[0166] FIG. 141 shows a nucleotide sequence (SEQ ID NO: 141) of a
native sequence PRO4330 cDNA, wherein SEQ ID NO: 141 is a clone
designated herein as "DNA90842-2574".
[0167] FIG. 142 shows the amino acid sequence (SEQ ID NO: 142)
derived from the coding sequence of SEQ ID NO:141 shown in FIG.
141.
[0168] FIG. 143 shows a nucleotide sequence (SEQ ID NO: 143) of a
native sequence PRO4339 cDNA, wherein SEQ ID NO: 143 is a clone
designated herein as "DNA91775-2581".
[0169] FIG. 144 shows the amino acid sequence (SEQ ID NO: 144)
derived from the coding sequence of SEQ ID NO: 143 shown in FIG.
143.
[0170] FIG. 145 shows a nucleotide sequence (SEQ ID NO:145) of a
native sequence PRO4326 cDNA, wherein SEQ ID NO: 145 is a clone
designated herein as "DNA91779-2571 ".
[0171] FIG. 146 shows the amino acid sequence (SEQ ID NO: 146)
derived from the coding sequence of SEQ ID NO: 145 shown in FIG.
145.
[0172] FIG. 147 shows a nucleotide sequence (SEQ ID NO: 147) of a
native sequence PRO6014 cDNA, wherein SEQ ID NO: 147 is a clone
designated herein as "DNA92217-2697".
[0173] FIG. 148 shows the amino acid sequence (SEQ ID NO: 148)
derived from the coding sequence of SEQ ID NO: 147 shown in FIG.
147.
[0174] FIG. 149 shows a nucleotide sequence (SEQ ID NO: 149) of a
native sequence PRO3446 cDNA, wherein SEQ ID NO: 149 is a clone
designated herein as "DNA92219-2541 ".
[0175] FIG. 150 shows the amino acid sequence (SEQ ID NO:150)
derived from the coding sequence of SEQ ID NO: 149 shown in FIG.
149.
[0176] FIG. 151 shows a nucleotide sequence (SEQ ID NO:151) of a
native sequence PRO4322 cDNA, wherein SEQ ID NO: 151 is a clone
designated herein as "DNA92223-2567".
[0177] FIG. 152 shows the amino acid sequence (SEQ ID NO:152)
derived from the coding sequence of SEQ ID NO: 151 shown in FIG.
151.
[0178] FIG. 153 shows a nucleotide sequence (SEQ ID NO:153) of a
native sequence PRO4381 cDNA, wherein SEQ ID NO: 153 is a clone
designated herein as "DNA92225-2603".
[0179] FIG. 154 shows the amino acid sequence (SEQ ID NO: 154)
derived from the coding sequence of SEQ ID NO:153 shown in FIG.
153.
[0180] FIG. 155 shows a nucleotide sequence (SEQ ID NO: 155) of a
native sequence PRO4348 cDNA, wherein SEQ ID NO: 155 is a clone
designated herein as "DNA92232-2589".
[0181] FIG. 156 shows the amino acid sequence (SEQ ID NO: 156)
derived from the coding sequence of SEQ ID NO:155 shown in FIG.
155.
[0182] FIG. 157 shows a nucleotide sequence (SEQ ID NO: 157) of a
native sequence PRO4371 cDNA, wherein SEQ ID NO: 157 is a clone
designated herein as "DNA92233-2599".
[0183] FIG. 158 shows the amino acid sequence (SEQ ID NO:158)
derived from the coding sequence of SEQ ID NO:157 shown in FIG.
157.
[0184] FIG. 159 shows a nucleotide sequence (SEQ ID NO: 159) of a
native sequence PRO3742 cDNA, wherein SEQ ID NO: 159 is a clone
designated herein as "DNA92243-2549".
[0185] FIG. 160 shows the amino acid sequence (SEQ ID NO: 160)
derived from the coding sequence of SEQ ID NO: 159 shown in FIG.
159.
[0186] FIG. 161 shows a nucleotide sequence (SEQ ID NO:161) of a
native sequence PRO5773 cDNA, wherein SEQ ID NO:161 is a clone
designated herein as "DNA92253-2671".
[0187] FIG. 162 shows the amino acid sequence (SEQ ID NO: 162)
derived from the coding sequence of SEQ ID NO: 161 shown in FIG.
161.
[0188] FIG. 163 shows a nucleotide sequence (SEQ ID NO: 163) of a
native sequence PRO5774 cDNA, wherein SEQ ID NO: 163 is a clone
designated herein as "DNA92254-2672".
[0189] FIG. 164 shows the amino acid sequence (SEQ ID NO: 164)
derived from the coding sequence of SEQ ID NO: 163 shown in FIG.
163.
[0190] FIG. 165 shows a nucleotide sequence (SEQ ID NO: 165) of a
native sequence PRO4343 cDNA, wherein SEQ ID NO: 165 is a clone
designated herein as "DNA92255-2584".
[0191] FIG. 166 shows the amino acid sequence (SEQ ID NO:166)
derived from the coding sequence of SEQ ID NO: 165 shown in FIG.
165.
[0192] FIG. 167 shows a nucleotide sequence (SEQ ID NO: 167) of a
native sequence PRO4325 cDNA, wherein SEQ ID NO: 167 is a clone
designated herein as "DNA92269-2570".
[0193] FIG. 168 shows the amino acid sequence (SEQ ID NO: 168)
derived from the coding sequence of SEQ ID NO: 167 shown in FIG.
167.
[0194] FIG. 169 shows a nucleotide sequence (SEQ ID NO:169) of a
native sequence PRO4347 cDNA, wherein SEQ ID NO: 169 is a clone
designated herein as "DNA92288-2588".
[0195] FIG. 170 shows the amino acid sequence (SEQ ID NO: 170)
derived from the coding sequence of SEQ ID NO: 169 shown in FIG.
169.
[0196] FIG. 171 shows a nucleotide sequence (SEQ ID NO: 171) of a
native sequence PRO3743 cDNA, wherein SEQ ID NO: 171 is a clone
designated herein as "DNA92290-2550".
[0197] FIG. 172 shows the amino acid sequence (SEQ ID NO: 172)
derived from the coding sequence of SEQ ID NO:171 shown in FIG.
171.
[0198] FIG. 173 shows a nucleotide sequence (SEQ ID NO:173) of a
native sequence PRO4426 cDNA, wherein SEQ ID NO: 173 is a clone
designated herein as "DNA93012-2622".
[0199] FIG. 174 shows the amino acid sequence (SEQ ID NO:174)
derived from the coding sequence of SEQ ID NO: 173 shown in FIG.
173.
[0200] FIG. 175 shows a nucleotide sequence (SEQ ID NO:175) of a
native sequence PRO4500 cDNA, wherein SEQ ID NO: 175 is a clone
designated herein as "DNA93020-2642".
[0201] FIG. 176 shows the amino acid sequence (SEQ ID NO: 176)
derived from the coding sequence of SEQ ID NO:175 shown in FIG.
175.
[0202] FIG. 177 shows a nucleotide sequence (SEQ ID NO: 177) of a
native sequence PRO4389 cDNA, wherein SEQ ID NO: 177 is a clone
designated herein as "DNA94830-2604".
[0203] FIG. 178 shows the amino acid sequence (SEQ ID NO: 178)
derived from the coding sequence of SEQ ID NO:177 shown in FIG.
177.
[0204] FIG. 179 shows a nucleotide sequence (SEQ ID NO: 179) of a
native sequence PRO4337 cDNA, wherein SEQ ID NO: 179 is a clone
designated herein as "DNA94833-2579".
[0205] FIG. 180 shows the amino acid sequence (SEQ ID NO: 180)
derived from the coding sequence of SEQ ID NO: 179 shown in FIG.
179.
[0206] FIG. 181 shows a nucleotide sequence (SEQ ID NO: 181) of a
native sequence PRO4992 cDNA, wherein SEQ ID NO: 181 is a clone
designated herein as "DNA94838-2658".
[0207] FIG. 182 shows the amino acid sequence (SEQ ID NO: 182)
derived from the coding sequence of SEQ ID NO:181 shown in FIG.
181.
[0208] FIG. 183 shows a nucleotide sequence (SEQ ID NO: 183) of a
native sequence PRO5996 cDNA, wherein SEQ ID NO: 183 is a clone
designated herein as "DNA94844-2686".
[0209] FIG. 184 shows the amino acid sequence (SEQ ID NO: 184)
derived from the coding sequence of SEQ ID NO: 183 shown in FIG.
183.
[0210] FIG. 185 shows a nucleotide sequence (SEQ ID NO: 185) of a
native sequence PRO4345 cDNA, wherein SEQ ID NO: 185 is a clone
designated herein as "DNA94854-2586".
[0211] FIG. 186 shows the amino acid sequence (SEQ ID NO: 186)
derived from the coding sequence of SEQ ID NO: 185 shown in FIG.
185.
[0212] FIG. 187 shows a nucleotide sequence (SEQ ID NO: 187) of a
native sequence PRO4978 cDNA, wherein SEQ ID NO: 187 is a clone
designated herein as "DNA95930".
[0213] FIG. 188 shows the amino acid sequence (SEQ ID NO: 188)
derived from the coding sequence of SEQ ID NO: 187 shown in FIG.
187.
[0214] FIG. 189 shows a nucleotide sequence (SEQ ID NO: 189) of a
native sequence PRO5780 cDNA, wherein SEQ ID NO: 189 is a clone
designated herein as "DNA96868-2677".
[0215] FIG. 190 shows the amino acid sequence (SEQ ID NO: 190)
derived from the coding sequence of SEQ ID NO:189 shown in FIG.
189.
[0216] FIG. 191 shows a nucleotide sequence (SEQ ID NO: 191) of a
native sequence PRO5992 cDNA, wherein SEQ ID NO: 191 is a clone
designated herein as "DNA96871-2683".
[0217] FIG. 192 shows the amino acid sequence (SEQ ID NO: 192)
derived from the coding sequence of SEQ ID NO: 191 shown in FIG.
191.
[0218] FIG. 193 shows a nucleotide sequence (SEQ ID NO: 193) of a
native sequence PRO4428 cDNA, wherein SEQ ID NO: 193 is a clone
designated herein as "DNA96880-2624".
[0219] FIG. 194 shows the amino acid sequence (SEQ ID NO: 194)
derived from the coding sequence of SEQ ID NO: 193 shown in FIG.
193.
[0220] FIG. 195 shows a nucleotide sequence (SEQ ID NO: 195) of a
native sequence PRO4994 cDNA, wherein SEQ ID NO: 195 is a clone
designated herein as "DNA96986-2660".
[0221] FIG. 196 shows the amino acid sequence (SEQ ID NO:196)
derived from the coding sequence of SEQ ID NO: 195 shown in FIG.
195.
[0222] FIG. 197 shows a nucleotide sequence (SEQ ID NO: 197) of a
native sequence PRO5995 cDNA, wherein SEQ ID NO: 197 is a clone
designated herein as "DNA96988-2685".
[0223] FIG. 198 shows the amino acid sequence (SEQ ID NO:198)
derived from the coding sequence of SEQ ID NO: 197 shown in FIG.
197.
[0224] FIG. 199 shows a nucleotide sequence (SEQ ID NO:199) of a
native sequence PRO6094 cDNA, wherein SEQ ID NO: 199 is a clone
designated herein as "DNA96995-2709".
[0225] FIG. 200 shows the amino acid sequence (SEQ ID NO:200)
derived from the coding sequence of SEQ ID NO: 199 shown in FIG.
199.
[0226] FIG. 201 shows a nucleotide sequence (SEQ ID NO:201) of a
native sequence PRO4317 cDNA, wherein SEQ ID NO:201 is a clone
designated herein as "DNA97004-2562".
[0227] FIG. 202 shows the amino acid sequence (SEQ ID NO:202)
derived from the coding sequence of SEQ ID NO:201 shown in FIG.
201.
[0228] FIG. 203 shows a nucleotide sequence (SEQ ID NO:203) of a
native sequence PRO5997 cDNA, wherein SEQ ID NO:203 is a clone
designated herein as "DNA97005-2687".
[0229] FIG. 204 shows the amino acid sequence (SEQ ID NO:204)
derived from the coding sequence of SEQ ID NO:203 shown in FIG.
203.
[0230] FIG. 205 shows a nucleotide sequence (SEQ ID NO:205) of a
native sequence PRO5005 cDNA, wherein SEQ ID NO:205 is a clone
designated herein as "DNA97009-2668".
[0231] FIG. 206 shows the amino acid sequence (SEQ ID NO:206)
derived from the coding sequence of SEQ ID NO:205 shown in FIG.
205.
[0232] FIG. 207 shows a nucleotide sequence (SEQ ID NO:207) of a
native sequence PRO5004 cDNA, wherein SEQ ID NO:207 is a clone
designated herein as "DNA97013-2667".
[0233] FIG. 208 shows the amino acid sequence (SEQ ID NO:208)
derived from the coding sequence of SEQ ID NO:207 shown in FIG.
207.
[0234] FIG. 209 shows a nucleotide sequence (SEQ ID NO:209) of a
native sequence PRO6001 cDNA, wherein SEQ ID NO:209 is a clone
designated herein as "DNA98380-2690".
[0235] FIG. 210 shows the amino acid sequence (SEQ ID NO:210)
derived from the coding sequence of SEQ ID NO:209 shown in FIG.
209.
[0236] FIG. 211 shows a nucleotide sequence (SEQ ID NO:211) of a
native sequence PRO6013 cDNA, wherein SEQ ID NO:211 is a clone
designated herein as "DNA98561-2696".
[0237] FIG. 212 shows the amino acid sequence (SEQ ID NO:212)
derived from the coding sequence of SEQ ID NO:211 shown in FIG.
211.
[0238] FIG. 213 shows a nucleotide sequence (SEQ ID NO:213) of a
native sequence PRO4502 cDNA, wherein SEQ ID NO:213 is a clone
designated herein as "DNA98575-2644".
[0239] FIG. 214 shows the amino acid sequence (SEQ ID NO:214)
derived from the coding sequence of SEQ ID NO:213 shown in FIG.
213.
[0240] FIG. 215 shows a nucleotide sequence (SEQ ID NO:215) of a
native sequence PRO6007 cDNA, wherein SEQ ID NO:215 is a clone
designated herein as "DNA98593-2694".
[0241] FIG. 216 shows the amino acid sequence (SEQ ID NO:216)
derived from the coding sequence of SEQ ID NO:215 shown in FIG.
215.
[0242] FIG. 217 shows a nucleotide sequence (SEQ ID NO:217) of a
native sequence PRO6028 cDNA, wherein SEQ ID NO:217 is a clone
designated herein as "DNA98600-2703".
[0243] FIG. 218 shows the amino acid sequence (SEQ ID NO:218)
derived from the coding sequence of SEQ ID NO:217 shown in FIG.
217.
[0244] FIG. 219 shows a nucleotide sequence (SEQ ID NO:219) of a
native sequence PRO100 cDNA, wherein SEQ ID NO:219 is a clone
designated herein as "DNA99333".
[0245] FIG. 220 shows the amino acid sequence (SEQ ID NO:220)
derived from the coding sequence of SEQ ID NO:219 shown in FIG.
219.
[0246] FIG. 221 shows a nucleotide sequence (SEQ ID NO:221) of a
native sequence PRO4327 cDNA, wherein SEQ ID NO:221 is a clone
designated herein as "DNA99391-2572".
[0247] FIG. 222 shows the amino acid sequence (SEQ ID NO:222)
derived from the coding sequence of SEQ ID NO:221 shown in FIG.
221.
[0248] FIG. 223 shows a nucleotide sequence (SEQ ID NO:223) of a
native sequence PRO4315 cDNA, wherein SEQ ID NO:223 is a clone
designated herein as "DNA99393-2560".
[0249] FIG. 224 shows the amino acid sequence (SEQ ID NO:224)
derived from the coding sequence of SEQ ID NO:223 shown in FIG.
223.
[0250] FIG. 225 shows a nucleotide sequence (SEQ ID NO:225) of a
native sequence PRO5993 cDNA, wherein SEQ ID NO:225 is a clone
designated herein as "DNA100276-2684".
[0251] FIG. 226 shows the amino acid sequence (SEQ ID NO:226)
derived from the coding sequence of SEQ ID NO:225 shown in FIG.
225.
[0252] FIG. 227 shows a nucleotide sequence (SEQ ID NO:227) of a
native sequence PRO4503 cDNA, wherein SEQ ID NO:227 is a clone
designated herein as "DNA100312-2645".
[0253] FIG. 228 shows the amino acid sequence (SEQ ID NO:228)
derived from the coding sequence of SEQ ID NO:227 shown in FIG.
227.
[0254] FIG. 229 shows a nucleotide sequence (SEQ ID NO:229) of a
native sequence PRO4976 cDNA, wherein SEQ ID NO:229 is a clone
designated herein as "DNA100902-2646".
[0255] FIG. 230 shows the amino acid sequence (SEQ ID NO:230)
derived from the coding sequence of SEQ ID NO:229 shown in FIG.
229.
[0256] FIG. 231 shows a nucleotide sequence (SEQ ID NO:231) of a
native sequence PRO5798 cDNA, wherein SEQ ID NO:231 is a clone
designated herein as "DNA102899-2679".
[0257] FIG. 232 shows the amino acid sequence (SEQ ID NO:232)
derived from the coding sequence of SEQ ID NO:231 shown in FIG.
231.
[0258] FIG. 233 shows a nucleotide sequence (SEQ ID NO:233) of a
native sequence PRO6242 cDNA, wherein SEQ ID NO:233 is a clone
designated herein as "DNA104875-2720".
[0259] FIG. 234 shows the amino acid sequence (SEQ ID NO:234)
derived from the coding sequence of SEQ ID NO:233 shown in FIG.
233.
[0260] FIG. 235 shows a nucleotide sequence (SEQ ID NO:235) of a
native sequence PRO6095 cDNA, wherein SEQ ID NO:235 is a clone
designated herein as "DNA105680-2710".
[0261] FIG. 236 shows the amino acid sequence (SEQ ID NO:236)
derived from the coding sequence of SEQ ID NO:235 shown in FIG.
235.
[0262] FIG. 237 shows a nucleotide sequence (SEQ ID NO:237) of a
native sequence PRO6093 cDNA, wherein SEQ ID NO:237 is a clone
designated herein as "DNA105779-2708".
[0263] FIG. 238 shows the amino acid sequence (SEQ ID NO:238)
derived from the coding sequence of SEQ ID NO:237 shown in FIG.
237.
[0264] FIG. 239 shows a nucleotide sequence (SEQ ID NO:239) of a
native sequence PRO6012 cDNA, wherein SEQ ID NO:239 is a clone
designated herein as "DNA105794-2695".
[0265] FIG. 240 shows the amino acid sequence (SEQ ID NO:240)
derived from the coding sequence of SEQ ID NO:239 shown in FIG.
239.
[0266] FIG. 241 shows a nucleotide sequence (SEQ ID NO:241) of a
native sequence PRO6027 cDNA, wherein SEQ ID NO:241 is a clone
designated herein as "DNA105838-2702".
[0267] FIG. 242 shows the amino acid sequence (SEQ ID NO:242)
derived from the coding sequence of SEQ ID NO:241 shown in FIG.
241.
[0268] FIG. 243 shows a nucleotide sequence (SEQ ID NO:243) of a
native sequence PRO6181 cDNA, wherein SEQ ID NO:243 is a clone
designated herein as "DNA107698-2715".
[0269] FIG. 244 shows the amino acid sequence (SEQ ID NO:244)
derived from the coding sequence of SEQ ID NO:243 shown in FIG.
243.
[0270] FIG. 245 shows a nucleotide sequence (SEQ ID NO:245) of a
native sequence PRO6097 cDNA, wherein SEQ ID NO:245 is a clone
designated herein as "DNA107701-2711".
[0271] FIG. 246 shows the amino acid sequence (SEQ ID NO:246)
derived from the coding sequence of SEQ ID NO:245 shown in FIG.
245.
[0272] FIG. 247 shows a nucleotide sequence (SEQ ID NO:247) of a
native sequence PRO6090 cDNA, wherein SEQ ID NO:247 is a clone
designated herein as "DNA107781-2707".
[0273] FIG. 248 shows the amino acid sequence (SEQ ID NO:248)
derived from the coding sequence of SEQ ID NO:247 shown in FIG.
247.
[0274] FIG. 249 shows a nucleotide sequence (SEQ ID NO:249) of a
native sequence PRO7171 cDNA, wherein SEQ ID NO:249 is a clone
designated herein as "DNA108670-2744".
[0275] FIG. 250 shows the amino acid sequence (SEQ ID NO:250)
derived from the coding sequence of SEQ ID NO:249 shown in FIG.
249.
[0276] FIG. 251 shows a nucleotide sequence (SEQ ID NO:251) of a
native sequence PRO6258 cDNA, wherein SEQ ID NO:251 is a clone
designated herein as "DNA108688-2725".
[0277] FIG. 252 shows the amino acid sequence (SEQ ID NO:252)
derived from the coding sequence of SEQ ID NO:251 shown in FIG.
251.
[0278] FIG. 253 shows a nucleotide sequence (SEQ ID NO:253) of a
native sequence PRO9820 cDNA, wherein SEQ ID NO:253 is a clone
designated herein as "DNA108769-2765".
[0279] FIG. 254 shows the amino acid sequence (SEQ ID NO:254)
derived from the coding sequence of SEQ ID NO:253 shown in FIG.
253.
[0280] FIG. 255 shows a nucleotide sequence (SEQ ID NO:255) of a
native sequence PRO6243 cDNA, wherein SEQ ID NO:255 is a clone
designated herein as "DNA108935-2721".
[0281] FIG. 256 shows the amino acid sequence (SEQ ID NO:256)
derived from the coding sequence of SEQ ID NO:255 shown in FIG.
255.
[0282] FIG. 257 shows a nucleotide sequence (SEQ ID NO:257) of a
native sequence PRO6182 cDNA, wherein SEQ ID NO:257 is a clone
designated herein as "DNA110700-2716".
[0283] FIG. 258 shows the amino acid sequence (SEQ ID NO:258)
derived from the coding sequence of SEQ ID NO:257 shown in FIG.
257.
[0284] FIG. 259 shows a nucleotide sequence (SEQ ID NO:259) of a
native sequence PRO6079 cDNA, wherein SEQ ID NO:259 is a clone
designated herein as "DNA111750-2706".
[0285] FIG. 260 shows the amino acid sequence (SEQ ID NO:260)
derived from the coding sequence of SEQ ID NO:259 shown in FIG.
259.
[0286] FIG. 261 shows a nucleotide sequence (SEQ ID NO:261) of a
native sequence PRO7434 cDNA, wherein SEQ ID NO:261 is a clone
designated herein as "DNA123430-2755".
[0287] FIG. 262 shows the amino acid sequence (SEQ ID NO:262)
derived from the coding sequence of SEQ ID NO:261 shown in FIG.
261.
[0288] FIG. 263 shows a nucleotide sequence (SEQ ID NO:263) of a
native sequence PRO9865 cDNA, wherein SEQ ID NO:263 is a clone
designated herein as "DNA125154-2785".
[0289] FIG. 264 shows the amino acid sequence (SEQ ID NO:264)
derived from the coding sequence of SEQ ID NO:263 shown in FIG.
263.
[0290] FIG. 265 shows a nucleotide sequence (SEQ ID NO:265) of a
native sequence PRO9828 cDNA, wherein SEQ ID NO:265 is a clone
designated herein as "DNA142238-2768".
[0291] FIG. 266 shows the amino acid sequence (SEQ ID NO:266)
derived from the coding sequence of SEQ ID NO:265 shown in FIG.
265.
[0292] FIG. 267 shows a nucleotide sequence (SEQ ID NO:267) of a
native sequence PRO196 cDNA, wherein SEQ ID NO:267 is a clone
designated herein as "DNA22779-1130".
[0293] FIG. 268 shows the amino acid sequence (SEQ ID NO:268)
derived from the coding sequence of SEQ ID NO:267 shown in FIG.
267.
[0294] FIG. 269 shows a nucleotide sequence (SEQ ID NO:269) of a
native sequence PRO197 cDNA, wherein SEQ ID NO:269 is a clone
designated herein as "DNA22780-1078".
[0295] FIG. 270 shows the amino acid sequence (SEQ ID NO:270)
derived from the coding sequence of SEQ ID NO:269 shown in FIG.
269.
[0296] FIG. 271 shows a nucleotide sequence (SEQ ID NO:271) of a
native sequence PRO195 cDNA, wherein SEQ ID NO:271 is a clone
designated herein as "DNA26847-1395".
[0297] FIG. 272 shows the amino acid sequence (SEQ ID NO:272)
derived from the coding sequence of SEQ ID NO:271 shown in FIG.
271.
[0298] FIG. 273 shows a nucleotide sequence (SEQ ID NO:273) of a
native sequence PRO187 cDNA, wherein SEQ ID NO:273 is a clone
designated herein as "DNA27864-1155".
[0299] FIG. 274 shows the amino acid sequence (SEQ ID NO:274)
derived from the coding sequence of SEQ ID NO:273 shown in FIG.
273.
[0300] FIG. 275 shows a nucleotide sequence (SEQ ID NO:275) of a
native sequence PRO182 cDNA, wherein SEQ ID NO:275 is a clone
designated herein as "DNA27865-1091".
[0301] FIG. 276 shows the amino acid sequence (SEQ ID NO:276)
derived from the coding sequence of SEQ ID NO:275 shown in FIG.
275.
[0302] FIG. 277 shows a nucleotide sequence (SEQ ID NO:277) of a
native sequence PRO188 cDNA, wherein SEQ ID NO:277 is a clone
designated herein as "DNA28497-1130.
[0303] FIG. 278 shows the amino acid sequence (SEQ ID NO:278)
derived from the coding sequence of SEQ ID NO:277 shown in FIG.
277.
[0304] FIG. 279 shows a nucleotide sequence (SEQ ID NO:279) of a
native sequence PRO183 cDNA, wherein SEQ ID NO:279 is a clone
designated herein as "DNA28498".
[0305] FIG. 280 shows the amino acid sequence (SEQ ID NO:280)
derived from the coding sequence of SEQ ID NO:279 shown in FIG.
279.
[0306] FIG. 281 shows a nucleotide sequence (SEQ ID NO:281) of a
native sequence PRO184 cDNA, wherein SEQ ID NO:281 is a clone
designated herein as "DNA28500".
[0307] FIG. 282 shows the amino acid sequence (SEQ ID NO:282)
derived from the coding sequence of SEQ ID NO: 281 shown in FIG.
281.
[0308] FIG. 283 shows a nucleotide sequence (SEQ ID NO:283) of a
native sequence PRO185 cDNA, wherein SEQ ID NO:283 is a clone
designated herein as "DNA28503".
[0309] FIG. 284 shows the amino acid sequence (SEQ ID NO:284)
derived from the coding sequence of SEQ ID NO:283 shown in FIG.
283.
[0310] FIG. 285 shows a nucleotide sequence (SEQ ID NO:285) of a
native sequence PRO200 cDNA, wherein SEQ ID NO:285 is a clone
designated herein as "DNA29101-1122".
[0311] FIG. 286 shows the amino acid sequence (SEQ ID NO:286)
derived from the coding sequence of SEQ ID NO:285 shown in FIG.
285.
[0312] FIG. 287 shows a nucleotide sequence (SEQ ID NO:287) of a
native sequence PRO202 cDNA, wherein SEQ ID NO:287 is a clone
designated herein as "DNA30869".
[0313] FIG. 288 shows the amino acid sequence (SEQ ID NO:288)
derived from the coding sequence of SEQ ID NO:287 shown in FIG.
287.
[0314] FIG. 289 shows a nucleotide sequence (SEQ ID NO:289) of a
native sequence PRO214 cDNA, wherein SEQ ID NO:289 is a clone
designated herein as "DNA32286-1191".
[0315] FIG. 290 shows the amino acid sequence (SEQ ID NO:290)
derived from the coding sequence of SEQ ID NO:289 shown in FIG.
289.
[0316] FIG. 291 shows a nucleotide sequence (SEQ ID NO:291) of a
native sequence PRO215 cDNA, wherein SEQ ID NO:291 is a clone
designated herein as "DNA32288-1132".
[0317] FIG. 292 shows the amino acid sequence (SEQ ID NO:292)
derived from the coding sequence of SEQ ID NO:291 shown in FIG.
291.
[0318] FIG. 293 shows a nucleotide sequence (SEQ ID NO:293) of a
native sequence PRO219 cDNA, wherein SEQ ID NO:293 is a clone
designated herein as "DNA32290-1164".
[0319] FIG. 294 shows dh aacid sequence (SEQ ID NO:294) derived
from the coding sequence of SEQ ID NO:293 shown in FIG. 293.
[0320] FIG. 295 shows a nucle sqnce (SEQ ID NO:295) of a native
sequence PRO211 cDNA, wherein SEQ ID NO:295 is a clone designated
herein as "DNA32292-1131".
[0321] FIG. 296 shows the amino acid sequence (SEQ ID NO:296)
derived from f codingsequenceofSEQ ID NO:295 shown in FIG. 295.
[0322] FIG. 297 shows a nucloctde sequence (SEQ ID NO:297) of a
native sequence PRO220 cDNA, wherein SEQ ID NO:297 is a cloneded
herein as "DNA322981132".
[0323] FIG. 298 shows the amino add sequence (SEQ ID NO:298)
derived from the coding sequence of SEQ ID NO:297 shown in FIG.
297.
[0324] FIG. 299 shows a nucleotide sequence (SEQ ID NO:299) of a
native sequence PRO366 cDNA, wherein SEQ ID NO:299 b a clone
delegate herein "DNA33085-1110".
[0325] FIG. 300 shows the acid sequence (SEQ ID NO:300) derived
from the coding sequence of SEQ ID NO:299 shown in FIG. 299.
[0326] FIG. 301 shows a nucleotide sequence (SEQ ID NO:301) of a
native sequence PRO216 cDNA, wherein SEQ ID NO:301 is a clone
designated herein as "DNA33087-1158".
[0327] FIG. 302 shows the amino acid sequence (SEQ ID NO:302)
derived from the coding sequence of SEQ ID NO:301 shown FIG.
301.
[0328] FIG. 303 shows a nucleotide sequence (SEQ ID NO:303) of a
native sequence PRO221 cDNA, wherein SEQ ID NO:303 is a clone
designated herein as "DNA33089-1132".
[0329] FIG. 304 shows the amino acid sequence (SEQ ID NO:304)
derived from the coding sequence of SEQ ID NO:303 shown in FIG.
303.
[0330] FIG. 305 shows a nucleotide sequence (SEQ ID NO:305) of a
native sequence PRO228 cDNA, wherein SEQ ID NO:305 is a clone
designated herein as -DNA33092-1202".
[0331] FIG. 306 shows the amino acid sequence (SEQ ID NO:306)
derived from the coding sequence of SEQ ID NO:305 shown in FIG.
305.
[0332] FIG. 307 shows a nucleotide sequence (SEQ ID NO:307) of a
native sequence PRO217 cDNA, wherein SEQ ID NO:307 is a clone
designated are as "DNA33094-1131".
[0333] FIG. 308 shows the amino acid sequence (SEQ ID NO:308)
derived from the coding sequence of SEQ ID NO:307 shown in FIG.
307.
[0334] FIG. 309 shows a nucleotide sequence (SEQ ID NO:309) of a
native sequence PRO222 cDNA, wherein SEQ ID NO:309 is a clone
designated herein as "DNA33107-1135".
[0335] FIG. 310 shows the amino acid sequence (SEQ ID NO:310)
derived from the coding sequence of SEQ ID NO:309 shown in FIG.
309.
[0336] FIG. 311 shows a nucleotide sequence (SEQ ID NO:311) of a
native sequence PRO224 cDNA, wherein SEQ ID NO:311 is a clone
designated herein as "DNA33221-1133".
[0337] FIG. 312 shows the amino acid sequence (SEQ ID NO:312)
derived from the coding sequence of SEQ ID NO:311 shown in FIG.
311.
[0338] FIG. 313 shows a nucleotide sequence (SEQ ID NO:313) of a
native sequence PRO230 cDNA, wherein SEQ ID NO:313 is a clone
designated herein as "DNA33223-1136".
[0339] FIG. 314 shows the amino acid sequence (SEQ ID NO:314)
derived from the coding sequence of SEQ ID NO:313 shown in FIG.
313.
[0340] FIG. 315 shows a nucleotide sequence (SEQ ID NO:315) of a
native sequence PRO198 cDNA, wherein SEQ ID NO:315 is a clone
designated herein as "DNA33457-1078".
[0341] FIG. 316 shows the amino acid sequence (SEQ ID NO:316)
derived from the coding sequence of SEQ ID NO:315 shown in FIG.
315.
[0342] FIG. 317 shows a nucleotide sequence (SEQ ID NO:317) of a
native sequence PRO226 cDNA, wherein SEQ ID NO:317 is a clone
designated herein as "DNA33460-1166".
[0343] FIG. 318 shows the amino acid sequence (SEQ ID NO:318)
derived from the coding sequence of SEQ ID NO:317 shown in FIG.
317.
[0344] FIG. 319 shows a nucleotide sequence (SEQ ID NO:319) of a
native sequence PRO261 cDNA, wherein SEQ ID NO:319 is a clone
designated herein as "DNA33473-1176".
[0345] FIG. 320 shows the amino acid sequence (SEQ ID NO:320)
derived from the coding sequence of SEQ ID NO:319 shown in FIG.
319.
[0346] FIG. 321 shows a nucleotide sequence (SEQ ID NO:321) of a
native sequence PRO242 cDNA, wherein SEQ ID NO:321 is a clone
designated herein as "DNA33785-1143".
[0347] FIG. 322 shows the amino acid sequence (SEQ ID NO:322)
derived from the coding sequence of SEQ ID NO:321 shown in FIG.
321.
[0348] FIG. 323 shows a nucleotide sequence (SEQ ID NO:323) of a
native sequence PRO227 cDNA, wherein SEQ ID NO:323 is a clone
designated herein as "DNA33786-1132".
[0349] FIG. 324 shows the amino acid sequence (SEQ ID NO:324)
derived from the coding sequence of SEQ ID NO:323 shown in FIG.
323.
[0350] FIG. 325 shows a nucleotide sequence (SEQ ID NO:325) of a
native sequence PRO237 cDNA, wherein SEQ ID NO:325 is a clone
designated herein as "DNA34353-1428".
[0351] FIG. 326 shows the amino acid sequence (SEQ ID NO:326)
derived from the coding sequence of SEQ ID NO:325 shown in FIG.
325.
[0352] FIG. 327 shows a nucleotide sequence (SEQ ID NO:327) of a
native sequence PRO241 cDNA, wherein SEQ ID NO:327 is a clone
designated herein as "DNA34392-1170".
[0353] FIG. 328 shows the amino acid sequence (SEQ ID NO:328)
derived from the coding sequence of SEQ ID NO:327 shown in FIG.
327.
[0354] FIG. 329 shows a nucleotide sequence (SEQ ID NO:329) of a
native sequence PRO231 cDNA, wherein SEQ ID NO:329 is a clone
designated herein as "DNA34434-1139".
[0355] FIG. 330 shows the amino acid sequence (SEQ ID NO:330)
derived from the coding sequence of SEQ ID NO:329 shown in FIG.
329.
[0356] FIG. 331 shows a nucleotide sequence (SEQ ID NO:331) of a
native sequence PRO235 cDNA, wherein SEQ ID NO:331 is a clone
designated herein as "DNA35558-1167".
[0357] FIG. 332 shows the amino acid sequence (SEQ ID NO:332)
derived from the coding sequence of SEQ ID NO:331 shown in FIG.
331.
[0358] FIG. 333 shows a nucleotide sequence (SEQ ID NO:333) of a
native sequence PRO323 cDNA, wherein SEQ ID NO:333 is a clone
designated herein as "DNA35595-1228".
[0359] FIG. 334 shows the amino acid sequence (SEQ ID NO:334)
derived from the coding sequence of SEQ ID NO:333 shown in FIG.
333.
[0360] FIG. 335 shows a nucleotide sequence (SEQ ID NO:335) of a
native sequence PRO245 cDNA, wherein SEQ ID NO:335 is a clone
designated herein as "DNA35638-1216".
[0361] FIG. 336 shows the amino acid sequence (SEQ ID NO:336)
derived from the coding sequence of SEQ ID NO:335 shown in FIG.
335.
[0362] FIG. 337 shows a nucleotide sequence (SEQ ID NO:337) of a
native sequence PRO246 cDNA, wherein SEQ ID NO:337 is a clone
designated herein as "DNA35639-1172".
[0363] FIG. 338 shows the amino acid sequence (SEQ ID NO:338)
derived from the coding sequence of SEQ ID NO:337 shown in FIG.
337.
[0364] FIG. 339 shows a nucleotide sequence (SEQ ID NO:339) of a
native sequence PRO288 cDNA, wherein SEQ ID NO:339 is a clone
designated herein as "DNA35663-1129".
[0365] FIG. 340 shows the amino acid sequence (SEQ ID NO:340)
derived from the coding sequence of SEQ ID NO:339 shown in FIG.
339.
[0366] FIG. 341 shows a nucleotide sequence (SEQ ID NO:341) of a
native sequence PRO248 cDNA, wherein SEQ ID NO:341 is a clone
designated herein as "DNA35674-1142".
[0367] FIG. 342 shows the amino acid sequence (SEQ ID NO:342)
derived from the coding sequence of SEQ ID NO:341 shown in FIG.
341.
[0368] FIG. 343 shows a nucleotide sequence (SEQ ID NO:343) of a
native sequence PRO257 cDNA, wherein SEQ ID NO:343 is a clone
designated herein as "DNA35841-1173".
[0369] FIG. 344 shows the amino acid sequence (SEQ ID NO:344)
derived from the coding sequence of SEQ ID NO:343 shown in FIG.
343.
[0370] FIG. 345 shows a nucleotide sequence (SEQ ID NO:345) of a
native sequence PRO172 cDNA, wherein SEQ ID NO:345 is a clone
designated herein as "DNA35916-1161 ".
[0371] FIG. 346 shows the amino acid sequence (SEQ ID NO:346)
derived from the coding sequence of SEQ ID NO:345 shown in FIG.
345.
[0372] FIG. 347 shows a nucleotide sequence (SEQ ID NO:347) of a
native sequence PRO258 cDNA, wherein SEQ ID NO:347 is a clone
designated herein as "DNA35918-1174".
[0373] FIG. 348 shows the amino acid sequence (SEQ ID NO:348)
derived from the coding sequence of SEQ ID NO:347 shown in FIG.
347.
[0374] FIG. 349 shows a nucleotide sequence (SEQ ID NO:349) of a
native sequence PRO265 cDNA, wherein SEQ ID NO:349 is a clone
designated herein as "DNA36350-1158".
[0375] FIG. 350 shows the amino acid sequence (SEQ ID NO:350)
derived from the coding sequence of SEQ ID NO:349 shown in FIG.
349.
[0376] FIG. 351 shows a nucleotide sequence (SEQ ID NO:351) of a
native sequence PRO326 cDNA, wherein SEQ ID NO:351 is a clone
designated herein as "DNA37140-1234".
[0377] FIG. 352 shows the amino acid sequence (SEQ ID NO:352)
derived from the coding sequence of SEQ ID NO:351 shown in FIG.
351.
[0378] FIG. 353 shows a nucleotide sequence (SEQ ID NO:353) of a
native sequence PRO266 cDNA, wherein SEQ ID NO:353 is a clone
designated herein as "DNA37150-1178".
[0379] FIG. 354 shows the amino acid sequence (SEQ ID NO:354)
derived from the coding sequence of SEQ ID NO:353 shown in FIG.
353.
[0380] FIG. 355 shows a nucleotide sequence (SEQ ID NO:355) of a
native sequence PRO269 cDNA, wherein SEQ ID NO:355 is a clone
designated herein as "DNA38260-1180".
[0381] FIG. 356 shows the amino acid sequence (SEQ ID NO:356)
derived from the coding sequence of SEQ ID NO:355 shown in FIG.
355.
[0382] FIG. 357 shows a nucleotide sequence (SEQ ID NO:357) of a
native sequence PRO285 cDNA, wherein SEQ ID NO:357 is a clone
designated herein as "DNA40021-1154".
[0383] FIG. 358 shows the amino acid sequence (SEQ ID NO:358)
derived from the coding sequence of SEQ ID NO:357 shown in FIG.
357.
[0384] FIG. 359 shows a nucleotide sequence (SEQ ID NO:359) of a
native sequence PRO328 cDNA, wherein SEQ ID NO:359 is a clone
designated herein as "DNA40587-1231".
[0385] FIG. 360 shows the amino acid sequence (SEQ ID NO:360)
derived from the coding sequence of SEQ ID NO:359 shown in FIG.
359.
[0386] FIG. 361 shows a nucleotide sequence (SEQ ID NO:361) of a
native sequence PRO344 cDNA, wherein SEQ ID NO:361 is a clone
designated herein as "DNA40592-1242".
[0387] FIG. 362 shows the amino acid sequence (SEQ ID NO:362)
derived from the coding sequence of SEQ ID NO:361 shown in FIG.
361.
[0388] FIG. 363 shows a nucleotide sequence (SEQ ID NO:363) of a
native sequence PRO272 cDNA, wherein SEQ ID NO:363 is a clone
designated herein as "DNA40620-1183".
[0389] FIG. 364 shows the amino acid sequence (SEQ ID NO:364)
derived from the coding sequence of SEQ ID NO:363 shown in FIG.
363.
[0390] FIG. 365 shows a nucleotide sequence (SEQ ID NO:365) of a
native sequence PRO301 cDNA, wherein SEQ ID NO:365 is a clone
designated herein as "DNA40628-1216".
[0391] FIG. 366 shows the amino acid sequence (SEQ ID NO:366)
derived from the coding sequence of SEQ ID NO:365 shown in FIG.
365.
[0392] FIG. 367 shows a nucleotide sequence (SEQ ID NO:367) of a
native sequence PRO331 cDNA, wherein SEQ ID NO:367 is a clone
designated herein as "DNA40981-1234".
[0393] FIG. 368 shows the amino acid sequence (SEQ ID NO:368)
derived from the coding sequence of SEQ ID NO:367 shown in FIG.
367.
[0394] FIG. 369 shows a nucleotide sequence (SEQ ID NO:369) of a
native sequence PRO332 cDNA, wherein SEQ ID NO:369 is a clone
designated herein as "DNA40982-1235".
[0395] FIG. 370 shows the amino acid sequence (SEQ ID NO:370)
derived from the coding sequence of SEQ ID NO:369 shown in FIG.
369.
[0396] FIG. 371 shows a nucleotide sequence (SEQ ID NO:371) of a
native sequence PRO353 cDNA, wherein SEQ ID NO:371 is a clone
designated herein as "DNA41234-1242".
[0397] FIG. 372 shows the amino acid sequence (SEQ ID NO:372)
derived from the coding sequence of SEQ ID NO:371 shown in FIG.
371.
[0398] FIG. 373 shows a nucleotide sequence (SEQ ID NO:373) of a
native sequence PRO310 cDNA, wherein SEQ ID NO:373 is a clone
designated herein as "DNA43046-1225".
[0399] FIG. 374 shows the amino acid sequence (SEQ ID NO:374)
derived from the coding sequence of SEQ ID NO:373 shown in FIG.
373.
[0400] FIG. 375 shows a nucleotide sequence (SEQ ID NO:375) of a
native sequence PRO337 cDNA, wherein SEQ ID NO:375 is a clone
designated herein as "DNA43316-1237".
[0401] FIG. 376 shows the amino acid sequence (SEQ ID NO:376)
derived from the coding sequence of SEQ ID NO:375 shown in FIG.
375.
[0402] FIG. 377 shows a nucleotide sequence (SEQ ID NO:377) of a
native sequence PRO346 cDNA, wherein SEQ ID NO:377 is a clone
designated herein as "DNA44167-1243".
[0403] FIG. 378 shows the amino acid sequence (SEQ ID NO:378)
derived from the coding sequence of SEQ ID NO:377 shown in FIG.
377.
[0404] FIG. 379 shows a nucleotide sequence (SEQ ID NO:379) of a
native sequence PRO350 cDNA, wherein SEQ ID NO:379 is a clone
designated herein as "DNA44175-1314".
[0405] FIG. 380 shows the amino acid sequence (SEQ ID NO:380)
derived from the coding sequence of SEQ ID NO:379 shown in FIG.
379.
[0406] FIG. 381 shows a nucleotide sequence (SEQ ID NO:381) of a
native sequence PRO526 cDNA, wherein SEQ ID NO:381 is a clone
designated herein as "DNA44184-1319".
[0407] FIG. 382 shows the amino acid sequence (SEQ ID NO:382)
derived from the coding sequence of SEQ ID NO:381 shown in FIG.
381.
[0408] FIG. 383 shows a nucleotide sequence (SEQ ID NO:383) of a
native sequence PRO381 cDNA, wherein SEQ ID NO:383 is a clone
designated herein as "DNA44194-1317".
[0409] FIG. 384 shows the amino acid sequence (SEQ ID NO:384)
derived from the coding sequence of SEQ ID NO:383 shown in FIG.
383.
[0410] FIG. 385 shows a nucleotide sequence (SEQ ID NO:385) of a
native sequence PRO846 cDNA, wherein SEQ ID NO:385 is a clone
designated herein as "DNA44196-1353".
[0411] FIG. 386 shows the amino acid sequence (SEQ ID NO:386)
derived from the coding sequence of SEQ ID NO:385 shown in FIG.
385.
[0412] FIG. 387 shows a nucleotide sequence (SEQ ID NO:387) of a
native sequence PRO363 cDNA, wherein SEQ ID NO:387 is a clone
designated herein as "DNA45419-1252".
[0413] FIG. 388 shows the amino acid sequence (SEQ ID NO:388)
derived from the coding sequence of SEQ ID NO:387 shown in FIG.
387.
[0414] FIG. 389 shows a nucleotide sequence (SEQ ID NO:389) of a
native sequence PRO3,65 cDNA, wherein SEQ ID NO:389 is a clone
designated herein as "DNA46777-1253".
[0415] FIG. 390 shows the amino acid sequence (SEQ ID NO:390)
derived from the coding sequence of SEQ ID NO:389 shown in FIG.
389.
[0416] FIG. 391 shows a nucleotide sequence (SEQ ID NO:391) of a
native sequence PRO1310 cDNA, wherein SEQ ID NO:391 is a clone
designated herein as "DNA47394-1572".
[0417] FIG. 392 shows the amino acid sequence (SEQ ID NO:392)
derived from the coding sequence of SEQ ID NO:391 shown in FIG.
391.
[0418] FIG. 393 shows a nucleotide sequence (SEQ ID NO:393) of a
native sequence PRO731 cDNA, wherein SEQ ID NO:393 is a clone
designated herein as "DNA48331-1329".
[0419] FIG. 394 shows the amino acid sequence (SEQ ID NO:394)
derived from the coding sequence of SEQ ID NO:393 shown in FIG.
393.
[0420] FIG. 395 shows a nucleotide sequence (SEQ ID NO:395) of a
native sequence PRO322 cDNA, wherein SEQ ID NO:395 is a clone
designated herein as "DNA48336-1309".
[0421] FIG. 396 shows the amino acid sequence (SEQ ID NO:396)
derived from the coding sequence of SEQ ID NO:395 shown in FIG.
395.
[0422] FIG. 397 shows a nucleotide sequence (SEQ ID NO:397) of a
native sequence PRO536 cDNA, wherein SEQ ID NO:397 is a clone
designated herein as "DNA49142-1430".
[0423] FIG. 398 shows the amino acid sequence (SEQ ID NO:398)
derived from the coding sequence of SEQ ID NO:397 shown in FIG.
397.
[0424] FIG. 399 shows a nucleotide sequence (SEQ ID NO:399) of a
native sequence PRO719 cDNA, wherein SEQ ID NO:399 is a clone
designated herein as "DNA49646-1327".
[0425] FIG. 400 shows the amino acid sequence (SEQ ID NO:400)
derived from the coding sequence of SEQ ID NO:399 shown in FIG.
399.
[0426] FIG. 401 shows a nucleotide sequence (SEQ ID NO:401) of a
native sequence PRO619 cDNA, wherein SEQ ID NO:401 is a clone
designated herein as "DNA49821-1562".
[0427] FIG. 402 shows the amino acid sequence (SEQ ID NO:402)
derived from the coding sequence of SEQ ID NO:401 shown in FIG.
401.
[0428] FIG. 403 shows a nucleotide sequence (SEQ ID NO:403) of a
native sequence PRO771 cDNA, wherein SEQ ID NO:403 is a clone
designated herein as "DNA49829-1346".
[0429] FIG. 404 shows the amino acid sequence (SEQ ID NO:404)
derived from the coding sequence of SEQ ID NO:403 shown in FIG.
403.
[0430] FIG. 405 shows a nucleotide sequence (SEQ ID NO:405) of a
native sequence PRO1083 cDNA, wherein SEQ ID NO:405 is a clone
designated herein as "DNA50921-1458".
[0431] FIG. 406 shows the amino acid sequence (SEQ ID NO:406)
derived from the coding sequence of SEQ ID NO:405 shown in FIG.
405.
[0432] FIG. 407 shows a nucleotide sequence (SEQ ID NO:407) of a
native sequence PRO862 cDNA, wherein SEQ ID NO:407 is a clone
designated herein as "DNA52187-1354".
[0433] FIG. 408 shows the amino acid sequence (SEQ ID NO:408)
derived from the coding sequence of SEQ ID NO:407 shown in FIG.
407.
[0434] FIG. 409 shows a nucleotide sequence (SEQ ID NO:409) of a
native sequence PRO733 cDNA, wherein SEQ ID NO:409 is a clone
designated herein as "DNA52196-1348".
[0435] FIG. 410 shows the amino acid sequence (SEQ ID NO:410)
derived from the coding sequence of SEQ ID NO:409 shown in FIG.
409.
[0436] FIG. 411 shows a nucleotide sequence (SEQ ID NO:411) of a
native sequence PRO1188 cDNA, wherein SEQ ID NO:411 is a clone
designated herein as "DNA52598-1518".
[0437] FIG. 412 shows the amino acid sequence (SEQ ID NO:412)
derived from the coding sequence of SEQ ID NO:411 shown in FIG.
411.
[0438] FIG. 413 shows a nucleotide sequence (SEQ ID NO:413) of a
native sequence PRO770 cDNA, wherein SEQ ID NO:413 is a clone
designated herein as "DNA54228-1366".
[0439] FIG. 414 shows the amino acid sequence (SEQ ID NO:414)
derived from the coding sequence of SEQ ID NO:413 shown in FIG.
413.
[0440] FIG. 415 shows a nucleotide sequence (SEQ ID NO:415) of a
native sequence PRO1080 cDNA, wherein SEQ ID NO:415 is a clone
designated herein as "DNA56047-1456".
[0441] FIG. 416 shows the amino acid sequence (SEQ ID NO:416)
derived from the coding sequence of SEQ ID NO:415 shown in FIG.
415.
[0442] FIG. 417 shows a nucleotide sequence (SEQ ID NO:417) of a
native sequence PRO1017 cDNA, wherein SEQ ID NO:417 is a clone
designated herein as "DNA56112-1379".
[0443] FIG. 418 shows the amino acid sequence (SEQ ID NO:418)
derived from the coding sequence of SEQ ID NO:417 shown in FIG.
417.
[0444] FIG. 419 shows a nucleotide sequence (SEQ ID NO:419) of a
native sequence PRO1016 cDNA, wherein SEQ ID NO:419 is a clone
designated herein as "DNA56113-1378".
[0445] FIG. 420 shows the amino acid sequence (SEQ ID NO:420)
derived from the coding sequence of SEQ ID NO:419 shown in FIG.
419.
[0446] FIG. 421 shows a nucleotide sequence (SEQ ID NO:421) of a
native sequence PRO792 cDNA, wherein SEQ ID NO:421 is a clone
designated herein as "DNA56352-1358".
[0447] FIG. 422 shows the amino acid sequence (SEQ ID NO:422)
derived from the coding sequence of SEQ ID NO:421 shown in FIG.
421.
[0448] FIG. 423 shows a nucleotide sequence (SEQ ID NO:423) of a
native sequence PRO938 cDNA, wherein SEQ ID NO:423 is a clone
designated herein as "DNA56433-1406".
[0449] FIG. 424 shows the amino acid sequence (SEQ ID NO:424)
derived from the coding sequence of SEQ ID NO:423 shown in FIG.
423.
[0450] FIG. 425 shows a nucleotide sequence (SEQ ID NO:425) of a
native sequence PRO1012 cDNA, wherein SEQ ID NO:425 is a clone
designated herein as "DNA56439-1376".
[0451] FIG. 426 shows the amino acid sequence (SEQ ID NO:426)
derived from the coding sequence of SEQ ID NO:425 shown in FIG.
425.
[0452] FIG. 427 shows a nucleotide sequence (SEQ ID NO:427) of a
native sequence PRO1008 cDNA, wherein SEQ ID NO:427 is a clone
designated herein as "DNA57530-1375".
[0453] FIG. 428 shows the amino acid sequence (SEQ ID NO:428)
derived from the coding sequence of SEQ ID NO:427 shown in FIG.
427.
[0454] FIG. 429 shows a nucleotide sequence (SEQ ID NO:429) of a
native sequence PRO1075 cDNA, wherein SEQ ID NO:429 is a clone
designated herein as "DNA57689-1385".
[0455] FIG. 430 shows the amino acid sequence (SEQ ID NO:430)
derived from the coding sequence of SEQ ID NO:429 shown in FIG.
429.
[0456] FIG. 431 shows a nucleotide sequence (SEQ ID NO:431) of a
native sequence PRO1007 cDNA, wherein SEQ ID NO:431 is a clone
designated herein as "DNA57690-1374".
[0457] FIG. 432 shows the amino acid sequence (SEQ ID NO:432)
derived from the coding sequence of SEQ ID NO:431 shown in FIG.
431.
[0458] FIG. 433 shows a nucleotide sequence (SEQ ID NO:433) of a
native sequence PRO1056 cDNA, wherein SEQ ID NO:433 is a clone
designated herein as "DNA57693-1424".
[0459] FIG. 434 shows the amino acid sequence (SEQ ID NO:434)
derived from the coding sequence of SEQ ID NO:433 shown in FIG.
433.
[0460] FIG. 435 shows a nucleotide sequence (SEQ ID NO:435) of a
native sequence PRO791 cDNA, wherein SEQ ID NO:435 is a clone
designated herein as "DNA57838-1337".
[0461] FIG. 436 shows the amino acid sequence (SEQ ID NO:436)
derived from the coding sequence of SEQ ID NO:435 shown in FIG.
435.
[0462] FIG. 437 shows a nucleotide sequence (SEQ ID NO:437) of a
native sequence PRO111 cDNA, wherein SEQ ID NO:437 is a clone
designated herein as "DNA58721-1475".
[0463] FIG. 438 shows the amino acid sequence (SEQ ID NO:438)
derived from the coding sequence of SEQ ID NO:437 shown in FIG.
437.
[0464] FIG. 439 shows a nucleotide sequence (SEQ ID NO:439) of a
native sequence PRO812 cDNA, wherein SEQ ID NO:439 is a clone
designated herein as "DNA59205-1421".
[0465] FIG. 440 shows the amino acid sequence (SEQ ID NO:440)
derived from the coding sequence of SEQ ID NO:439 shown in FIG.
439.
[0466] FIG. 441 shows a nucleotide sequence (SEQ ID NO:441) of a
native sequence PRO1066 cDNA, wherein SEQ ID NO:441 is a clone
designated herein as "DNA59215-1425".
[0467] FIG. 442 shows the amino acid sequence (SEQ ID NO:442)
derived from the coding sequence of SEQ ID NO:441 shown in FIG.
441.
[0468] FIG. 443 shows a nucleotide sequence (SEQ ID NO:443) of a
native sequence PRO1185 cDNA, wherein SEQ ID NO:443 is a clone
designated herein as "DNA59220-1514".
[0469] FIG. 444 shows the amino acid sequence (SEQ ID NO:444)
derived from the coding sequence of SEQ ID NO:443 shown in FIG.
443.
[0470] FIG. 445 shows a nucleotide sequence (SEQ ID NO:445) of a
native sequence PRO1031 cDNA, wherein SEQ ID NO:445 is a clone
designated herein as "DNA59294-1381".
[0471] FIG. 446 shows the amino acid sequence (SEQ ID NO:446)
derived from the coding sequence of SEQ ID NO:445 shown in FIG.
445.
[0472] FIG. 447 shows a nucleotide sequence (SEQ ID NO:447) of a
native sequence PRO1360 cDNA, wherein SEQ ID NO:447 is a clone
designated herein as "DNA59488-1603".
[0473] FIG. 448 shows the amino acid sequence (SEQ ID NO:448)
derived from the coding sequence of SEQ ID NO:447 shown in FIG.
447.
[0474] FIG. 449 shows a nucleotide sequence (SEQ ID NO:449) of a
native sequence PRO1309 cDNA, wherein SEQ ID NO:449 is a clone
designated herein as "DNA59588-1571".
[0475] FIG. 450 shows the amino acid sequence (SEQ ID NO:450)
derived from the coding sequence of SEQ ID NO:449 shown in FIG.
449.
[0476] FIG. 451 shows a nucleotide sequence (SEQ ID NO:451) of a
native sequence PRO1107 cDNA, wherein SEQ ID NO:451 is a clone
designated herein as "DNA59606-1471".
[0477] FIG. 452 shows the amino acid sequence (SEQ ID NO:452)
derived from the coding sequence of SEQ ID NO:451 shown in FIG.
451.
[0478] FIG. 453 shows a nucleotide sequence (SEQ ID NO:453) of a
native sequence PRO836 cDNA, wherein SEQ ID NO:453 is a clone
designated herein as "DNA59620-1463 ".
[0479] FIG. 454 shows the amino acid sequence (SEQ ID NO:454)
derived from the coding sequence of SEQ ID NO:453 shown in FIG.
453.
[0480] FIG. 455 shows a nucleotide sequence (SEQ ID NO:455) of a
native sequence PROL 132 cDNA, wherein SEQ ID NO:455 is a clone
designated herein as "DNA59767-1489".
[0481] FIG. 456 shows the amino acid sequence (SEQ ID NO:456)
derived from the coding sequence of SEQ ID NO:455 shown in FIG.
455.
[0482] FIG. 457 shows a nucleotide sequence (SEQ ID NO:457) of a
native sequence PRO1131 cDNA, wherein SEQ ID NO:457 is a clone
designated herein as "DNA59777-1480".
[0483] FIG. 458 shows the amino acid sequence (SEQ ID NO:458)
derived from the coding sequence of SEQ ID NO:457 shown in FIG.
457.
[0484] FIG. 459 shows a nucleotide sequence (SEQ ID NO:459) of a
native sequence PRO1130 cDNA, wherein SEQ ID NO:459 is a clone
designated herein as "DNA59814-1486".
[0485] FIG. 460 shows the amino acid sequence (SEQ ID NO:460)
derived from the coding sequence of SEQ ID NO:459 shown in FIG.
459.
[0486] FIG. 461 shows a nucleotide sequence (SEQ ID NO:461) of a
native sequence PRO844 cDNA, wherein SEQ ID NO:461 is a clone
designated herein as "DNA59839-1461".
[0487] FIG. 462 shows the amino acid sequence (SEQ ID NO:462)
derived from the coding sequence of SEQ ID NO:461 shown in FIG.
461.
[0488] FIG. 463 shows a nucleotide sequence (SEQ ID NO:463) of a
native sequence PRO1154 cDNA, wherein SEQ ID NO:463 is a clone
designated herein as "DNA59846-1503".
[0489] FIG. 464 shows the amino acid sequence (SEQ ID NO:464)
derived from the coding sequence of SEQ ID NO:463 shown in FIG.
463.
[0490] FIG. 465 shows a nucleotide sequence (SEQ ID NO:465) of a
native sequence PRO1181 cDNA, wherein SEQ ID NO:465 is a clone
designated herein as "DNA59847-1511".
[0491] FIG. 466 shows the amino acid sequence (SEQ ID NO:466)
derived from the coding sequence of SEQ ID NO:465 shown in FIG.
465.
[0492] FIG. 467 shows a nucleotide sequence (SEQ ID NO:467) of a
native sequence PRO1126 cDNA, wherein SEQ ID NO:467 is a clone
designated herein as "DNA60615-1483".
[0493] FIG. 468 shows the amino acid sequence (SEQ ID NO:468)
derived from the coding sequence of SEQ ID NO:467 shown in FIG.
467.
[0494] FIG. 469 shows a nucleotide sequence (SEQ ID NO:469) of a
native sequence PRO1186 cDNA, wherein SEQ ID NO:469 is a clone
designated herein as "DNA60621-1516".
[0495] FIG. 470 shows the amino acid sequence (SEQ ID NO:470)
derived from the coding sequence of SEQ ID NO:469 shown in FIG.
469.
[0496] FIG. 471 shows a nucleotide sequence (SEQ ID NO:471) of a
native sequence PRO1198 cDNA, wherein SEQ ID NO:471 is a clone
designated herein as "DNA60622-1525".
[0497] FIG. 472 shows the amino acid sequence (SEQ ID NO:472)
derived from the coding sequence of SEQ ID NO:471 shown in FIG.
471.
[0498] FIG. 473 shows a nucleotide sequence (SEQ ID NO:473) of a
native sequence PRO1159 cDNA, wherein SEQ ID NO:473 is a clone
designated herein as "DNA60627-1508".
[0499] FIG. 474 shows the amino acid sequence (SEQ ID NO:474)
derived from the coding sequence of SEQ ID NO:473 shown in FIG.
473.
[0500] FIG. 475 shows a nucleotide sequence (SEQ ID NO:475) of a
native sequence PRO1265 cDNA, wherein SEQ ID NO:475 is a clone
designated herein as "DNA60764-1533".
[0501] FIG. 476 shows the amino acid sequence (SEQ ID NO:476)
derived from the coding sequence of SEQ ID NO:475 shown in FIG.
475.
[0502] FIG. 477 shows a nucleotide sequence (SEQ ID NO:477) of a
native sequence PRO1250 cDNA, wherein SEQ ID NO:477 is a clone
designated herein as "DNA60775-1532".
[0503] FIG. 478 shows the amino acid sequence (SEQ ID NO:478)
derived from the coding sequence of SEQ ID NO:477 shown in FIG.
477.
[0504] FIG. 479 shows a nucleotide sequence (SEQ ID NO:479) of a
native sequence PRO1475 cDNA, wherein SEQ ID NO:479 is a clone
designated herein as "DNA61185-1646".
[0505] FIG. 480 shows the amino acid sequence (SEQ ID NO:480)
derived from the coding sequence of SEQ ID NO:479 shown in FIG.
479.
[0506] FIG. 481 shows a nucleotide sequence (SEQ ID NO:481) of a
native sequence PRO1312 cDNA, wherein SEQ ID NO:481 is a clone
designated herein as "DNA61873-1574".
[0507] FIG. 482 shows the amino acid sequence (SEQ ID NO:482)
derived from the coding sequence of SEQ ID NO:481 shown in FIG.
481.
[0508] FIG. 483 shows a nucleotide sequence (SEQ ID NO:483) of a
native sequence PRO1308 cDNA, wherein SEQ ID NO:483 is a clone
designated herein as "DNA62306-1570".
[0509] FIG. 484 shows the amino acid sequence (SEQ ID NO:484)
derived from the coding sequence of SEQ ID NO:483 shown in FIG.
483.
[0510] FIG. 485 shows a nucleotide sequence (SEQ ID NO:485) of a
native sequence PRO1326 cDNA, wherein SEQ ID NO:485 is a clone
designated herein as "DNA62808-1582".
[0511] FIG. 486 shows the amino acid sequence (SEQ ID NO:486)
derived from the coding sequence of SEQ ID NO:485 shown in FIG.
485.
[0512] FIG. 487 shows a nucleotide sequence (SEQ ID NO:487) of a
native sequence PRO1192 cDNA, wherein SEQ ID NO:487 is a clone
designated herein as "DNA62814-1521 ".
[0513] FIG. 488 shows the amino acid sequence (SEQ ID NO:488)
derived from the coding sequence of SEQ ID NO:487 shown in FIG.
487.
[0514] FIG. 489 shows a nucleotide sequence (SEQ ID NO:489) of a
native sequence PRO1246 cDNA, wherein SEQ ID NO:489 is a clone
designated herein as "DNA64885-1529".
[0515] FIG. 490 shows the amino acid sequence (SEQ ID NO:490)
derived from the coding sequence of SEQ ID NO:489 shown in FIG.
489.
[0516] FIG. 491 shows a nucleotide sequence (SEQ ID NO:491) of a
native sequence PRO1356 cDNA, wherein SEQ ID NO:491 is a clone
designated herein as "DNA64886-1601".
[0517] FIG. 492 shows the amino acid sequence (SEQ ID NO:492)
derived from the coding sequence of SEQ ID NO:491 shown in FIG.
491.
[0518] FIG. 493 shows a nucleotide sequence (SEQ ID NO:493) of a
native sequence PRO1275 cDNA, wherein SEQ ID NO:493 is a clone
designated herein as "DNA64888-1542".
[0519] FIG. 494 shows the amino acid sequence (SEQ ID NO:494)
derived from the coding sequence of SEQ ID NO:493 shown in FIG.
493.
[0520] FIG. 495 shows a nucleotide sequence (SEQ ID NO:495) of a
native sequence PRO1274 cDNA, wherein SEQ ID NO:495 is a clone
designated herein as "DNA64889-1541".
[0521] FIG. 496 shows the amino acid sequence (SEQ ID NO:496)
derived from the coding sequence of SEQ ID NO:495 shown in FIG.
495.
[0522] FIG. 497 shows a nucleotide sequence (SEQ ID NO:497) of a
native sequence PRO1358 cDNA, wherein SEQ ID NO:497 is a clone
designated herein as "DNA64890-1612".
[0523] FIG. 498 shows the amino acid sequence (SEQ ID NO:498)
derived from the coding sequence of SEQ ID NO:497 shown in FIG.
497.
[0524] FIG. 499 shows a nucleotide sequence (SEQ ID NO:499) of a
native sequence PRO1286 cDNA, wherein SEQ ID NO:499 is a clone
designated herein as "DNA64903-1553".
[0525] FIG. 500 shows the amino acid sequence (SEQ ID NO:500)
derived from the coding sequence of SEQ ID NO:499 shown in FIG.
499.
[0526] FIG. 501 shows a nucleotide sequence (SEQ ID NO:501) of a
native sequence PRO1294 cDNA, wherein SEQ ID NO:501 is a clone
designated herein as "DNA64905-1558".
[0527] FIG. 502 shows the amino acid sequence (SEQ ID NO:502)
derived from the coding sequence of SEQ ID NO:501 shown in FIG.
501.
[0528] FIG. 503 shows a nucleotide sequence (SEQ ID NO:503) of a
native sequence PRO1273 cDNA, wherein SEQ ID NO:503 is a clone
designated herein as "DNA65402-1540".
[0529] FIG. 504 shows the amino acid sequence (SEQ ID NO:504)
derived from the coding sequence of SEQ ID NO:503 shown in FIG.
503.
[0530] FIG. 505 shows a nucleotide sequence (SEQ ID NO:505) of a
native sequence PRO1279 cDNA, wherein SEQ ID NO:505 is a clone
designated herein as "DNA65405-1547".
[0531] FIG. 506 shows the amino acid sequence (SEQ ID NO:506)
derived from the coding sequence of SEQ ID NO:505 shown in FIG.
505.
[0532] FIG. 507 shows a nucleotide sequence (SEQ ID NO:507) of a
native sequence PRO1195 cDNA, wherein SEQ ID NO:507 is a clone
designated herein as "DNA65412-1523 ".
[0533] FIG. 508 shows the amino acid sequence (SEQ ID NO:508)
derived from the coding sequence of SEQ ID NO:507 shown in FIG.
507.
[0534] FIG. 509 shows a nucleotide sequence (SEQ ID NO:509) of a
native sequence PRO1271 cDNA, wherein SEQ ID NO:509 is a clone
designated herein as "DNA66309-1538".
[0535] FIG. 510 shows the amino acid sequence (SEQ ID NO:510)
derived from the coding sequence of SEQ ID NO:509 shown in FIG.
509.
[0536] FIG. 511 shows a nucleotide sequence (SEQ ID NO:511) of a
native sequence PRO1338 cDNA, wherein SEQ ID NO:511 is a clone
designated herein as "DNA66667-1596".
[0537] FIG. 512 shows the amino acid sequence (SEQ ID NO:512)
derived from the coding sequence of SEQ ID NO:511 shown in FIG.
511.
[0538] FIG. 513 shows a nucleotide sequence (SEQ ID NO:513) of a
native sequence PRO1343 cDNA, wherein SEQ ID NO:513 is a clone
designated herein as "DNA66675-1587".
[0539] FIG. 514 shows the amino acid sequence (SEQ ID NO:514)
derived from the coding sequence of SEQ ID NO:513 shown in FIG.
513.
[0540] FIG. 515 shows a nucleotide sequence (SEQ ID NO:515) of a
native sequence PRO1434 cDNA, wherein SEQ ID NO:515 is a clone
designated herein as "DNA68818-2536".
[0541] FIG. 516 shows the amino acid sequence (SEQ ID NO:516)
derived from the coding sequence of SEQ ID NO:515 shown in FIG.
515.
[0542] FIG. 517 shows a nucleotide sequence (SEQ ID NO:517) of a
native sequence PRO1418 cDNA, wherein SEQ ID NO:517 is a clone
designated herein as "DNA68864-1629".
[0543] FIG. 518 shows the amino acid sequence (SEQ ID NO:518)
derived from the coding sequence of SEQ ID NO:517 shown in FIG.
517.
[0544] FIG. 519 shows a nucleotide sequence (SEQ ID NO:519) of a
native sequence PRO1387 cDNA, wherein SEQ ID NO:519 is a clone
designated herein as "DNA68872-1620".
[0545] FIG. 520 shows the amino acid sequence (SEQ ID NO:520)
derived from the coding sequence of SEQ ID NO:519 shown in FIG.
519.
[0546] FIG. 521 shows a nucleotide sequence (SEQ ID NO:521) of a
native sequence PRO1384 cDNA, wherein SEQ ID NO:521 is a clone
designated herein as "DNA71159-1617".
[0547] FIG. 522 shows the amino acid sequence (SEQ ID NO:522)
derived from the coding sequence of SEQ ID NO:521 shown in FIG.
521.
[0548] FIG. 523 shows a nucleotide sequence (SEQ ID NO:523) of a
native sequence PRO1565 cDNA, wherein SEQ ID NO:523 is a clone
designated herein as "DNA73727-1673".
[0549] FIG. 524 shows the amino acid sequence (SEQ ID NO:524)
derived from the coding sequence of SEQ ID NO:523 shown in FIG.
523.
[0550] FIG. 525 shows a nucleotide sequence (SEQ ID NO:525) of a
native sequence PRO1474 cDNA, wherein SEQ ID NO:525 is a clone
designated herein as "DNA73739-1645".
[0551] FIG. 526 shows the amino acid sequence (SEQ ID NO:526)
derived from the coding sequence of SEQ ID NO:525 shown in FIG.
525.
[0552] FIG. 527 shows a nucleotide sequence (SEQ ID NO:527) of a
native sequence PRO1917 cDNA, wherein SEQ ID NO:527 is a clone
designated herein as "DNA76400-2528".
[0553] FIG. 528 shows the amino acid sequence (SEQ ID NO:528)
derived from the coding sequence of SEQ ID NO:527 shown in FIG.
527.
[0554] FIG. 529 shows a nucleotide sequence (SEQ ID NO:529) of a
native sequence PRO1787 cDNA, wherein SEQ ID NO:529 is a clone
designated herein as "DNA76510-2504".
[0555] FIG. 530 shows the amino acid sequence (SEQ ID NO:530)
derived from the coding sequence of SEQ ID NO:529 shown in FIG.
529.
[0556] FIG. 531 shows a nucleotide sequence (SEQ ID NO:531) of a
native sequence PRO1556 cDNA, wherein SEQ ID NO:531 is a clone
designated herein as "DNA76529-1666".
[0557] FIG. 532 shows the amino acid sequence (SEQ ID NO:532)
derived from the coding sequence of SEQ ID NO:531 shown in FIG.
531.
[0558] FIG. 533 shows a nucleotide sequence (SEQ ID NO:533) of a
native sequence PRO1561 cDNA, wherein SEQ ID NO:533 is a clone
designated herein as "DNA76538-1670".
[0559] FIG. 534 shows the amino acid sequence (SEQ ID NO:534)
derived from the coding sequence of SEQ ID NO:533 shown in FIG.
533.
[0560] FIG. 535 shows a nucleotide sequence (SEQ ID NO:535) of a
native sequence PRO1693 cDNA, wherein SEQ ID NO:535 is a clone
designated herein as "DNA77301-1708".
[0561] FIG. 536 shows the amino acid sequence (SEQ ID NO:536)
derived from the coding sequence of SEQ ID NO:535 shown in FIG.
535.
[0562] FIG. 537 shows a nucleotide sequence (SEQ ID NO:537) of a
native sequence PRO1868 cDNA, wherein SEQ ID NO:537 is a clone
designated herein as "DNA77624-2515".
[0563] FIG. 538 shows the amino acid sequence (SEQ ID NO:538)
derived from the coding sequence of SEQ ID NO:537 shown in FIG.
537.
[0564] FIG. 539 shows a nucleotide sequence (SEQ ID NO:539) of a
native sequence PRO1890 cDNA, wherein SEQ ID NO:539 is a clone
designated herein as "DNA79230-2525".
[0565] FIG. 540 shows the amino acid sequence (SEQ ID NO:540)
derived from the coding sequence of SEQ ID NO:539 shown in FIG.
539.
[0566] FIG. 541 shows a nucleotide sequence (SEQ ID NO:541) of a
native sequence PRO1887 cDNA, wherein SEQ ID NO:541 is a clone
designated herein as "DNA79862-2522".
[0567] FIG. 542 shows the amino acid sequence (SEQ ID NO:542)
derived from the coding sequence of SEQ ID NO:541 shown in FIG.
541.
[0568] FIG. 543 shows a nucleotide sequence (SEQ ID NO:543) of a
native sequence PRO4353 cDNA, wherein SEQ ID NO:543 is a clone
designated herein as "DNA80145-2594".
[0569] FIG. 544 shows the amino acid sequence (SEQ ID NO:544)
derived from the coding sequence of SEQ ID NO:543 shown in FIG.
543.
[0570] FIG. 545 shows a nucleotide sequence (SEQ ID NO:545) of a
native sequence PRO1801 cDNA, wherein SEQ ID NO:545 is a clone
designated herein as "DNA83500-2506".
[0571] FIG. 546 shows the amino acid sequence (SEQ ID NO:546)
derived from the coding sequence of SEQ ID NO:545 shown in FIG.
545.
[0572] FIG. 547 shows a nucleotide sequence (SEQ ID NO:547) of a
native sequence PRO4357 cDNA, wherein SEQ ID NO:547 is a clone
designated herein as "DNA84917-2597".
[0573] FIG. 548 shows the amino acid sequence (SEQ ID NO:548)
derived from the coding sequence of SEQ ID NO:547 shown in FIG.
547.
[0574] FIG. 549 shows a nucleotide sequence (SEQ ID NO:549) of a
native sequence PRO4302 cDNA, wherein SEQ ID NO:549 is a clone
designated herein as "DNA92218-2554".
[0575] FIG. 550 shows the amino acid sequence (SEQ ID NO:550)
derived from the coding sequence of SEQ ID NO:549 shown in FIG.
549.
DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENTS
[0576] I. Definitions
[0577] The terms "PRO polypeptide" and "PRO" as used herein and
when immediately followed by a numerical designation refer to
various polypeptides, wherein the complete designation (i.e.,
PRO/number) refers to specific polypeptide sequences as described
herein. The terms "PRO/number polypeptide" and "PRO/number" wherein
the term "number" is provided as an actual numerical designation as
used herein encompass native sequence polypeptides and polypeptide
variants (which are further defined herein). The PRO polypeptides
described herein may be isolated from a variety of sources, such as
from human tissue types or from another source, or prepared by
recombinant or synthetic methods. The term "PRO polypeptide" refers
to each individual PRO/number polypeptide disclosed herein. All
disclosures in this specification which refer to the "PRO
polypeptide" refer to each of the polypeptides individually as well
as jointly. For example, descriptions of the preparation of,
purification of, derivation of, formation of antibodies to or
against, administration of, compositions containing, treatment of a
disease with, etc., pertain to each polypeptide of the invention
individually. The term "PRO polypeptide" also includes variants of
the PRO/number polypeptides disclosed herein.
[0578] A "native sequence PRO polypeptide" comprises a polypeptide
having the same amino acid sequence as the corresponding PRO
polypeptide derived from nature. Such native sequence PRO
polypeptides can be isolated from nature or can be produced by
recombinant or synthetic means. The term "native sequence PRO
polypeptide" specifically encompasses naturally-occurring truncated
or secreted forms of the specific PRO polypeptide (e.g., an
extracellular domain sequence), naturally-occurring variant forms
(e.g., alternatively spliced forms) and naturally-occurring allelic
variants of the polypeptide. In various embodiments of the
invention, the native sequence PRO polypeptides disclosed herein
are mature or full-length native sequence polypeptides comprising
the full-length amino acids sequences shown in the accompanying
figures. Start and stop codons are shown in bold font and
underlined in the figures. However, while the PRO polypeptide
disclosed in the accompanying figures are shown to begin with
methionine residues designated herein as amino acid position 1 in
the figures, it is conceivable and possible that other methionine
residues located either upstream or downstream from the amino acid
position 1 in the figures may be employed as the starting amino
acid residue for the PRO polypeptides.
[0579] The PRO polypeptide "extracellular domain" or "ECD" refers
to a form of the PRO polypeptide which is essentially free of the
transmembrane and cytoplasmic domains. Ordinarily, a PRO
polypeptide ECD will have less than 1% of such transmembrane and/or
cytoplasmic domains and preferably, will have less than 0.5% of
such domains. It will be understood that any transmembrane domains
identified for the PRO polypeptides of the present invention are
identified pursuant to criteria routinely employed in the art for
identifying that type of hydrophobic domain. The exact boundaries
of a transmembrane domain may vary but most likely by no more than
about 5 amino acids at either end of the domain as initially
identified herein. Optionally, therefore, an extracellular domain
of a PRO polypeptide may contain from about 5 or fewer amino acids
on either side of the transmembrane domain/extracellular domain
boundary as identified in the Examples or specification and such
polypeptides, with or without the associated signal peptide, and
nucleic acid encoding them, are comtemplated by the present
invention.
[0580] The approximate location of the "signal peptides" of the
various PRO polypeptides disclosed herein are shown in the present
specification and/or the accompanying figures. It is noted,
however, that the C-terminal boundary of a signal peptide may vary,
but most likely by no more than about 5 amino acids on either side
of the signal peptide C-termiinal boundary as initially identified
herein, wherein the C-terminal boundary of the signal peptide may
be identified pursuant to criteria routinely employed in the art
for identifying that type of amino acid sequence element (e.g.,
Nielsen et al., Prot. Eng. 10:1-6 (1997) and von Heinje et al.,
Nucl. Acids. Res. 14:4683-4690 (1986)). Moreover, it is also
recognized that, in some cases, cleavage of a signal sequence from
a secreted polypeptide is not entirely uniform, resulting in more
than one secreted species. These mature polypeptides, where the
signal peptide is cleaved within no more than about 5 amino acids
on either side of the C-terminal boundary of the signal peptide as
identified herein, and the polynucleotides encoding them, are
contemplated by the present invention.
[0581] "PRO polypeptide variant" means an active PRO polypeptide as
defined above or below having at least about 80% amino acid
sequence identity with a full-length native sequence PRO
polypeptide sequence as disclosed herein, a PRO polypeptide
sequence lacking the signal peptide as disclosed herein, an
extracellular domain of a PRO polypeptide, with or without the
signal peptide, as disclosed herein or any other fragment of a
full-length PRO polypeptide sequence as disclosed herein. Such PRO
polypeptide variants include, for instance, PRO polypeptides
wherein one or more amino acid residues are added, or deleted, at
the N- or C-terminus of the full-length native amino acid sequence.
Ordinarily, a PRO polypeptide variant will have at least about 80%
amino acid sequence identity, alternatively at least about 81%
amino acid sequence identity, alternatively at least about 82%
amino acid sequence identity, alternatively at least about 83%
amino acid sequence identity, alternatively at least about 84%
amino acid sequence identity, alternatively at least about 85%
amino acid sequence identity, alternatively at least about 86%
amino acid sequence identity, alternatively at least about 87%
amino acid sequence identity, alternatively at least about 88%
amino acid sequence identity, alternatively at least about 89%
amino acid sequence identity, alternatively at least about 90%
amino acid sequence identity, alternatively at least about 91%
amino acid sequence identity, alternatively at least about 92%
amino acid sequence identity, alternatively at least about 93%
amino acid sequence identity, alternatively at least about 94%
amino acid sequence identity, alternatively at least about 95%
amino acid sequence identity, alternatively at least about 96%
amino acid sequence identity, alternatively at least about 97%
amino acid sequence identity, alternatively at least about 98%
amino acid sequence identity and alternatively at least about 99%
amino acid sequence identity to a full-length native sequence PRO
polypeptide sequence as disclosed herein, a PRO polypeptide
sequence lacking the signal peptide as disclosed herein, an
extracellular domain of a PRO polypeptide, with or without the
signal peptide, as disclosed herein or any other specifically
defined fragment of a full-length PRO polypeptide sequence as
disclosed herein. Ordinarily, PRO variant polypeptides are at least
about 10 amino acids in length, alternatively at least about 20
amino acids in length, alternatively at least about 30 amino acids
in length, alternatively at least about 40 amino acids in length,
alternatively at least about 50 amino acids in length,
alternatively at least about 60 amino acids in length,
alternatively at least about 70 amino acids in length,
alternatively at least about 80 amino acids in length,
alternatively at least about 90 amino acids in length,
alternatively at least about 100 amino acids in length,
alternatively at least about 150 amino acids in length,
alternatively at least about 200 amino acids in length,
alternatively at least about 300 amino acids in length, or
more.
[0582] "Percent (%) amino acid sequence identity" with respect to
the PRO polypeptide sequences identified herein is defined as the
percentage of amino acid residues in a candidate sequence that are
identical with the amino acid residues in the specific PRO
polypeptide sequence, after aligning the sequences and introducing
gaps, if necessary, to achieve the maximum percent sequence
identity, and not considering any conservative substitutions as
part of the sequence identity. Alignment for purposes of
determining percent amino acid sequence identity can be achieved in
various ways that are within the skill in the art, for instance,
using publicly available computer software such as BLAST, BLAST-2,
ALIGN or Megalign (DNASTAR) software. Those skilled in the art can
determine appropriate parameters for measuring alignment, including
any algorithms needed to achieve maximal alignment over the full
length of the sequences being compared. For purposes herein,
however, % amino acid sequence identity values are generated using
the sequence comparison computer program ALIGN-2, wherein the
complete source code for the ALIGN-2 program is provided in Table 1
below. The ALIGN-2 sequence comparison computer program was
authored by Genentech, Inc. and the source code shown in Table 1
below has been filed with user documentation in the U.S. Copyright
Office, Washington D.C., 20559, where it is registered under U.S.
Copyright Registration No. TXU510087. The ALIGN-2 program is
publicly available through Genentech, Inc., South San Francisco,
Calif. or may be compiled from the source code provided in Table 1
below. The ALIGN-2 program should be compiled for use on a UNIX
operating system, preferably digital UNIX V4.0D. All sequence
comparison parameters are set by the ALIGN-2 program and do not
vary.
[0583] In situations where ALIGN-2 is employed for amino acid
sequence comparisons, the % amino acid sequence identity of a given
amino acid sequence A to, with, or against a given amino acid
sequence B (which can alternatively be phrased as a given amino
acid sequence A that has or comprises a certain % amino acid
sequence identity to, with, or against a given amino acid sequence
B) is calculated as follows:
100 times the fraction X/Y
[0584] where X is the number of amino acid residues scored as
identical matches by the sequence alignment program ALIGN-2 in that
program's alignment of A and B, and where Y is the total number of
amino acid residues in B. It will be appreciated that where the
length of amino acid sequence A is not equal to the length of amino
acid sequence B, the % amino acid sequence identity of A to B will
not equal the % amino acid sequence identity of B to A. As examples
of % amino acid sequence identity calculations using this method,
Tables 2 and 3 demonstrate how to calculate the % amino acid
sequence identity of the amino acid sequence designated "Comparison
Protein" to the amino acid sequence designated "PRO", wherein "PRO"
represents the amino acid sequence of a hypothetical PRO
polypeptide of interest, "Comparison Protein" represents the amino
acid sequence of a polypeptide against which the "PRO" polypeptide
of interest is being compared, and "X, "Y" and "Z" each represent
different hypothetical amino acid residues.
[0585] Unless specifically stated otherwise, all % amino acid
sequence identity values used herein are obtained as described in
the immediately preceding paragraph using the ALIGN-2 computer
program. However, % amino acid sequence identity values may also be
obtained as described below by using the WU-BLAST-2 computer
program (Altschul et al., Methods in Enzymology 266:460-480
(1996)). Most of the WU-BLAST-2 search parameters are set to the
default values. Those not set to default values, i.e., the
adjustable parameters, are set with the following values: overlap
span=1, overlap fraction=0.125, word threshold (MI)=11, and scoring
matrix=BLOSUM62. When WU-BLAST-2 is employed, a % amino acid
sequence identity value is determined by dividing (a) the number of
matching identical amino acid residues between the amino acid
sequence of the PRO polypeptide of interest having a sequence
derived from the native PRO polypeptide and the comparison amino
acid sequence of interest (i.e., the sequence against which the PRO
polypeptide of interest is being compared which may be a PRO
variant polypeptide) as determined by WU-BLAST-2 by (b) the total
number of amino acid residues of the PRO polypeptide of interest.
For example, in the statement "a polypeptide comprising an the
amino acid sequence A which has or having at least 80% amino acid
sequence identity to the amino acid sequence B", the amino acid
sequence A is the comparison amino acid sequence of interest and
the amino acid sequence B is the amino acid sequence of the PRO
polypeptide of interest.
[0586] Percent amino acid sequence identity may also be determined
using the sequence comparison program NCBI-BLAST2 (Altschul et al.,
Nucleic Acids Res. 25:3389-3402 (1997)). The NCBI-BLAST2 sequence
comparison program may be downloaded from
http://www.ncbi.nlm.nih.gov or otherwise obtained from the National
Institute of Health, Bethesda, Md. NCBI-BLAST2 uses several search
parameters, wherein all of those search parameters are set to
default values including, for example, unmask=yes, strand=all,
expected occurrences=10, minimum low complexity length=15/5,
multi-pass e-value=0.01, constant for multi-pass=25, dropoff for
final gapped alignment=25 and scoring matrix=BLOSUM62.
[0587] In situations where NCBI-BLAST2 is employed for amino acid
sequence comparisons, the % amino acid sequence identity of a given
amino acid sequence A to, with, or against a given amino acid
sequence B (which can alternatively be phrased as a given amino
acid sequence A that has or comprises a certain % amino acid
sequence identity to, with, or against a given amino acid sequence
B) is calculated as follows:
100 times the fraction X/Y
[0588] where X is the number of amino acid residues scored as
identical matches by the sequence alignment program NCBI-BLAST2 in
that program's alignment of A and B, and where Y is the total
number of amino acid residues in B. It will be appreciated that
where the length of amino acid sequence A is not equal to the
length of amino acid sequence B, the % amino acid sequence identity
of A to B will not equal the % amino acid sequence identity of B to
A.
[0589] "PRO variant polynucleotide" or "PRO variant nucleic acid
sequence" means a nucleic acid molecule which encodes an active PRO
polypeptide as defined below and which has at least about 80%
nucleic acid sequence identity with a nucleotide acid sequence
encoding a full-length native sequence PRO polypeptide sequence as
disclosed herein, a full-length native sequence PRO polypeptide
sequence lacking the signal peptide as disclosed herein, an
extracellular domain of a PRO polypeptide, with or without the
signal peptide, as disclosed herein or any other fragment of a
full-length PRO polypeptide sequence as disclosed herein.
Ordinarily, a PRO variantpolynucleotide will have at least about
80% nucleic acid sequence identity, alternatively at least about
81% nucleic acid sequence identity, alternatively at least about
82% nucleic acid sequence identity, alternatively at least about
83% nucleic acid sequence identity, alternatively at least about
84% nucleic acid sequence identity, alternatively at least about
85% nucleic acid sequence identity, alternatively at least about
86% nucleic acid sequence identity, alternatively at least about
87% nucleic acid sequence identity, alternatively at least about
88% nucleic acid sequence identity, alternatively at least about
89% nucleic acid sequence identity, alternatively at least about
90% nucleic acid sequence identity, alternatively at least about
91% nucleic acid sequence identity, alternatively at least about
92% nucleic acid sequence identity, alternatively at least about
93% nucleic acid sequence identity, alternatively at least about
94% nucleic acid sequence identity, alternatively at least about
95% nucleic acid sequence identity, alternatively at least about
96% nucleic acid sequence identity, alternatively at least about
97% nucleic acid sequence identity, alternatively at least about
98% nucleic acid sequence identity and alternatively at least about
99% nucleic acid sequence identity with a nucleic acid sequence
encoding a full-length native sequence PRO polypeptide sequence as
disclosed herein, a full-length native sequence PRO polypeptide
sequence lacking the signal peptide as disclosed herein, an
extracellular domain of a PROpolypeptide, with or without the
signal sequence, as disclosed herein or any other fragment of a
full-length PRO polypeptide sequence as disclosed herein. Variants
do not encompass the native nucleotide sequence.
[0590] Ordinarily, PRO variant polynucleotides are at least about
30 nucleotides in length, alternatively at least about 60
nucleotides in length, alternatively at least about 90 nucleotides
in length, alternatively at least about 120 nucleotides in length,
alternatively at least about 150 nucleotides in length,
alternatively at least about 180 nucleotides in length,
alternatively at least about 210 nucleotides in length,
alternatively at least about 240 nucleotides in length,
alternatively at least about 270 nucleotides in length,
alternatively at least about 300 nucleotides in length,
alternatively at least about 450 nucleotides in length,
alternatively at least about 600 nucleotides in length,
alternatively at least about 900 nucleotides in length, or
more.
[0591] "Percent (%) nucleic acid sequence identity" with respect to
PRO-encoding nucleic acid sequences identified herein is defined as
the percentage of nucleotides in a candidate sequence that are
identical with the nucleotides in the PRO nucleic acid sequence of
interest, after aligning the sequences and introducing gaps, if
necessary, to achieve the maximum percent sequence identity.
Alignment for purposes of determining percent nucleic acid sequence
identity can be achieved in various ways that are within the skill
in the art, for instance, using publicly available computer
software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR)
software. For purposes herein, however, % nucleic acid sequence
identity values are generated using the sequence comparison
computer program ALIGN-2, wherein the complete source code for the
ALIGN-2 program is provided in Table 1 below. The ALIGN-2 sequence
comparison computer program was authored by Genentech, Inc. and the
source code shown in Table 1 below has been filed with user
documentation in the U.S. Copyright Office, Washington D.C., 20559,
where it is registered under U.S. Copyright Registration No.
[0592] TXU510087. The ALIGN-2 program is publicly available through
Genentech, Inc., South San Francisco, Calif. or may be compiled
from the source code provided in Table 1 below. The ALIGN-2 program
should be compiled for use on a UNIX operating system, preferably
digital UNIX V4.OD. All sequence comparison parameters are set by
the ALIGN-2 program and do not vary.
[0593] In situations where ALIGN-2 is employed for nucleic acid
sequence comparisons, the % nucleic acid sequence identity of a
given nucleic acid sequence C to, with, or against a given nucleic
acid sequence D (which can alternatively be phrased as a given
nucleic acid sequence C that has or comprises a certain % nucleic
acid sequence identity to, with, or against a given nucleic acid
sequence D) is calculated as follows:
100 times the fraction W/Z
[0594] where W is the number of nucleotides scored as identical
matches by the sequence alignment program ALIGN-2 in that program's
alignment of C and D, and where Z is the total number of
nucleotides in D. It will be appreciated that where the length of
nucleic acid sequence C is not equal to the length of nucleic acid
sequence D, the % nucleic acid sequence identity of C to D will not
equal the % nucleic acid sequence identity of D to C. As examples
of % nucleic acid sequence identity calculations, Tables 4 and 5,
demonstrate how to calculate the % nucleic acid sequence identity
of the nucleic acid sequence designated "Comparison DNA" to the
nucleic acid sequence designated "PRO-DNA", wherein "PRO-DNA"
represents a hypothetical PRO-encoding nucleic acid sequence of
interest, "Comparison DNA" represents the nucleotide sequence of a
nucleic acid molecule against which the "PRO-DNA" nucleic acid
molecule of interest is being compared, and "N", "L" and "V" each
represent different hypothetical nucleotides.
[0595] Unless specifically stated otherwise, all % nucleic acid
sequence identity values used herein are obtained as described in
the immediately preceding paragraph using the ALIGN-2 computer
program. However, % nucleic acid sequence identity values may also
be obtained as described below by using the WU-BLAST-2 computer
program (Altschul et al., Methods in Enzymology 266:460480 (1996)).
Most of the WU-BLAST-2 search parameters are set to the default
values. Those not set to default values, i.e., the adjustable
parameters, are set with the following values: overlap span=1,
overlap fraction=0.125, word threshold (T)=11, and scoring
matrix=BLOSUM62. When WU-BLAST-2 is employed, a % nucleic acid
sequence identity value is determined by dividing (a) the number of
matching identical nucleotides between the nucleic acid sequence of
the PRO polypeptide-encoding nucleic acid molecule of interest
having a sequence derived from the native sequence PRO
polypeptide-encoding nucleic acid and the comparison nucleic acid
molecule of interest (i.e., the sequence against which the PRO
polypeptide-encoding nucleic acid molecule of interest is being
compared which may be a variant PRO polynucleotide) as determined
by WU-BLAST-2 by (b) the total number of nucleotides of the PRO
polypeptide-encoding nucleic acid molecule of interest. For
example, in the statement "an isolated nucleic acid molecule
comprising a nucleic acid sequence A which has or having at least
80% nucleic acid sequence identity to the nucleic acid sequence B",
the nucleic acid sequence A is the comparison nucleic acid molecule
of interest and the nucleic acid sequence B is the nucleic acid
sequence of the PRO polypeptide-encoding nucleic acid molecule of
interest.
[0596] Percent nucleic acid sequence identity may also be
determined using the sequence comparison program NCBI-BLAST2
(Altschul et al., Nucleic Acids Res. 25:3389-3402 (1997)). The
NCBI-BLAST2 sequence comparison program may be downloaded from
http://www.ncbi.nlm.nih.gov or otherwise obtained from the National
Institute of Health, Bethesda, MD. NCBI-BLAST2 uses several search
parameters, wherein all of those search parameters are set to
default values including, for example, unmask=yes, strand=all,
expected occurrences=10, minimum low complexity length=15/5,
multi-pass e-value=0.01, constant for multi-pass=25, dropoff for
final gapped alignment=25 and scoring matrix=BLOSUM62.
[0597] In situations where NCBI-BLAST2 is employed for sequence
comparisons, the % nucleic acid sequence identity of a given
nucleic acid sequence C to, with, or against a given nucleic acid
sequence D (which can alternatively be phrased as a given nucleic
acid sequence C that has or comprises a certain % nucleic acid
sequence identity to, with, or against a given nucleic acid
sequence D) is calculated as follows:
100 times the fraction W/Z
[0598] where W is the number of nucleotides scored as identical
matches by the sequence alignment program NCBI-BLAST2 in that
program's alignment of C and D, and where Z is the total number of
nucleotides in D. It will be appreciated that where the length of
nucleic acid sequence C is not equal to the length of nucleic acid
sequence D, the % nucleic acid sequence identity of C to D will not
equal the % nucleic acid sequence identity of D to C.
[0599] In other embodiments, PRO variant polynucleotides are
nucleic acid molecules that encode an active PRO polypeptide and
which are capable of hybridizing, preferably under stringent
hybridization and wash conditions, to nucleotide sequences encoding
a full-length PRO polypeptide as disclosed herein. PRO variant
polypeptides may be those that are encoded by a PRO variant
polynucleofide.
[0600] "Isolated," when used to describe the various polypeptides
disclosed herein, means polypeptide that has been identified and
separated and/or recovered from a component of its natural
environment. Contaminant components of its natural environment are
materials that would typically interfere with diagnostic or
therapeutic uses for the polypeptide, and may include enzymes,
hormones, and other proteinaceous or non-proteinaceous solutes. In
preferred embodiments, the polypeptide will be purified (1) to a
degree sufficient to obtain at least 15 residues of N-terminal
orintemal amino acid sequence by use of a spinning cup sequenator,
or (2) to homogeneity by SDS-PAGE under non-reducing or reducing
conditions using Coomassie blue or, preferably, silver stain.
Isolated polypeptide includes polypeptide in situ within
recombinant cells, since at least one component of the PRO
polypeptide natural environment will not be present. Ordinarily,
however, isolated polypeptide will be prepared by at least one
purification step.
[0601] An "isolated" PRO polypeptide-encoding nucleic acid or other
polypeptide-encoding nucleic acid is a nucleic acid molecule that
is identified and separated from at least onecontaminant nucleic
acid molecule with which it is ordinarily associated in the natural
source of the polypeptide-encoding nucleic acid. An isolated
polypeptide-encoding nucleic acid molecule is other than in the
form or setting in which it is found in nature. Isolated
polypeptide-encoding nucleic acid molecules therefore are
distinguished from the specific polypeptide-encoding nucleic acid
molecule as it exists in natural cells. However, an isolated
polypeptide-encoding nucleic acid molecule includes
polypeptide-encoding nucleic acid molecules contained in cells that
ordinarily express the polypeptide where, for example, the nucleic
acid molecule is in a chromosomal location different from that of
natural cells.
[0602] The term "control sequences" refers to DNA sequences
necessary for the expression of an operably linked coding sequence
in a particular host organism. The control sequences that are
suitable for prokaryotes, for example, include a promoter,
optionally an operator sequence, and a ribosome binding site.
Eukaryotic cells are known to utilize promoters, polyadenylation
signals, and enhancers.
[0603] Nucleic acid is "operably linked" when it is placed into a
functional relationship with another nucleic acid sequence. For
example, DNA for a presequence or secretory leader is operably
linked to DNA for a polypeptide if it is expressed as a preprotein
that participates in the secretion of the polypeptide; a promoter
or enhancer is operably linked to a coding sequence if it affects
the transcription of the sequence; or a ribosome binding site is
operably linked to a coding sequence if it is positioned so as to
facilitate translation. Generally, "operably linked" means that the
DNA sequences being linked are contiguous, and, in the case of a
secretory leader, contiguous and in reading phase. However,
enhancers do not have to be contiguous. Linking is accomplished by
ligation at convenient restriction sites. If such sites do not
exist, the synthetic oligonucleotide adaptors or linkers are used
in accordance with conventional practice.
[0604] The term "antibody" is used in the broadest sense and
specifically covers, for example, single anti-PRO monoclonal
antibodies (including agonist, antagonist, and neutralizing
antibodies), anti-PRO antibody compositions with polyepitopic
specificity, single chain anti-PRO antibodies, and fragments of
anti-PRO antibodies (see below). The term "monoclonal antibody" as
used herein refers to an antibody obtained from a population of
substantially homogeneous antibodies, i.e., the individual
antibodies comprising the population are identical except for
possible naturally-occurring mutations that may be present in minor
amounts.
[0605] "Stringency" of hybridization reactions is readily
determinable by one of ordinary skill in the art, and generally is
an empirical calculation dependent upon probe length, washing
temperature, and salt concentration. In general, longer probes
require higher temperatures for proper annealing, while shorter
probes need lower temperatures. Hybridization generally depends on
the ability of denatured DNA to reanneal when complementary strands
are present in an environment below their melting temperature. The
higher the degree of desired homology between the probe and
hybridizable sequence, the higher the relative temperature which
can be used. As a result, it follows that higher relative
temperatures would tend to make the reaction conditions more
stringent, while lower temperatures less so. For additional details
and explanation of stringency of hybridization reactions, see
Ausubel et al., Current Protocols in Molecular Biology, Wiley
Interscience Publishers, (1995).
[0606] "Stringent conditions" or "high stringency conditions", as
defined herein, may be identified by those that: (1) employ low
ionic strength and high temperature for washing, for example 0.015
M sodium chloride/0.0015 M sodium citrate/0.1% sodium dodecyl
sulfate at 50.degree. C.; (2) employ during hybridization a
denaturing agent, such as formamide, for example, 50% (v/v)
formamide with 0.1% bovine serum albumin/0.1% Ficoll/0.1%
polyvinylpyrrolidone/50 mM sodium phosphate buffer at pH 6.5 with
750 mM sodium chloride, 75 mM sodium citrate at 42.degree. C.; or
(3) employ 50% formamide, 5.times.SSC (0.75 M NaCl, 0.075 M sodium
citrate), 50 mnM sodium phosphate (pH 6.8), 0.1% sodium
pyrophosphate, 5.times.Denhardt's solution, sonicated salmon sperm
DNA (50 .mu.g/ml), 0.1% SDS, and 10% dextran sulfate at 42.degree.
C., with washes at 42.degree. C. in 0.2.times.SSC (sodium
chloride/sodium citrate) and 50% formamide at 55.degree. C.,
followed by a high-stringency wash consisting of 0.1.times.SSC
containing EDTA at 55.degree. C.
[0607] "Moderately stringent conditions" may be identified as
described by Sambrook et al., Molecular Cloning: A Laboratory
Manual, New York: Cold Spring Harbor Press, 1989, and include the
use of washing solution and hybridization conditions (e.g.,
temperature, ionic strength and %SDS) less stringent that those
described above. An example of moderately stringent conditions is
overnight incubation at 37.degree. C. in a solution comprising: 20%
formamide, 5.times.SSC (150 mM NaCl, 15 mM trisodium citrate), 50
mM sodium phosphate (pH 7.6), 5.times.Denhardt's solution, 10%
dextran sulfate, and 20 mg/ml denatured sheared salmon sperm DNA,
followed by washing the filters in 1.times.SSC at about
37-50.degree. C. The skilled artisan will recognize how to adjust
the temperature, ionic strength, etc. as necessary to accommodate
factors such as probe length and the like.
[0608] The term "epitope tagged" when used herein refers to a
chimeric polypeptide comprising a PRO polypeptide fused to a "tag
polypeptide". The tag polypeptide has enough residues to provide an
epitope against which an antibody can be made, yet is short enough
such that it does not interfere with activity of the polypeptide to
which it is fused. The tag polypeptide preferably also is fairly
unique so that the antibody does not substantially cross-react with
other epitopes. Suitable tag polypeptides generally have at least
six amino acid residues and usually between about 8 and 50 amino
acid residues (preferably, between about 10 and 20 amino acid
residues).
[0609] As used herein, the term "immunoadhesin" designates
antibody-like molecules which combine the binding specificity of a
heterologous protein (an "adhesin") with the effector functions of
immunoglobulin constant domains. Structurally, the immunoadhesins
comprise a fusion of an amino acid sequence with the desired
binding specificity which is other than the antigen recognition and
binding site of an antibody (i.e., is "heterologous"), and an
immunoglobulin constant domain sequence. The adhesin part of an
immunoadhesin molecule typically is a contiguous amino acid
sequence comprising at least the binding site of a receptor or a
ligand. The immunoglobulin constant domain sequence in the
immunoadhesin may be obtained from any immunoglobulin, such as
IgG-1, IgG-2, IgG-3, or IgG4 subtypes, IgA (including IgA-1 and
IgA-2), IgE, IgD or IgM.
[0610] "Active" or "activity" for the purposes herein refers to
form(s) of a PRO polypeptide which retain a biological andlor an
immunological activity of native or naturally-occurring PRO,
wherein "biological" activity refers to a biological function
(either inhibitory or stimulatory) caused by a native or
naturally-occurring PRO other than the ability to induce the
production of an antibody against an antigenic epitope possessed by
a native or naturally-occurring PRO and an "immunological" activity
refers to the ability to induce the production of an antibody
against an antigenic epitope possessed by a native or
naturally-occurring PRO.
[0611] The term "antagonist" is used in the broadest sense, and
includes any molecule that partially or fully blocks, inhibits, or
neutralizes a biological activity of a native PRO polypeptide
disclosed herein. In a similar manner, the term "agonist" is used
in the broadest sense and includes any molecule that mimics a
biological activity of a native PRO polypeptide disclosed herein.
Suitable agonist or antagonist molecules specifically include
agonist or antagonist antibodies or antibody fragments, fragments
or amino acid sequence variants of native PRO polypeptides,
peptides, antisense oligonucleotides, small organic molecules, etc.
Methods for identifying agonists or antagonists of a PRO
polypeptide may comprise contacting a PRO polypeptide with a
candidate agonist or antagonist molecule and measuring a detectable
change in one or more biological activities normally associated
with the PRO polypeptide.
[0612] "Treatment" refers to both therapeutic treatment and
prophylactic or preventative measures, wherein the object is to
prevent or slow down (lessen) the targeted pathologic condition or
disorder. Those in need of treatment include those already with the
disorder as well as those prone to have the disorder or those in
whom the disorder is to be prevented.
[0613] "Chronic" administration refers to administration of the
agent(s) in a continuous mode as opposed to an acute mode, so as to
maintain the initial therapeutic effect (activity) for an extended
period of time. "Intermittent" administration is treatment that is
not consecutively done without interruption, but rather is cyclic
in nature.
[0614] "Mammal" for purposes of treatment refers to any animal
classified as a mammal, including humans, domestic and farm
animals, and zoo, sports, or pet animals, such as dogs, cats,
cattle, horses, sheep, pigs, goats, rabbits, etc. Preferably, the
mammal is human.
[0615] Administration "in combination with" one or more further
therapeutic agents includes simultaneous (concurrent) and
consecutive administration in any order.
[0616] "Carriers" as used herein include pharmaceutically
acceptable carriers, excipients, or stabilizers which are nontoxic
to the cell or mammal being exposed thereto at the dosages and
concentrations employed. Often the physiologically acceptable
carrier is an aqueous pH buffered solution. Examples of
physiologically acceptable carriers include buffers such as
phosphate, citrate, and other organic acids; antioxidants including
ascorbic acid; low molecular weight (less than about 10 residues)
polypeptide; proteins, such as serum albumin, gelatin, or
immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone;
amino acids such as glycine, glutamine, asparagine, arginine or
lysine; monosaccharides, disaccharides, and other carbohydrates
including glucose, mannose, or dextrins; chelating agents such as
EDTA; sugar alcohols such as mannitol or sorbitol; salt-forming
counterions such as sodium; and/or nonionic surfactants such as
TWEEN.TM., polyethylene glycol (PEG), and PLURONICS.TM..
[0617] "Antibody fragments" comprise aportion of an intact
antibody, preferably the antigen binding or variable region of the
intact antibody. Examples of antibody fragments include Fab, Fab',
F(ab').sub.2, and Fv fragments; diabodies; linear antibodies
(Zapata et al., Protein Eng. 8(10): 1057-1062[1995]); single-chain
antibody molecules; and multispecific antibodies formed from
antibody fragments.
[0618] Papain digestion of antibodies produces two identical
antigen-binding fragments, called "Fab" fragments, each with a
single antigen-binding site, and a residual "Fc" fragment, a
designation reflecting the ability to crystallize readily. Pepsin
treatment yields an F(ab').sub.2 fragment that has two
antigen-combining sites and is still capable of cross-linking
antigen.
[0619] "Fv" is the minimum antibody fragment which contains a
complete antigen-recognition and -binding site. This region
consists of a dimer of one heavy- and one light-chain variable
domain in tight, non-covalent association. It is in this
configuration that the three CDRs of each variable domain interact
to define an antigen-binding site on the surface of the
V.sub.H-V.sub.L dimer. Collectively, the six CDRs confer
antigen-binding specificity to the antibody. However, even a single
variable domain (or half of an Fv comprising only three CDRs
specific for an antigen) has the ability to recognize and bind
antigen, although at a lower affinity than the entire binding
site.
[0620] The Fab fragment also contains the constant domain of the
light chain and the first constant domain (CH1) of the heavy chain.
Fab fragments differ from Fab' fragments by the addition of a few
residues at the carboxy terminus of the heavy chain CHI domain
including one or more cysteines from the antibody hinge region.
Fab'-SH is the designation herein for Fab' in which the cysteine
residue(s) of the constant domains bear a free thiol group.
F(ab').sub.2 antibody fragments originally were produced as pairs
of Fab' fragments which have hinge cysteines between them. Other
chemical couplings of antibody fragments are also known.
[0621] The "light chains" of antibodies (immunoglobulins) from any
vertebrate species can be assigned to one of two clearly distinct
types, called kappa and lambda, based on the amino acid sequences
of their constant domains.
[0622] Depending on the amino acid sequence of the constant domain
of their heavy chains, immunoglobulins can be assigned to different
classes. There are five major classes of immunoglobulins: IgA, IgD,
IgE, IgG, and IgM, and several of these may be further divided into
subclasses (isotypes), e.g., IgGI, IgG2, IgG3, IgG4, IgA, and
IgA2.
[0623] "Single-chain Fv" or "sFv" antibody fragments comprise the
V.sub.H and V.sub.L domains of antibody, wherein these domains are
present in a single polypeptide chain. Preferably, the Fv
polypeptide further comprises a polypeptide linker between the
V.sub.H and V.sub.L domains which enables the sFv to form the
desired structure for antigen binding. For a review of sFv, see
Pluckthun in The Pharmacology of Monoclonal Antibodies, vol. 113,
Rosenburg and Moore eds., Springer-Verlag, New York, pp. 269-315
(1994).
[0624] The term "diabodies" refers to small antibody fragments with
two antigen-binding sites, which fragments comprise a heavy-chain
variable domain (V.sub.H) connected to a light-chain variable
domain (V.sub.L) in the same polypeptide chain (V.sub.H-V.sub.L).
By using a linker that is too short to allow pairing between the
two domains on the same chain, the domains are forced to pair with
the complementary domains of another chain and create two
antigen-binding sites. Diabodies are described more fully in, for
example, EP 404,097; WO 93/11161; and Hollinger et al., Proc. Natl.
Acad. Sci. USA, 90:6444-6448 (1993).
[0625] An "isolated" antibody is one which has been identified and
separated and/or recovered from a component of its natural
environment. Contaminant components of its natural environment are
materials which would interfere with diagnostic or therapeutic uses
for the antibody, and may include enzymes, hormones, and other
proteinaceous or nonproteinaceous solutes. In preferred
embodiments, the antibody will be purified (1) to greater than 95%
by weight of antibody as determined by the Lowry method, and most
preferably more than 99% by weight, (2) to a degree sufficient to
obtain at least 15 residues of N-terminal or internal amino acid
sequence by use of a spinning cup sequenator, or (3) to homogeneity
by SDS-PAGE under reducing or nonreducing conditions using
Coomassie blue or, preferably, silver stain. Isolated antibody
includes the antibody in situ within recombinant cells since at
least one component of the antibody's natural environment will not
be present. Ordinarily, however, isolated antibody will be prepared
by at least one purification step.
[0626] An antibody that "specifically binds to" or is "specific
for" a particular polypeptide or an epitope on a particular
polypeptide is one that binds to that particular polypeptide or
epitope on a particular polypeptide without substantially binding
to any other polypeptide or polypeptide epitope.
[0627] The word "label" when used herein refers to a detectable
compound or composition which is conjugated directly or indirectly
to the antibody so as to generate a "labeled" antibody. The label
may be detectable by itself (e.g. radioisotope labels or
fluorescent labels) or, in the case of an enzymatic label, may
catalyze chemical alteration of a substrate compound or composition
which is detectable.
[0628] By "solid phase" is meant a non-aqueous matrix to which the
antibody of the present invention can adhere. Examples of solid
phases encompassed herein include those formed partially or
entirely of glass (e.g., controlled pore glass), polysaccharides
(e.g., agarose), polyacrylamides, polystyrene, polyvinyl alcohol
and silicones. In certain embodiments, depending on the context,
the solid phase can comprise the well of an assay plate; in others
it is a purification column (e.g., an affinity chromatography
column). This term also includes a discontinuous solid phase of
discrete particles, such as those described in U.S. Pat. No.
4,275,149.
[0629] A "liposome" is a small vesicle composed of various types of
lipids, phospholipids and/or surfactant which is useful for
delivery of a drug (such as a PRO polypeptide or antibody thereto)
to a mammal. The components of the liposome are commonly arranged
in a bilayer formation, similar to the lipid arrangement of
biological membranes.
[0630] A "small molecule" is defined herein to have a molecular
weight below about 500 Daltons.
[0631] An "effective amount" of a polypeptide disclosed herein or
an agonist or antagonist thereof is an amount sufficient to carry
out a specifically stated purpose. An "effective amount" may be
determined empirically and in a routine manner, in relation to the
stated purpose.
1TABLE 2 PRO XXXXXXXXXXXXXXX (Length = 15 amino acids) Comparison
XXXXXYYYYYYY (Length = 12 amino acids) Protein % amino acid
sequence identity = (the number of identically matching amino acid
residues between the two polypeptide sequences as determined by
ALIGN-2) divided by (the total number of amino acid residues of the
PRO polypeptide) = 5 divided by 15 = 33.3%
[0632]
2TABLE 3 PRO XXXXXXXXXX (Length = 10 amino acids) Comparison
XXXXXYYYYYYZZYZ (Length = 15 amino acids) Protein % amino acid
sequence identity = (the number of identically matching amino acid
residues between the two polypeptide sequences as determined by
ALIGN-2) divided by (the total number of amino acid residues of the
PRO polypeptide) = 5 divided by 10 = 50%
[0633]
3TABLE 4 PRO-DNA NNNNNNNNNNNNNN (Length = 14 nucleotides)
Comparison NNNNNNLLLLLLLLLL (Length = 16 nucleotides) DNA % nucleic
acid sequence identity = (the number of identically matching
nucleotides between the two nucleic acid sequences as determined by
ALIGN-2) divided by (the total number of nucleotides of the PRO-DNA
nucleic acid sequence) = 6 divided by 14 = 42.9%
[0634]
4TABLE 5 PRO-DNA NNNNNNNNNNNN (Length = 12 nucleotides) Comparison
DNA NNNNLLLVV (Length = 9 nucleotides) % nucleic acid sequence
identity = (the number of identically matching nucleotides between
the two nucleic acid sequences as determined by ALIGN-2) divided by
(the total number of nucleotides of the PRO-DNA nucleic acid
sequence) = 4 divided by 12 = 33.3%
[0635] II. Compositions and Methods of the Invention
[0636] A. Full-Length PRO Polypeptides
[0637] The present invention provides newly identified and isolated
nucleotide sequences encoding polypeptides referred to in the
present application as PRO polypeptides. In particular, cDNAs
encoding various PRO polypeptides have been identified and
isolated, as disclosed in further detail in the Examples below. It
is noted that proteins produced in separate expression rounds may
be given different PRO numbers but the UNQ number is unique for any
given DNA and the encoded protein, and will not be changed.
However, for sake of simplicity, in the present specification the
protein encoded by the full length native nucleic acid molecules
disclosed herein as well as all further native homologues and
variants included in the foregoing definition of PRO, will be
referred to as "PRO/number", regardless of their origin or mode of
preparation.
[0638] As disclosed in the Examples below, various cDNA clones have
been deposited with the ATCC. The actual nucleotide sequences of
those clones can readily be determined by the skilled artisan by
sequencing of the deposited clone using routine methods in the art.
The predicted amino acid sequence can be determined from the
nucleotide sequence using routine skill. For the PRO polypeptides
and encoding nucleic acids described herein, Applicants have
identified what is believed to be the reading frame best
identifiable with the sequence information available at the
time.
[0639] B. PRO Polypeptide Variants
[0640] In addition to the full-length native sequence PRO
polypeptides described herein, it is contemplated that PRO variants
can be prepared. PRO variants can be prepared by introducing
appropriate nucleotide changes into the PRO DNA, and/or by
synthesis of the desired PRO polypeptide. Those skilled in the art
will appreciate that amino acid changes may alter
post-translational processes of the PRO, such as changing the
number or position of glycosylation sites or altering the membrane
anchoring characteristics.
[0641] Variations in the native full-length sequence PRO or in
various domains of the PRO described herein, can be made, for
example, using any of the techniques and guidelines for
conservative and non-conservative mutations set forth, for
instance, in U.S. Pat. No. 5,364,934. Variations may be a
substitution, deletion or insertion of one or more codons encoding
the PRO that results in a change in the amino acid sequence of the
PRO as compared with the native sequence PRO. Optionally the
variation is by substitution of at least one amino acid with any
other amino acid in one or more of the domains of the PRO. Guidance
in determining which amino acid residue may be inserted,
substituted or deleted without adversely affecting the desired
activity may be found by comparing the sequence of the PRO with
that of homologous known protein molecules and minimizing the
number of amino acid sequence changes made in regions of high
homology. Amino acid substitutions can be the result of replacing
one amino acid with another amino acid having similar structural
and/or chemical properties, such as the replacement of a leucine
with a serine, i.e., conservative amino acid replacements.
Insertions or deletions may optionally be in the range of about 1
to 5 amino acids. The variation allowed may be determined by
systematically making insertions, deletions or substitutions of
amino acids in the sequence and testing the resulting variants for
activity exhibited by the full-length or mature native
sequence.
[0642] PRO polypeptide fragments are provided herein. Such
fragments may be truncated at the N-terminus or C-terminus, or may
lack internal residues, for example, when compared with a full
length native protein. Certain fragments lack amino acid residues
that are not essential for a desired biological activity of the PRO
polypeptide.
[0643] PRO fragments may be prepared by any of a number of
conventional techniques. Desired peptide fragments may be
chemically synthesized. An alternative approach involves generating
PRO fragments by enzymatic digestion, e.g., by treating the protein
with an enzyme known to cleave proteins at sites defined by
particular amino acid residues, orby digesting the DNA with
suitable restriction enzymes and isolating the desired fragment.
Yet another suitable technique involves isolating and amplifying a
DNA fragment encoding a desired polypeptide fragment, by polymerase
chain reaction (PCR). Oligonucleotides that define the desired
termini of the DNA fragment are employed at the 5' and 3' primers
in the PCR. Preferably, PRO polypeptide fragments share at least
one biological and/or immunological activity with the native PRO
polypeptide disclosed herein.
[0644] In particular embodiments, conservative substitutions of
interest are shown in Table 6 under the heading of preferred
substitutions. If such substitutions result in a change in
biological activity, then more substantial changes, denominated
exemplary substitutions in Table 6, or as further described below
in reference to amino acid classes, are introduced and the products
screened.
5 TABLE 6 Original Exemplary Preferred Residue Substitutions
Substitutions Ala (A) val; leu; ile val Arg (R) lys; gln; asn lys
Asn (N) gln; his; lys; arg gln Asp (D) glu glu Cys (C) ser ser Gln
(Q) asn asn Glu (E) asp asp Gly (G) pro; ala ala His (H) asn; gln;
lys; arg arg Ile (I) leu; val; met; ala; phe; leu norleucine Leu
(L) norleucine; ile; val; ile met; ala; phe Lys (K) arg; gln; asn
arg Met (M) leu; phe; ile leu Phe (F) leu; val; ile; ala; tyr leu
Pro (P) ala ala Ser (S) thr thr Thr (T) ser ser Trp (W) tyr; phe
tyr Tyr (Y) trp; phe; thr; ser phe Val (V) ile; leu; met; phe; leu
ala; norleucine
[0645] Substantial modifications in function or immunological
identity of the PRO polypeptide are accomplished by selecting
substitutions that differ significantly in their effect on
maintaining (a) the structure of the polypeptide backbone in the
area of the substitution, for example, as a sheet or helical
conformation, (b) the charge or hydrophobicity of the molecule at
the target site, or (c) the bulk of the side chain. Naturally
occurring residues are divided into groups based on common
side-chain properties:
[0646] (1) hydrophobic: norleucine, met, ala, val, leu, ile;
[0647] (2) neutral hydrophilic: cys, ser, thr;
[0648] (3) acidic: asp, glu;
[0649] (4) basic: asn, gln, his, lys, arg;
[0650] (5) residues that influence chain orientation: gly, pro;
and
[0651] (6) aromatic: trp, tyr, phe.
[0652] Non-conservative substitutions will entail exchanging a
member of one of these classes for another class. Such substituted
residues also may be introduced into the conservative substitution
sites or, more preferably, into the remaining (non-conserved)
sites.
[0653] The variations can be made using methods known in the art
such as oligonucleotide-mediated (site-directed) mutagenesis,
alanine scanning, and PCR mutagenesis. Site-directed mutagenesis
[Carter et al., Nucl. Acids Res., 13:4331 (1986); Zoller et al.,
Nucl. Acids Res., 10:6487 (1987)], cassette mutagenesis [Wells et
al., Gene, 34:315 (1985)], restriction selection mutagenesis [Wells
et al., Philos. Trans. R. Soc. London SerA, 317:415 (1986)] or
other known techniques can be performed on the cloned DNA to
produce the PRO variant DNA.
[0654] Scanning amino acid analysis can also be employed to
identify one or more amino acids along a contiguous sequence. Among
the preferred scanning amino acids are relatively small, neutral
amino acids. Such amino acids include alanine, glycine, serine, and
cysteine. Alanine is typically a preferred scanning amino acid
among this group because it eliminates the side-chain beyond the
beta-carbon and is less likely to alter the main-chain conformation
of the variant [Cunningham and Wells, Science, 244: 1081-1085
(1989)]. Alanine is also typically preferred because it is the most
common amino acid. Further, it is frequently found in both buried
and exposed positions [Creighton, The Proteins, (W. H. Freeman
& Co., N.Y.); Chothia, J. Mol. Biol., 150:1 (1976)]. If alanine
substitution does not yield adequate amounts of variant, an
isoteric amino acid can be used.
[0655] C. Modifications of PRO
[0656] Covalent modifications of PRO are included within the scope
of this invention. One type of covalent modification includes
reacting targeted amino acid residues of a PRO polypeptide with an
organic derivatizing agent that is capable of reacting with
selected side chains or the N- or C- terminal residues of the PRO.
Derivatization with bifunctional agents is useful, for instance,
for crosslinking PRO to a water-insoluble support matrix or surface
for use in the method for purifying anti-PRO antibodies, and
vice-versa. Commonly used crosslinking agents include, e.g.,
1,1-bis(diazoacetyl)-2-phenylethane, glutaraldehyde,
N-hydroxysuccinimide esters, for example, esters with
4-azidosalicylic acid, homobifunctional imidoesters, including
disuccinimidyl esters such as
3,3'-dithiobis(succinimidylpropionate), bifunctional maleimides
such as bis-N-maleimido-1,8-octane and agents such as
methyl-3-[(p-azidophenyl- )dithio]propioimidate.
[0657] Other modifications include deamidation of glutaminyl and
asparaginyl residues to the corresponding glutamyl and aspartyl
residues, respectively, hydroxylation of proline and lysine,
phosphorylation of hydroxyl groups of seryl or threonyl residues,
methylation of the a-amino groups of lysine, arginine, and
histidine side chains [T. E. Creighton, Proteins: Structure and
Molecular Properties, W. H. Freeman & Co., San Francisco, pp.
79-86 (1983)], acetylation of the N-terminal amine, and amidation
of any C-terminal carboxyl group.
[0658] Another type of covalent modification of the PRO polypeptide
included within the scope of this invention comprises altering the
native glycosylation pattern of the polypeptide. "Altering the
native glycosylation pattern" is intended for purposes herein to
mean deleting one or more carbohydrate moieties found in native
sequence PRO (either by removing the underlying glycosylation site
or by deleting the glycosylation by chemical and/or enzymatic
means), and/or adding one or more glycosylation sites that are not
present in the native sequence PRO. In addition, the phrase
includes qualitative changes in the glycosylation of the native
proteins, involving a change in the nature and proportions of the
various carbohydrate moieties present.
[0659] Addition of glycosylation sites to the PRO polypeptide may
be accomplished by altering the amino acid sequence. The alteration
may be made, for example, by the addition of, or substitution by,
one or more serine or threonine residues to the native sequence PRO
(for O-linked glycosylation sites). The PRO amino acid sequence may
optionally be altered through changes at the DNA level,
particularly by mutating the DNA encoding the PRO polypeptide at
preselected bases such that codons are generated that will
translate into the desired amino acids.
[0660] Another means of increasing the number of carbohydrate
moieties on the PRO polypeptide is by chemical or enzymatic
coupling of glycosides to the polypeptide. Such methods are
described in the art, e.g., in WO 87/05330 published Sep. 11, 1987,
and in Aplin and Wriston, CRC Crit. Rev. Biochem., pp. 259-306
(1981).
[0661] Removal of carbohydrate moieties present on the PRO
polypeptide may be accomplished chemically or enzymatically or by
mutational substitution of codons encoding for amino acid residues
that serve as targets for glycosylation. Chemical deglycosylation
techniques are known in the art and described, for instance, by
Hakimuddin, etal., Arch. Biochem. Biophys.,259:52 (1987) and by
Edge et al., Anal. Biochem., 118:131(1981). Enzymatic cleavage of
carbohydrate moieties on polypeptides can be achieved by the use of
a variety of endo- and exo-glycosidases as described by Thotakura
et al., Meth. Enzymol., 138:350 (1987).
[0662] Another type of covalent modification of PRO comprises
linking the PRO polypeptide to one of a variety of nonproteinaceous
polymers, e.g., polyethylene glycol (PEG), polypropylene glycol, or
polyoxyalkylenes, in the manner set forth in U.S. Pat. Nos.
4,640,835; 4,496,689; 4,301,144; 4,670,417; 4,791,192 or
4,179,337.
[0663] The PRO of the present invention may also be modified in a
way to form a chimeric molecule comprising PRO fused to another,
heterologous polypeptide or amino acid sequence.
[0664] In one embodiment, such a chimeric molecule comprises a
fusion of the PRO with a tag polypeptide which provides an epitope
to which an anti-tag antibody can selectively bind. The epitope tag
is generally placed at the amino- or carboxyl- terminus of the PRO.
The presence of such epitope-tagged forms of the PRO can be
detected using an antibody against the tag polypeptide. Also,
provision of the epitope tag enables the PRO to be readily purified
by affinity purification using an anti-tag antibody or another type
of affinity matrix that binds to the epitope tag. Various tag
polypeptides and their respective antibodies are well known in the
art. Examples include poly-histidine (poly-his) or
poly-histidine-glycine (poly-his-gly) tags; the flu HA tag
polypeptide and its antibody 12CA5 [Field et al., Mol. Cell. Biol.,
8:2159-2165 (1988)]; the c-myc tag and the 8F9, 3C7, 6E10, G4, B7
and 9E10 antibodies thereto [Evan et al., Molecular and Cellular
Biology, 5:3610-3616 (1985)]; and the Herpes Simplex virus
glycoprotein D (gD) tag and its antibody [Paborsky et al., Protein
Engineering, 3(6):547-553 (1990)]. Other tag polypeptides include
the Flag-peptide [Hopp et al., BioTechnology,6:1204-1210 (1988)];
the KT3 epitope peptide [Martin et al., Science, 255:192-194
(1992)]; an a-tubulin epitope peptide [Skinner et al., J. Biol.
Chem., 266:15163-15166 (1991)]; and the T7 gene 10 protein peptide
tag [Lutz-Freyermuth et al., Proc. Natl. Acad. Sci. USA,
87:6393-6397 (1990)].
[0665] In an alternative embodiment, the chimeric molecule may
comprise a fusion of the PRO with an immunoglobulin or a particular
region of an immirunoglobulin. For a bivalent form of the chimeric
molecule (also referred to as an "immunoadhesin"), such a fusion
could be to the Fc region of an IgG molecule. The Ig fusions
preferably include the substitution of a soluble (transmembrane
domain deleted or inactivated) form of a PRO polypeptide in place
of at least one variable region within an Ig molecule. In a
particularly preferred embodiment, the immunoglobulin fusion
includes the hinge, CH2 and CH3, or the hinge, CH1, CH2 and CH3
regions of an IgGI molecule. For the production of immunoglobulin
fusions see also U.S. Pat. No. 5,428,130 issued Jun. 27, 1995.
[0666] D. Preparation of PRO
[0667] The description below relates primarily to production of PRO
by culturing cells transformed or transfected with a vector
containing PRO nucleic acid. It is, of course, contemplated that
alternative methods, which are well known in the art, may be
employed to prepare PRO. For instance, the PRO sequence, or
portions thereof, may be produced by direct peptide synthesis using
solid-phase techniques [see, e.g., Stewart et al., Solid-Phase
Peptide Synthesis, W. H. Freeman Co., San Francisco, Calif. (1969);
Merrifield, J. Am. Chem. Soc., 85:2149-2154 (1963)]. In vitro
protein synthesis may be performed using manual techniques or by
automation. Automated synthesis may be accomplished, for instance,
using an Applied Biosystems Peptide Synthesizer (Foster City,
Calif.) using manufacturer's instructions. Various portions of the
PRO may be chemically synthesized separately and combined using
chemical or enzymatic methods to produce the full-length PRO.
[0668] 1. Isolation of DNA Encoding PRO
[0669] DNA encoding PRO may be obtained from a cDNA library
prepared from tissue believed to possess the PRO mRNA andto express
it at a detectable level. Accordingly, human PRO DNA can be
conveniently obtained from a cDNA library prepared from human
tissue, such as described in the Examples. The PRO-encoding gene
may also be obtained from a genomic library or by known synthetic
procedures (e.g., automated nucleic acid synthesis).
[0670] Libraries can be screened with probes (such as antibodies to
the PRO or oligonucleotides of at least about 20-80 bases) designed
to identify the gene of interest or the protein encoded by it.
Screening the cDNA or genomic library with the selected probe may
be conducted using standard procedures, such as described in
Sambrook et al., Molecular Cloning: A Laboratory Manual (New York:
Cold Spring Harbor Laboratory Press, 1989). An alternative means to
isolate the gene encoding PRO is to use PCR methodology [Sambrook
et al., supra; Dieffenbach et al., PCR Primer: A Laboratory Manual
(Cold Spring Harbor Laboratory Press, 1995)].
[0671] The Examples below describe techniques for screening a cDNA
library. The oligonucleotide sequences selected as probes should be
of sufficient length and sufficiently unambiguous that false
positives are minimized. The oligonucleotide is preferably labeled
such that it can be detected upon hybridization to DNA in the
library being screened. Methods of labeling are well known in the
art, and include the use of radiolabels like .sup.32P-labeled ATP,
biotinylation or enzyme labeling. Hybridization conditions,
including moderate stringency and high stringency, are provided in
Sambrook et al., supra.
[0672] Sequences identified in such library screening methods can
be compared and aligned to other known sequences deposited and
available in public databases such as GenBank or other private
sequence databases. Sequence identity (at either the amino acid or
nucleotide level) within defined regions of the molecule or across
the full-length sequence can be determined using methods known in
the art and as described herein.
[0673] Nucleic acid having protein coding sequence may be obtained
by screening selected cDNA or genomic libraries using the deduced
amino acid sequence disclosed herein for the first time, and, if
necessary, using conventional primer extension procedures as
described in Sambrook et al., supra, to detect precursors and
processing intermediates of mRNA that may not have been
reverse-transcribed into cDNA.
[0674] 2. Selection and Transformation of Host Cells
[0675] Host cells are transfected or transformed with expression or
cloning vectors described herein for PRO production and cultured in
conventional nutrient media modified as appropriate for inducing
promoters, selecting transformants, or amplifying the genes
encoding the desired sequences. The culture conditions, such as
media, temperature, pH and the like, can be selected by the skilled
artisan without undue experimentation. In general, principles,
protocols, and practical techniques for maximizing the productivity
of cell cultures can be found in Mammalian Cell Biotechnology: a
Practical Approach, M. Butler, ed. (IRL Press, 1991) and Sambrook
et al., supra.
[0676] Methods of eukaryotic cell transfection and prokaryotic cell
transformation are known to the ordinarily skilled artisan, for
example, CaCl.sub.2, CaPO.sub.4, liposome-mediated and
electroporation. Depending on the host cell used, transformation is
performed using standard techniques appropriate to such cells. The
calcium treatment employing calcium chloride, as described in
Sambrook et al., supra, or electroporation is generally used for
prokaryotes. Infection with Agrobacterium tumefaciens is used for
transformation of certain plant cells, as described by Shaw et al.,
Gene 23:315 (1983) and WO 89/05859 published Jun. 29, 1989. For
mammalian cells without such cell walls, the calcium phosphate
precipitation method of Graham and van derEb, Virology, 52:456-457
(1978) can be employed. General aspects of mammalian cell host
system transfections have been described in U.S. Pat. No.4,399,216.
Transformations into yeast are typically carried out according to
the method of Van Solingen et al., J. Bact., 130:946 (1977) and
Hsiao et al., Proc. Natl. Acad. Sci. (USA), 76:3829 (1979).
However, other methods for introducing DNA into cells, such as by
nuclear microinjection, electroporation, bacterial protoplast
fusion with intact cells, or polycations, e.g., polybrene,
polyornithine, may also be used. For various techniques for
transforming mammalian cells, see Keown et al., Methods in
Enzymology, 185:527-537 (1990) and Mansour et al., Nature,
336:348-352 (1988).
[0677] Suitable host cells for cloning or expressing the DNA in the
vectors herein include prokaryote, yeast, or higher eukaryote
cells. Suitable prokaryotes include but are not limited to
eubacteria, such as Gram-negative or Gram-positive organisms, for
example, Enterobacteriaceae such as E. coli. Various E. coli
strains are publicly available, such as E. coli K12 strain MM294
(ATCC 31,446); E. coli X1776 (ATCC 31,537); E. coli strain W3110
(ATCC 27,325) and K5 772 (ATCC 53,635). Other suitable prokaryotic
host cells include Enterobacteriaceaesuch as Escherichia, e.g., E.
coli, Enterobacter, Erwinia, Klebsiella, Proteus, Salmonella, e.g.,
Salmonella typhimurium, Serratia, e.g., Serratia marcescans, and
Shigella, as well as Bacilli such as B. subtilis and B.
lichenifornis (e.g., B. lichenifornis 41P disclosed in DD
266,710published Apr. 12, 1989), Pseudomonas such as P. aeruginosa,
and Streptomyces. These examples are illustrative rather than
limiting. Strain W3110 is one particularly preferred host or parent
host because it is a common host strain for recombinant DNA product
fermentations. Preferably, the host cell secretes minimal amounts
of proteolytic enzymes. For example, strain W3 110 may be modified
to effect a genetic mutation in the genes encoding proteins
endogenous to the host, with examples of such hosts including E.
coli W3 110 strain 1A2, which has the complete genotype tonA; E.
coli W3 110 strain 9E4, which has the complete genotype tonA ptr3;
E. coli W3 110 strain 27C7 (ATCC 55,244), which has the complete
genotype tonA ptr3 phoA E15 (argF-lac)169 degP ompT kan.sup.r; E.
coli W3 110 strain 37D6, which has the complete genotype tonA
ptr3phoA E15 (argF-lac)169 degP ompT rbs7 ilvG kan.sup.r; E. coli
W3110 strain 40B4, which is strain 37D6 with a non-kanamycin
resistant degP deletion mutation; and an E. coli strain having
mutant periplasmic protease disclosed in U.S. Pat. No. 4,946,783
issued Aug. 7, 1990. Alternatively, in vitro methods of cloning,
e.g., PCR or other nucleic acid polymerase reactions, are
suitable.
[0678] In addition to prokaryotes, eukaryotic microbes such as
filamentous fungi or yeast are suitable cloning or expression hosts
for PRO-encoding vectors. Saccharomyces cerevisiae is a commonly
used lower eukaryotic host microorganism. Others include
Schizosaccharomyces pombe (Beach and Nurse, Nature, 290:140[1981];
EP 139,383 published May 2, 1985); Kluyveromyces hosts (U.S. Pat.
No. 4,943,529; Fleer et al., Bio/Technoloy, 9:968-975 (1991)) such
as, e.g., K. lactis (MW98-8C, CBS683, CBS4574; Louvencourt et al.,
J. Bacteriol., 154(2):737-742[1983]), K. fragilis (ATCC 12,424), K.
bulgaricus (ATCC 16,045), K. wickeramii (ATCC 24,178), K. waltii
(ATCC 56,500), K. drosophilarum (ATCC 36,906; Van den Berg et al.,
Bio/Technology, 8:135 (1990)), K. thermotolerans, and K. marxianus;
yarrowia (EP 402,226); Pichia pastoris (EP 183,070; Sreekrishna et
al., J. Basic Microbiol., 28:265-278[1988]); Candida; Trichoderma
reesia (EP 244,234); Neurospora crassa (Case et al., Proc. Natl.
Acad. Sci. USA, 76:5259-5263[1979]); Schwanniomyces such as
Schwanniomyces occidentalis (EP 394,538 published Oct. 31, 1990);
and filamentous fungi such as, e.g., Neurospora, Penicillium,
Tolypocladium (WO 91/00357 published Jan. 10, 1991), and
Aspergillus hosts such as A. nidulans (Ballance et al., Biochem.
Biophys. Res. Commun., 112:284-289[1983]; Tilburn et al., Gene,
26:205-221[1983]; Yelton et al., Proc. Natl. Acad. Sci. USA, 81:
1470-1474[1984]) and A. niger (Kelly and Hynes, EMBO J.,
4:475-479[1985]). Methylotropic yeasts are suitable herein and
include, but are not limited to, yeast capable of growth on
methanol selected from the genera consisting of Hansenula, Candida,
Kloeckera, Pichia, Saccharomyces, Torulopsis, and Rhodotorula. A
list of specific species that are exemplary of this class of yeasts
may be found in C. Anthony, The Biochemistry of Methylotrophs, 269
(1982).
[0679] Suitable host cells for the expression of glycosylated PRO
are derived from multicellular organisms. Examples of invertebrate
cells include insect cells such as Drosophila S2 and Spodoptera
Sf9, as well as plant cells. Examples of useful mammalian host cell
lines include Chinese hamster ovary (CHO) and COS cells. More
specific examples include monkey kidney CV1 line transformed by
SV40 (COS-7, ATCC CRL 1651); human embryonic kidney line (293 or
293 cells subcloned for growth in suspension culture, Graham et
al., J. Gen Virol., 36:59 (1977)); Chinese hamster ovary
cells/-DHFR (CHO, Urlaub and Chasin, Proc. Natl. Acad. Sci. USA,
77:4216(1980)); mouse sertoli cells (TM4, Mather, Biol. Reprod.,
23:243-251 (1980)); human lung cells (W138, ATCC CCL 75); human
liver cells (Hep G2, HB 8065); and mouse mammary tumor (MMT 060562,
ATCC CCL51). The selection of the appropriate host cell is deemed
to be within the skill in the art.
[0680] 3. Selection and Use of a Replicable Vector
[0681] The nucleic acid (e.g., cDNA or genomic DNA) encoding PRO
may be inserted into a replicable vector for cloning (amplification
of the DNA) or for expression. Various vectors are publicly
available. The vector may, for example, be in the form of a
plasmid, cosmid, viral particle, or phage. The appropriate nucleic
acid sequence may be inserted into the vector by a variety of
procedures. In general, DNA is inserted into an appropriate
restriction endonuclease site(s) using techniques known in the art.
Vector components generally include, but are not limited to, one or
more of a signal sequence, an origin of replication, one or more
marker genes, an enhancer element, a promoter, and a transcription
termination sequence. Construction of suitable vectors containing
one or more of these components employs standard ligation
techniques which are known to the skilled artisan.
[0682] The PRO may be produced recombinantly not only directly, but
also as a fusion polypeptide with a heterologous polypeptide, which
may be a signal sequence or other polypeptide having a specific
cleavage site at the N-terminus of the mature protein or
polypeptide. In general, the signal sequence may be a component of
the vector, or it may be a part of the PRO-encoding DNA that is
inserted into the vector. The signal sequence may be a prokaryotic
signal sequence selected, for example, from the group of the
alkaline phosphatase, penicillinase, Ipp, or heat-stable
enterotoxin II leaders. For yeast secretion the signal sequence may
be, e.g., the yeast invertase leader, alpha factor leader
(including Saccharomyces and Kluyveromyces .alpha.-factor leaders,
the latter described in U.S. Pat. No. 5,010,182), or acid
phosphatase leader, the C. albicans glucoamylase leader (EP 362,179
published Apr. 4, 1990), or the signal described in WO 90/13646
published Nov. 15, 1990. In mammalian cell expression, mammalian
signal sequences may be used to direct secretion of the protein,
such as signal sequences from secreted polypeptides of the same or
related species, as well as viral secretory leaders.
[0683] Both expression and cloning vectors contain a nucleic acid
sequence that enables the vector to replicate in one or more
selected host cells. Such sequences are well known for a variety of
bacteria, yeast, and viruses. The origin of replication from the
plasmid pBR322 is suitable for most Gram-negative bacteria, the
2.mu. plasmid origin is suitable for yeast, and various viral
origins (SV40, polyoma, adenovirus, VSV or BPV) are useful for
cloning vectors in mammalian cells.
[0684] Expression and cloning vectors will typically contain a
selection gene, also termed a selectable marker. Typical selection
genes encode proteins that (a) confer resistance to antibiotics or
other toxins, e.g., ampicillin, neomycin, methotrexate, or
tetracycline, (b) complement auxotrophic deficiencies, or (c)
supply critical nutrients not available from complex media, e.g.,
the gene encoding D-alanine racemase forBacilli.
[0685] An example of suitable selectable markers for mammalian
cells are those that enable the identification of cells competent
to take up the PRO-encoding nucleic acid, such as DHFR or thymidine
kinase. An appropriate host cell when wild-type DHFR is employed is
the CHO cell line deficient in DHFR activity, prepared and
propagated as described by Urlaub et al., Proc. Natl. Acad. Sci.
USA, 77:4216 (1980). A suitable selection gene for use in yeast is
the trp1 gene present in the yeast plasmid YRp7 [Stinchcomb et al.,
Nature, 282:39 (1979); Kingsman et al., Gene,7:141(1979); Tschemper
et al., Gene,10:157(1980)]. The trp1 gene provides a selection
marker for a mutant strain of yeast lacking the ability to grow in
tryptophan, for example, ATCC No. 44076 or PEP4-1 [Jones, Genetics,
85:12 (1977)].
[0686] Expression and cloning vectors usually contain apromoter
operably linked to the PRO-encoding nucleic acid sequence to direct
mRNA synthesis. Promoters recognized by a variety of potential host
cells are well known. Promoters suitable for use with prokaryotic
hosts include the P-lactamase and lactose promoter systems
[Changetal., Nature, 275:615 (1978); Goeddeletal., Nature, 281:544
(1979)], alkaline phosphatase, atryptophan (trp) promoter system
[Goeddel, Nucleic Acids Res., 8:4057 (1980); EP 36,776], and hybrid
promoters such as the tac promoter [deBoer et al., Proc. Natl.
Acad. Sci. USA, 80:21-25 (1983)]. Promoters for use in bacterial
systems also will contain a Shine-Dalgarno (S.D.) sequence operably
linked to the DNA encoding PRO.
[0687] Examples of suitable promoting sequences for use with yeast
hosts include the promoters for 3-phosphoglycerate kinase [Hitzeman
et al., J. Biol. Chem., 255:2073 (1980)] or other glycolytic
enzymes [Hess et al., J. Adv. Enzvme Reg., 7:149 (1968); Holland,
Biochemistry, 17:4900 (1978)], such as enolase,
glyceraldehyde-3-phosphate dehydrogenase, hexokinase, pyruvate
decarboxylase, phosphofructokinase, glucose-6-phosphate isomerase,
3-phosphoglycerate mutase, pyruvate kinase, triosephosphate
isomerase, phosphoglucose isomerase, and glucokinase.
[0688] Other yeast promoters, which are inducible promoters having
the additional advantage of transcription controlled by growth
conditions, are the promoter regions for alcohol dehydrogenase 2,
isocytochrome C, acid phosphatase, degradative enzymes associated
with nitrogen metabolism, metallothionein,
glyceraldehyde-3-phosphate dehydrogenase, and enzymes responsible
for maltose and galactose utilization. Suitable vectors and
promoters for use in yeast expression are further described in EP
73,657.
[0689] PRO transcription from vectors in mammalian host cells is
controlled, for example, by promoters obtained from the genomes of
viruses such as polyoma virus, fowlpox virus (UK 2,211,504
published Jul. 5, 1989), adenovirus (such as Adenovirus 2), bovine
papilloma virus, avian sarcoma virus, cytomegalovirus, a
retrovirus, hepatitis-B virus and Simian Virus 40 (SV40),
fromheterologous mammalianpromoters, e.g., the actin promoter or an
immunoglobulin promoter, and from heat-shock promoters, provided
such promoters are compatible with the host cell systems.
[0690] Transcription of a DNA encoding the PRO by higher eukaryotes
may be increased by inserting an enhancer sequence into the vector.
Enhancers are cis-acting elements of DNA, usually about from 10 to
300 bp, that act on a promoter to increase its transcription. Many
enhancer sequences are now known from mammalian genes (globin,
elastase, albumin, a-fetoprotein, and insulin). Typically, however,
one will use an enhancer from a eukaryotic cell virus. Examples
include the SV40 enhancer on the late side of the replication
origin (bp 100-270), the cytomegalovirus early promoter enhancer,
the polyoma enhancer on the late side of the replication origin,
and adenovirus enhancers. The enhancer may be spliced into the
vector at a position 5' or 3' to the PRO coding sequence, but is
preferably located at a site 5' from the promoter.
[0691] Expression vectors used in eukaryotic host cells (yeast,
fungi, insect, plant, animal, human, or nucleated cells from other
multicellular organisms) will also contain sequences necessary for
the termination of transcription and for stabilizing the mRNA. Such
sequences are commonly available from the 5' and, occasionally 3',
untranslated regions of eukaryotic or viral DNAs or cDNAs. These
regions contain nucleotide segments transcribed as polyadenylated
fragments in the untranslated portion of the mRNA encoding PRO.
[0692] Still other methods, vectors, and host cells suitable for
adaptation to the synthesis of PRO in recombinant vertebrate cell
culture are described in Gething et al., Nature, 293:620-625
(1981); Mantei et al., Nature, 281:40-46 (1979); EP 117,060; and EP
117,058.
[0693] 4. Detecting Gene Amplification/Expression
[0694] Gene amplification and/or expression may be measured in a
sample directly, for example, by conventional Southern blotting,
Northern blotting to quantitate the transcription of mRNA [Thomas,
Proc. Natl. Acad. Sci. USA, 77:5201-5205 (1980)], dot blotting (DNA
analysis), or in situ hybridization, using an appropriately labeled
probe, based on the sequences provided herein. Alternatively,
antibodies may be employed that can recognize specific duplexes,
including DNA duplexes, RNA duplexes, and DNA-RNA hybrid duplexes
or DNA-protein duplexes. The antibodies in turn may be labeled and
the assay may be carried out where the duplex is bound to a
surface, so that upon the formation of duplex on the surface, the
presence of antibody bound to the duplex can be detected.
[0695] Gene expression, alternatively, may be measured by
immunological methods, such as immunohistochemical staining of
cells or tissue sections and assay of cell culture or body fluids,
to quantitate directly the expression of gene product. Antibodies
useful for immunohistochemical staining and/or assay of sample
fluids may be either monoclonal or polyclonal, and may be prepared
in any mammal. Conveniently, the antibodies may be prepared against
a native sequence PRO polypeptide or against a synthetic peptide
based on the DNA sequences provided herein or against exogenous
sequence fused to PRO DNA and encoding a specific antibody
epitope.
[0696] 5. Purification of Polypeptide
[0697] Forms of PRO may be recovered from culture medium or from
host cell lysates. If membrane-bound, it can be released from the
membrane using a suitable detergent solution (e.g. Triton-X 100) or
by enzymatic cleavage. Cells employed in expression of PRO can be
disrupted by various physical or chemical means, such as
freeze-thaw cycling, sonication, mechanical disruption, or cell
lysing agents.
[0698] It may be desired to purify PRO from recombinant cell
proteins or polypeptides. The following procedures are exemplary of
suitable purification procedures: by fractionation on an
ion-exchange column; ethanol precipitation; reverse phase HPLC;
chromatography on silica or on a cation-exchange resin such as
DEAE; chromatofocusing; SDS-PAGE; ammonium sulfate precipitation;
gel filtration using, for example, Sephadex G-75; protein A
Sepharose columns to remove contaminants such as IgG; and metal
chelating columns to bind epitope-tagged forms of the PRO. Various
methods of protein purification may be employed and such methods
are known in the art and described for example in Deutscher,
Methods in Enzamology, 182 (1990); Scopes, Protein Purification:
Principles and Practice, Springer-Verlag, New York (1982).
Thepurificationstep(s) selected will depend, for example, on the
nature of the production process used and the particular PRO
produced.
[0699] E. Uses for PRO
[0700] Nucleotide sequences (or their complement) encoding PRO have
various applications in the art of molecular biology, including
uses as hybridization probes, in chromosome and gene mapping and in
the generation of anti-sense RNA and DNA. PRO nucleic acid will
also be useful for the preparation of PRO polypeptides by the
recombinant techniques described herein.
[0701] The full-length native sequence PRO gene, or portions
thereof, may be used as hybridization probes for a cDNA library to
isolate the full-length PRO cDNA or to isolate still other cDNAs
(for instance, those encoding naturally-occurring variants of PRO
or PRO from other species) which have a desired sequence identity
to the native PRO sequence disclosed herein. Optionally, the length
of the probes will be about 20 to about 50 bases. The hybridization
probes may be derived from at least partially novel regions of the
full length native nucleotide sequence wherein those regions may be
determined without undue experimentation or from genomic sequences
including promoters, enhancer elements and introns of native
sequence PRO. By way of example, a screening method will comprise
isolating the coding region of the PRO gene using the known DNA
sequence to synthesize a selected probe of about 40 bases.
Hybridization probes may be labeled by a variety of labels,
including radionucleotides such as .sup.32P or .sup.35S, or
enzymatic labels such as alkaline phosphatase coupled to the probe
via avidin/biotin coupling systems. Labeled probes having a
sequence complementary to that of the PRO gene of the present
invention can be used to screen libraries of human cDNA, genomic
DNA or mRNA to determine which members of such libraries the probe
hybridizes to. Hybridization techniques are described in further
detail in the Examples below.
[0702] Any EST sequences disclosed in the present application may
similarly be employed as probes, using the methods disclosed
herein.
[0703] Other useful fragments of the PRO nucleic acids include
antisense or sense oligonucleotides comprising a singe-stranded
nucleic acid sequence (either RNA or DNA) capable of binding to
target PRO mRNA (sense) or PRO DNA (antisense) sequences. Antisense
or sense oligonucleotides, according to the present invention,
comprise a fragment of the coding region of PRO DNA. Such a
fragment generally comprises at least about 14 nucleotides,
preferably from about 14 to 30 nucleotides. The ability to derive
an antisense or a sense oligonucleotide, based upon a cDNA sequence
encoding a given protein is described in, for example, Stein and
Cohen (Cancer Res. 48:2659, 1988) and van der Krol et al.
(BioTechnigues 6:958, 1988).
[0704] Binding of antisense or sense oligonucleotides to target
nucleic acid sequences results in the formation of duplexes that
block transcription or translation of the target sequence by one of
several means, including enhanced degradation of the duplexes,
premature termination of transcription or translation, or by other
means. The antisense oligonucleotides thus may be used to block
expression of PRO proteins. Antisense or sense oligonucleotides
further comprise oligonucleotides having modified
sugar-phosphodiester backbones (or other sugar linkages, such as
those described in WO 91/06629) and wherein such sugar linkages are
resistant to endogenous nucleases. Such oligonucleotides with
resistant sugar linkages are stable.in vivo (i.e., capable of
resisting enzymatic degradation) but retain sequence specificity to
be able to bind to target nucleotide sequences.
[0705] Other examples of sense or antisense oligonucleotides
include those oligonucleotides which are covalently linked to
organic moieties, such as those described in WO 90/10048, and other
moieties that increases affinity of the oligonucleotide for a
target nucleic acid sequence, such as poly-(L-lysine). Further
still, intercalating agents, such as ellipticine, and alkylating
agents or metal complexes may be attached to sense or antisense
oligonucleotides to modify binding specificities of the antisense
or sense oligonucleotide for the target nucleotide sequence.
[0706] Antisense or sense oligonucleotides may be introduced into a
cell containing the target nucleic acid sequence by any gene
transfer method, including, for example, CaPO.sub.4-mediated DNA
transfection, electroporation, or by using gene transfer vectors
such as Epstein-Barr virus. In a preferred procedure, an antisense
or sense oligonucleotide is inserted into a suitable retroviral
vector. A cell containing the target nucleic acid sequence is
contacted with the recombinant retroviral vector, either in vivo or
ex vivo. Suitable retroviral vectors include, but are not limited
to, those derived from the murine retrovirus M-MuLV, N2 (a
retrovirus derived from M-MuLV), or the double copy vectors
designated DCTSA, DCT5B and DCT5C (see WO 90/13641).
[0707] Sense or antisense oligonucleotides also may be introduced
into a cell containing the target nucleotide sequence by formation
of a conjugate with a ligand binding molecule, as described in WO
91/04753. Suitable ligand binding molecules include, but are not
limited to, cell surface receptors, growth factors, other
cytokines, or other ligands that bind to cell surface receptors.
Preferably, conjugation of the ligand binding molecule does not
substantially interfere with the ability of the ligand binding
molecule to bind to its corresponding molecule or receptor, or
block entry of the sense or antisense oligonucleotide or its
conjugated version into the cell.
[0708] Alternatively, a sense or an antisense oligonucleotide may
be introduced into a cell containing the target nucleic acid
sequence by formation of an oligonucleotide-lipid complex, as
described in WO 90/10448. The sense or antisense
oligonucleotide-lipid complex is preferably dissociated within the
cell by an endogenous lipase.
[0709] Antisense or sense RNA or DNA molecules are generally at
least about 5 bases in length, about 10 bases in length, about 15
bases in length, about 20 bases in length, about 25 bases in
length, about 30 bases in length, about 35 bases in length, about
40 bases in length, about 45 bases in length, about 50 bases in
length, about 55 bases in length, about 60 bases in length, about
65 bases in length, about 70 bases in length, about 75 bases in
length, about 80 bases in length, about 85 bases in length, about
90 bases in length, about 95 bases in length, about 100 bases in
length, or more.
[0710] The probes may also be employed in PCR techniques to
generate a pool of sequences for identification of closely related
PRO coding sequences.
[0711] Nucleotide sequences encoding a PRO can also be used to
construct hybridization probes for mapping the gene which encodes
that PRO and for the genetic analysis of individuals with genetic
disorders. The nucleotide sequences provided herein may be mapped
to a chromosome and specific regions of a chromosome using known
techniques, such as in situ hybridization, linkage analysis against
known chromosomal markers, and hybridization screening with
libraries.
[0712] When the coding sequences for PRO encode a protein which
binds to another protein (example, where the PRO is a receptor),
the PRO can be used in assays to identify the other proteins or
molecules involved in the binding interaction. By such methods,
inhibitors of the receptor/ligand binding interaction can be
identified. Proteins involved in such binding interactions can also
be used to screen for peptide or small molecule inhibitors or
agonists of the binding interaction. Also, the receptor PRO can be
used to isolate correlative ligand(s). Screening assays can be
designed to find lead compounds that mirnic the biological activity
of a native PRO or a receptor for PRO. Such screening assays will
include assays amenable to high-throughput screening of chemical
libraries, making them particularly suitable for identifying small
molecule drug candidates. Small molecules contemplated include
synthetic organic or inorganic compounds. The assays can be
performed in a variety of formats, including protein-protein
binding assays, biochemical screening assays, immunoassays and cell
based assays, which are well characterized in the art.
[0713] Nucleic acids which encode PRO or its modified formns can
also be used to generate either transgenic animals or "knock out"
animals which, in turn, are useful in the development and screening
of therapeutically useful reagents. A transgenic animal (e.g., a
mouse or rat) is an animal having cells that contain a transgene,
which transgene was introduced into the animal or an ancestor of
the animal at a prenatal, e.g., an embryonic stage. A transgene is
a DNA which is integrated into the genome of a cell from which a
transgenic animal develops. In one embodiment, cDNA encoding PRO
can be used to clone genomic DNA encoding PRO in accordance with
established techniques and the genomic sequences used to generate
transgenic animals that contain cells which express DNA encoding
PRO. Methods for generating transgenic animals, particularly
animals such as mice or rats, have become conventional in the art
and are described, for example, in U.S. Pat. Nos. 4,736,866 and
4,870,009. Typically, particular cells would be targeted for PRO
transgene incorporation with tissue-specific enhancers. Transgenic
animals that include a copy of a transgene encoding PRO introduced
into the germ line of the animal at an embryonic stage can be used
to examine the effect of increased expression of DNA encoding PRO.
Such animals can be used as tester animals for reagents thought to
confer protection from, for example, pathological conditions
associated with its overexpression. In accordance with this facet
of the invention, an animal is treated with the reagent and a
reduced incidence of the pathological condition, compared to
untreated animals bearing the transgene, would indicate a potential
therapeutic intervention for the pathological condition.
[0714] Alternatively, non-human homologues of PRO can be used to
construct a PRO "knock out" animal which has a defective or altered
gene encoding PRO as a result of homologous recombination between
the endogenous gene encoding PRO and altered genomic DNA encoding
PRO introduced into an embryonic stem cell of the animal. For
example, cDNA encoding PRO can be used to clone genomic DNA
encoding PRO in accordance with established techniques. A portion
of the genomic DNA encoding PRO can be deleted or replaced with
another gene, such as a gene encoding a selectable marker which can
be used to monitor integration. Typically, several kilobases of
unaltered flanking DNA (both at the 5' and 3' ends) are included in
the vector [see e.g., Thomas and Capecchi, Cell, 51:503 (1987) for
a description of homologous recombination vectors]. The vector is
introduced into an embryonic stem cell line (e.g., by
electroporation) and cells in which the introduced DNA has
homologously recombined with the endogenous DNA are selected [see
e.g., Li et al., Cell, 69:915 (1992)]. The selected cells are then
injected into a blastocyst of an animal (e.g., a mouse or rat) to
form aggregation chimeras [see e.g., Bradley, in Teratocarcinomas
and Embryonic Stem Cells: A Practical Approach, E. J. Robertson,
ed. (IRL, Oxford, 1987), pp. 113-152]. A chimeric embryo can then
be implanted into a suitable pseudopregnant female foster animal
and the embryo brought to term to create a "knock out" animal.
Progeny harboring the homologously recombined DNA in their germ
cells can be identified by standard techniques and used to breed
animals in which all cells of the animal contain the homologously
recombined DNA. Knockout animals can be characterized for instance,
for their ability to defend against certain pathological conditions
and for their development of pathological conditions due to absence
of the PRO polypeptide.
[0715] Nucleic acid encoding the PRO polypeptides may also be used
in gene therapy. In gene therapy applications, genes are introduced
into cells in order to achieve in vivo synthesis of a
therapeutically effective genetic product, for example for
replacement of a defective gene. "Gene therapy" includes both
conventional gene therapy where a lasting effect is achieved by a
single treatment, and the administration of gene therapeutic
agents, which involves the one time or repeated administration of a
therapeutically effective DNA or mRNA. Antisense RNAs and DNAs can
be used as therapeutic agents for blocking the expression of
certain genes in vivo. It has already been shown that short
antisense oligonucleotides can be imported into cells where they
act as inhibitors, despite their low intracellular concentrations
caused by their restricted uptake by the cell membrane. (Zamecnik
et al., Proc. Natl. Acad. Sci. USA 83:4143-4146[1986]). The
oligonucleotides can be modified to enhance their uptake, e.g. by
substituting their negatively charged phosphodiester groups by
uncharged groups.
[0716] There are a variety of techniques available for introducing
nucleic acids into viable cells. The techniques vary depending upon
whether the nucleic acid is transferred into cultured cells in
vitro, or in vivo in the cells of the intended host. Techniques
suitable for the transfer of nucleic acid into mammalian cells in
vitro include the use of liposomes, electroporation,
microinjection, cell fusion, DEAE-dextran, the calcium phosphate
precipitation method, etc. The currently preferred in vivo gene
transfer techniques include transfection with viral (typically
retroviral) vectors and viral coat protein-liposome mediated
transfection (Dzau et al., Trends in Biotechnology
11,205-210[1993]). In some situations it is desirable to provide
the nucleic acid source with an agent that targets the target
cells, such as an antibody specific for a cell surface membrane
protein or the target cell, a ligand for a receptor on the target
cell, etc. Where liposomes are employed, proteins which bind to a
cell surface membrane protein associated with endocytosis may be
used for targeting and/or to facilitate uptake, e.g. capsid
proteins or fragments thereof tropic for aparticular cell type,
antibodies forproteins which undergo internalization in cycling,
proteins that target intracellular localization and enhance
intracellular half-life. The technique of receptor-mediated
endocytosis is described, for example, by Wu et al., J. Biol. Chem.
262,4429-4432 (1987); and Wagner et al., Proc. Natl. Acad. Sci. USA
87, 3410-3414 (1990). For review of gene marking and gene therapy
protocols see Anderson et al., Science 256, 808-813 (1992).
[0717] The PRO polypeptides described herein may also be employed
as molecular weight markers for protein electrophoresis purposes
and the isolated nucleic acid sequences may be used for
recombinantly expressing those markers.
[0718] The nucleic acid molecules encoding the PRO polypeptides or
fragments thereof described herein are useful for chromosome
identification. In this regard, there exists an ongoing need to
identify new chromosome markers, since relatively few chromosome
marking reagents, based upon actual sequence data are presently
available. Each PRO nucleic acid molecule of the present invention
can be used as a chromosome marker.
[0719] The PRO polypeptides and nucleic acid molecules of the
present invention may also be used diagnostically for tissue
typing, wherein the PRO polypeptides of the present invention may
be differentially expressed in one tissue as compared to another,
preferably in a diseased tissue as compared to a normal tissue of
the same tissue type. PRO nucleic acid molecules will find use for
generating probes for PCR, Northern analysis, Southern analysis and
Western analysis.
[0720] The PRO polypeptides described herein may also be employed
as therapeutic agents. The PRO polypeptides of the present
invention can be formulated according to known methods to prepare
pharmaceutically useful compositions, whereby the PRO product
hereof is combined in admixture with a pharmaceutically acceptable
carrier vehicle. Therapeutic formulations are prepared for storage
by mixing the active ingredient having the desired degree of purity
with optional physiologically acceptable carriers, excipients or
stabilizers (Remington's Pharmaceutical Sciences 16th edition,
Osol, A. Ed. (1980)), in the form of lyophilized formulations or
aqueous solutions. Acceptable carriers, excipients or stabilizers
are nontoxic to recipients at the dosages and concentrations
employed, and include buffers such as phosphate, citrate and other
organic acids; antioxidants including ascorbic acid; low molecular
weight (less than about 10 residues) polypeptides; proteins, such
as serum albumin, gelatin or immunoglobulins; hydrophilic polymers
such as polyvinylpyrrolidone, amino acids such as glycine,
glutamine, asparagine, arginine or lysine; monosaccharides,
disaccharides and other carbohydrates including glucose, mannose,
or dextrins; chelating agents such as EDTA; sugar alcohols such as
mannitol or sorbitol; salt-forming counterions such as sodium;
and/or nonionic surfactants such as TWEEN.TM., PLURONICS.TM. or
PEG.
[0721] The formulations to be used for in vivo administration must
be sterile. This is readily accomplished by filtration through
sterile filtration membranes, prior to or following lyophilization
and reconstitution.
[0722] Therapeutic compositions herein generally are placed into a
container having a sterile access port, for example, an intravenous
solution bag or vial having a stopper pierceable by a hypodermic
injection needle.
[0723] The route of administration is in accord with known methods,
e.g. injection or infusion by intravenous, intraperitoneal,
intracerebral, intramuscular, intraocular, intraarterial or
intralesional routes, topical administration, or by sustained
release systems.
[0724] Dosages and desired drug concentrations of pharmaceutical
compositions of the present invention may vary depending on the
particular use envisioned. The determination of the appropriate
dosage or route of administration is well within the skill of an
ordinary physician. Animal experiments provide reliable guidance
for the determination of effective doses for human therapy.
Interspecies scaling of effective doses can be performed following
the principles laid down by Mordenti, J. and Chappell, W. "The use
of interspecies scaling in toxicokinetics" In Toxicokinetics and
New Drug Development, Yacobi et al., Eds., Pergamon Press, New York
1989, pp. 42-96.
[0725] When in vivo administration of a PRO polypeptide or agonist
or antagonist thereof is employed, normal dosage amounts may vary
from about 10 nglkg to up to 100 mg/kg of mammal body weight or
more per day, preferably about 1 itg/kg/day to 10 mg/kg/day,
depending upon the route of administration. Guidance as to
particular dosages and methods of delivery is provided in the
literature; see, for example, U.S. Pat. Nos. 4,657,760; 5,206,344;
or 5,225,212. It is anticipated that different formulations will be
effective for different treatment compounds and different
disorders, that administration targeting one organ or tissue, for
example, may necessitate delivery in a manner different from that
to another organ or tissue.
[0726] Where sustained-release administration of a PRO polypeptide
is desired in a formulation with release characteristics suitable
for the treatment of any disease or disorder requiring
administration of the PRO polypeptide, microencapsulation of the
PRO polypeptide is contemplated. Microencapsulation of recombinant
proteins for sustained release has been successfully performed with
human growth hormone (rhGH), interferon-(rhIFN-), interleukin-2,
and MN rgp120. Johnson et al., Nat. Med., 2:795-799 (1996); Yasuda,
Biomed. Ther., 27:1221-1223 (1993); Hora et al., Bio/Technology,
8:755-758 (1990); Cleland, "Design and Production of Single
Immunization Vaccines Using Polylactide Polyglycolide Microsphere
Systems," in Vaccine Design: The Subunit and Adjuvant Approach,
Powell and Newman, eds, (Plenum Press: New York, 1995), pp.
439-462; WO 97/03692, WO 96/40072, WO 96/07399; and U.S. Pat. No.
5,654,010.
[0727] The sustained-release formulations of these proteins were
developed using poly-lactic-coglycolic acid (PLGA) polymer due to
its biocompatibility and wide range of biodegradable properties.
The degradation products of PLGA, lactic and glycolic acids, can be
cleared quickly within the human body. Moreover, the degradability
of this polymer can be adjusted from months to years depending on
its molecular weight and composition. Lewis, "Controlled release of
bioactive agents from lactide/glycolide polymer," in: M. Chasin and
R. Langer (Eds.), Biodegradable Polymers as Drug Delivery Systems
(Marcel Dekker: New York, 1990), pp. 1-41.
[0728] This invention encompasses methods of screening compounds to
identify those that mimic the PRO polypeptide (agonists) or prevent
the effect of the PRO polypeptide (antagonists). Screening assays
for antagonist drug candidates are designed to identify compounds
that bind or complex with the PRO polypeptides encoded by the genes
identified herein, or otherwise interfere with the interaction of
the encoded polypeptides with other cellular proteins. Such
screening assays will include assays amenable to high-throughput
screening of chemical libraries, making them particularly suitable
for identifying small molecule drug candidates.
[0729] The assays can be performed in a variety of formats,
including protein-protein binding assays, biochemical screening
assays, immunoassays, and cell-based assays, which are well
characterized in the art.
[0730] All assays for antagonists are common in that they call for
contacting the drug candidate with a PRO polypeptide encoded by a
nucleic acid identified herein under conditions and for a time
sufficient to allow these two components to interact.
[0731] In binding assays, the interaction is binding and the
complex formed can be isolated or detected in the reaction mixture.
In a particular embodiment, the PRO polypeptide encoded by the gene
identified herein or the drug candidate is immobilized on a solid
phase, e.g., on a microtiter plate, by covalent or non-covalent
attachments. Non-covalent attachment generally is accomplished by
coating the solid surface with a solution of the PRO polypeptide
and drying. Alternatively, an immobilized antibody, e.g., a
monoclonal antibody, specific for the PRO polypeptide to be
immobilized can be used to anchor it to a solid surface. The assay
is performed by adding the non-immobilized component, which may be
labeled by a detectable label, to the immobilized component, e.g.,
the coated surface containing the anchored component. When the
reaction is complete, the non-reacted components are removed, e.g.,
by washing, and complexes anchored on the solid surface are
detected. When the originally non-immobilized component carries a
detectable label, the detection of label immobilized on the surface
indicates that complexing occurred. Where the originally
non-immobilized component does not carry a label, complexing can be
detected, for example, by using a labeled antibody specifically
binding the immobilized complex.
[0732] If the candidate compound interacts with but does not bind
to a particular PRO polypeptide encoded by a gene identified
herein, its interaction with that polypeptide can be assayed by
methods well known for detecting protein-protein interactions. Such
assays include traditional approaches, such as, e.g.,
cross-linking, co-immunoprecipitation, and co-purification through
gradients or chromatographic columns. In addition, protein-protein
interactions can be monitored by using a yeast-based genetic system
described by Fields and co-workers (Fields and Song, Nature
(London), 340:245-246 (1989); Chien et al., Proc. Natl. Acad. Sci.
USA, 88:9578-9582 (1991)) as disclosed by Chevray and Nathans,
Proc. Natl. Acad. Sci. USA, 89: 5789-5793 (1991). Many
transcriptional activators, such as yeast GALA, consist of two
physically discrete modular domains, one acting as the DNA-binding
domain, the other one functioning as the transcription-activation
domain. The yeast expression system described in the foregoing
publications (generally referred to as the "two-hybrid system")
takes advantage of this property, and employs two hybrid proteins,
one in which the target protein is fused to the DNA-binding domain
of GALA, and another, in which candidate activating proteins are
fused to the activation domain. The expression of a GALl-lacZ
reporter gene under control of a GALA-activated promoter depends on
reconstitution of GALA activity via protein-protein interaction.
Colonies containing interacting polypeptides are detected with a
chromogenic substrate for .beta.-galactosidase. A complete kit
(MATCHRAKER.TM.) for identifying protein-protein interactions
between two specific proteins using the two-hybrid technique is
commercially available from Clontech. This system can also be
extended to map protein domains involved in specific protein
interactions as well as to pinpoint amino acid residues that are
crucial for these interactions.
[0733] Compounds that interfere with the interaction of a gene
encoding a PRO polypeptide identified herein and other intra- or
extracellular components can be tested as follows: usually a
reaction mixture is prepared containing the product of the gene and
the intra- or extracellular component under conditions and for a
time allowing for the interaction and binding of the two products.
To test the ability of a candidate compound to inhibit binding, the
reaction is run in the absence and in the presence of the test
compound. In addition, a placebo may be added to a third reaction
mixture, to serve as positive control. The binding (complex
formation) between the test compound and the intra- or
extracellular component present in the mixture is monitored as
described hereinabove. The formation of a complex in the control
reaction(s) but not in the reaction mixture containing the test
compound indicates that the test compound interferes with the
interaction of the test compound and its reaction partner.
[0734] To assay for antagonists, the PRO polypeptide may be added
to a cell along with the compound to be screened for a particular
activity and the ability of the compound to inhibit the activity of
interest in the presence of the PRO polypeptide indicates that the
compound is an antagonist to the PRO polypeptide. Alternatively,
antagonists may be detected by combining the PRO polypeptide and a
potential antagonist with membrane-bound PRO polypeptide receptors
or recombinant receptors under appropriate conditions for a
competitive inhibition assay. The PRO polypeptide can be labeled,
such as by radioactivity, such that the number of PRO polypeptide
molecules bound to the receptor can be used to determine the
effectiveness of the potential antagonist. The gene encoding the
receptor can be identified by numerous methods known to those of
skill in the art, for example, ligand panning and FACS sorting.
Coligan et al., Current Protocols in Immun., 1(2): Chapter 5
(1991). Preferably, expression cloning is employed wherein
polyadenylated RNA is prepared from a cell responsive to the PRO
polypeptide and a cDNA library created from this RNA is divided
into pools and used to transfect COS cells or other cells that are
not responsive to the PRO polypeptide. Transfected cells that are
grown on glass slides are exposed to labeled PRO polypeptide. The
PRO polypeptide can be labeled by a variety of means including
iodination or inclusion of a recognition site for a site-specific
protein kinase. Following fixation and incubation, the slides are
subjected to autoradiographic analysis. Positive pools are
identified and sub-pools are prepared and re-transfected using an
interactive sub-pooling and re-screening process, eventually
yielding a single clone that encodes the putative receptor.
[0735] As an alternative approach for receptor identification,
labeled PRO polypeptide can be photoaffinity-linked with cell
membrane or extract preparations that express the receptor
molecule. Cross-linked material is resolved by PAGE and exposed to
X-ray film. The labeled complex containing the receptor can be
excised, resolved into peptide fragments, and subjected to protein
micro-sequencing. The amino acid sequence obtained from micro-
sequencing would be used to design a set of degenerate
oligonucleotide probes to screen a cDNA library to identify the
gene encoding the putative receptor.
[0736] In another assay for antagonists, mammalian cells or a
membrane preparation expressing the receptor would be incubated
with labeled PRO polypeptide in the presence of the candidate
compound. The ability of the compound to enhance or block this
interaction could then be measured.
[0737] More specific examples of potential antagonists include an
oligonucleotide that binds to the fusions of immunoglobulin with
PRO polypeptide, and, in particular, antibodies including, without
limitation, poly- and monoclonal antibodies and antibody fragments,
single-chain antibodies, anti-idiotypic antibodies, and chimeric or
humanized versions of such antibodies or fragments, as well as
human antibodies and antibody fragments. Alternatively, a potential
antagonist may be a closely related protein, for example, a mutated
form of the PRO polypeptide that recognizes the receptor but
imparts no effect, thereby competitively inhibiting the action of
the PRO polypeptide.
[0738] Another potential PRO polypeptide antagonist is an antisense
RNA or DNA construct prepared using antisense technology, where,
e.g., an antisense RNA or DNA molecule acts to block directly the
translation of mRNA by hybridizing to targeted mRNA and preventing
protein translation. Antisense technology can be used to control
gene expression through triple-helix formation or antisense DNA or
RNA, both of which methods are based on binding of apolynucleotide
to DNA or RNA. For example, the 5'coding portion of the
polynucleotide sequence, which encodes the mature PRO polypeptides
herein, is used to design an antisense RNA oligonucleotide of from
about 10 to 40 base pairs in length. A DNA oligonucleotide is
designed to be complementary to a region of the gene involved in
transcription (triple helix--see Lee et al., Nucl. Acids Res.,
6:3073 (1979); Cooney et al., Science, 241: 456 (1988); Dervan et
al., Science, 251:1360 (1991)), thereby preventing transcription
and the production of the PRO polypeptide. The antisense RNA
oligonucleotide hybridizes to the mRNA in vivo and blocks
translation of the mRNA molecule into the PRO polypeptide
(antisense--Okano, Neurochem., 56:560 (1991); Oligodeoxynucleotides
as Antisense Inhibitors of Gene Expression (CRC Press: Boca Raton,
Fla., 1988). The oligonucleotides described above can also be
delivered to cells such that the antisense RNA or DNA may be
expressed in vivo to inhibit production of the PRO polypeptide.
When antisense DNA is used, oligodeoxyribonucleotides derived from
the translation-initiation site, e.g., between about -10 and +10
positions of the target gene nucleotide sequence, are
preferred.
[0739] Potential antagonists include small molecules that bind to
the active site, the receptor binding site, or growth factor or
other relevant binding site of the PRO polypeptide, thereby
blocking the normal biological activity of the PRO polypeptide.
Examples of small molecules include, but are not limited to, small
peptides or peptide-like molecules, preferably soluble peptides,
and synthetic non-peptidyl organic or inorganic compounds.
[0740] Ribozymes are enzymatic RNA molecules capable of catalyzing
the specific cleavage of RNA. Ribozymes act by sequence-specific
hybridization to the complementary target RNA, followed by
endonucleolytic cleavage. Specific ribozyme cleavage sites within a
potential RNA target can be identified by known techniques. For
further details see, e.g., Rossi, Current Biology, 4:469471 (1994),
and PCT publication No. WO 97/33551 (published Sep. 18, 1997).
[0741] Nucleic acid molecules in triple-helix formation used to
inhibit transcription should be single-stranded and composed of
deoxynucleotides. The base composition of these oligonucleotides is
designed such that it promotes triple-helix formation via Hoogsteen
base-pairing rules, which generally require sizeable stretches of
purines or pyrimidines on one strand of a duplex. For further
details see, e.g., PCT publication No. WO 97/33551, supra.
[0742] These small molecules can be identified by any one or more
of the screening assays discussed hereinabove and/or by any other
screening techniques well known for those skilled in the art.
[0743] Diagnostic and therapeutic uses of the herein disclosed
molecules may also be based upon the positive functional assay hits
disclosed and described below.
[0744] F. Anti-PRO Antibodies
[0745] The present invention further provides anti-PRO antibodies.
Exemplary antibodies include polyclonal, monoclonal, humanized,
bispecific, and heteroconjugate antibodies.
[0746] 1. Polyclonal Antibodies
[0747] The anti-PRO antibodies may comprise polyclonal antibodies.
Methods of preparing polyclonal antibodies are known to the skilled
artisan. Polyclonal antibodies can be raised in a mammal, for
example, by one or more injections of an immunizing agent and, if
desired, an adjuvant. Typically, the immunizing agent and/or
adjuvant will be injected in the mammal by multiple subcutaneous or
intraperitoneal injections. The immunizing agent may include the
PRO polypeptide or a fusion protein thereof. It may be useful to
conjugate the immunizing agent to aprotein known to be immunogenic
in the mammal being immunized. Examples of such immunogenic
proteins include but are not limited to keyhole limpet hemocyanin,
serum albumin, bovine thyroglobulin, and soybean trypsin inhibitor.
Examples of adjuvants which may be employed include Freund's
complete adjuvant and MPL-TDM adjuvant (monophosphoryl Lipid A,
synthetic trehalose dicorynomycolate). The immunization protocol
may be selected by one skilled in the art without undue
experimentation.
[0748] 2. Monoclonal Antibodies
[0749] The anti-PRO antibodies may, alternatively, be monoclonal
antibodies. Monoclonal antibodies may be prepared using hybridoma
methods, such as those described by Kohler and Milstein, Nature,
256:495 (1975). In a hybridoma method, a mouse, hamster, or other
appropriate host animal, is typically immunized with an immunizing
agent to elicit lymphocytes that produce or are capable of
producing antibodies that will specifically bind to the immunizing
agent. Alternatively, the lymphocytes may be immunized in
vitro.
[0750] The immunizing agent will typically include the PRO
polypeptide or a fusion protein thereof. Generally, either
peripheral blood lymphocytes ("PBLs") are used if cells of human
origin are desired, or spleen cells or lymph node cells are used if
non-human mammalian sources are desired. The lymphocytes are then
fused with an immortalized cell line using a suitable fusing agent,
such as polyethylene glycol, to form a hybridoma cell [Goding,
Monoclonal Antibodies: Principles and Practice, Academic Press,
(1986) pp. 59-103]. Immortalized cell lines are usually transformed
mammalian cells, particularly myeloma cells of rodent, bovine and
human origin. Usually, rat or mouse myeloma cell lines are
employed. The hybridoma cells may be cultured in a suitable culture
medium that preferably contains one or more substances that inhibit
the growth or survival of the unfused, immortalized cells. For
example, if the parental cells lack the enzyme hypoxanthine guanine
phosphoribosyl transferase (HGPRT or HPRT), the culture medium for
the hybridomas typically will include hypoxanthine, aminopterin,
and thymidine ("HAT medium"), which substances prevent the growth
of HGPRT-deficient cells.
[0751] Preferred immortalized cell lines are those that fuse
efficiently, support stable high level expression of antibody by
the selected antibody-producing cells, and are sensitive to a
medium such as HAT medium. More preferred immortalized cell lines
are murine myeloma lines, which can be obtained, for instance, from
the Salk Institute Cell Distribution Center, San Diego, California
and the American Type Culture Collection, Manassas, Virginia. Human
myeloma and mouse-human heteromyeloma cell lines also have been
described for the production of human monoclonal antibodies
[Kozbor, J. Immunol., 133:3001 (1984); Brodeur et al., Monoclonal
Antibody Production Techniques and Applications, Marcel Dekker,
Inc., New York, (1987) pp. 51-63].
[0752] The culture medium in which the hybridoma cells are cultured
can then be assayed for the presence of monoclonal antibodies
directed against PRO. Preferably, the binding specificity of
monoclonal antibodies produced by the hybridoma cells is determined
by immunoprecipitation or by an in vitro binding assay, such as
radioimmunoassay (RIA) or enzyme-linked immunoabsorbent assay
(ELISA). Such techniques and assays are known in the art. The
binding affinity of the monoclonal antibody can, for example, be
determined by the Scatchard analysis of Munson and Pollard, Anal.
Biochem., 107:220 (1980).
[0753] After the desired hybridoma cells are identified, the clones
may be subdloned by limiting dilution procedures and grown by
standard methods [Goding, supra]. Suitable culture media for this
purpose include, for example, Dulbecco's Modified Eagle's Medium
and RPMI-1640 medium. Alternatively, the hybridoma cells may be
grown in vivo as ascites in a mammal.
[0754] The monoclonal antibodies secreted by the subclones may be
isolated or purified from the culture medium or ascites fluid by
conventional immunoglobulin purification procedures such as, for
example, protein A-Sepharose, hydroxylapatite chromatography, gel
electrophoresis, dialysis, or affinity chromatography.
[0755] The monoclonal antibodies may also be made by recombinant
DNA methods, such as those described in U.S. Pat. No. 4,816,567.
DNA encoding the monoclonal antibodies of the invention can be
readily isolated and sequenced using conventional procedures (e.g.,
by using oligonucleotide probes that are capable of binding
specifically to genes encoding the heavy and light chains of murine
antibodies). The hybridoma cells of the invention serve as a
preferred source of such DNA. Once isolated, the DNA may be placed
into expression vectors, which are then transfected into host cells
such as simian COS cells, Chinese hamster ovary (CHO) cells, or
myeloma cells that do not otherwise produce immunoglobulin protein,
to obtain the synthesis of monoclonal antibodies in the recombinant
host cells. The DNA also may be modified, for example, by
substituting the coding sequence for human heavy and light chain
constant domains in place of the homologous murine sequences [U.S.
Pat. No. 4,816,567; Morrison et al., u or by covalently joining to
the immunoglobulin coding sequence all or part of the coding
sequence for a non-immunoglobulin polypeptide. Such a
non-immunoglobulin polypeptide can be substituted for the constant
domains of an antibody of the invention, or can be substituted for
the variable domains of one antigen-combining site of an antibody
of the invention to create a chimeric bivalent antibody.
[0756] The antibodies may be monovalent antibodies. Methods for
preparing monovalent antibodies are well known in the art. For
example, one method involves recombinant expression of
immunoglobulin light chain and modified heavy chain. The heavy
chain is truncated generally at any point in the Fc region so as to
prevent heavy chain crosslinking. Alternatively, the relevant
cysteine residues are substituted with another amino acid residue
or are deleted so as to prevent crosslinking.
[0757] In vitro methods are also suitable for preparing monovalent
antibodies. Digestion of antibodies to produce fragments thereof,
particularly, Fab fragments, can be accomplished using routine
techniques known in the art.
[0758] 3. Human and Humanized Antibodies
[0759] The anti-PRO antibodies of the invention may further
comprise humanized antibodies or human antibodies. Humanized forms
of non-human (e.g., murine) antibodies are chimeric
inununoglobulins, immunoglobulin chains or fragments thereof (such
as Fv, Fab, Fab', F(ab').sub.2 or other antigen-binding
subsequences of antibodies) which contain minimal sequence derived
from non-human inmuunoglobulin. Humanized antibodies include human
immunoglobulins (recipient antibody) in which residues from a
complementary determining region (CDR) of the recipient are
replaced by residues from a CDR of a non-human species (donor
antibody) such as mouse, rat or rabbit having the desired
specificity, affinity and capacity. In some instances, Fv framework
residues of the human immunoglobulin are replaced by corresponding
non-human residues. Humanized antibodies may also comprise residues
which are found neither in the recipient antibody nor in the
imported CDR or framework sequences. In general, the humanized
antibody will comprise substantially all of at least one, and
typically two, variable domains, in which all or substantially all
of the CDR regions correspond to those of a non-human
immunoglobulin and all or substantially all of the FR regions are
those of a human immunoglobulin consensus sequence. The humanized
antibody optimally also will comprise at least a portion of an
immunoglobulin constant region (Fc), typically that of a human
immunoglobulin [Jones et al., Nature, 321:522-525 (1986); Riechmann
et al., Nature, 332:323-329 (1988); and Presta, Curr. Op. Struct.
Biol., 2:593-596(1992)].
[0760] Methods for humanizing non-human antibodies are well known
in the art. Generally, a humanized antibody has one or more amino
acid residues introduced into it from a source which is non-human.
These non-human amino acid residues are often referred to as
"import" residues, which are typically taken from an "import"
variable domain. Humanization can be essentially performed
following the method of Winter and co-workers [Jones et al.,
Nature, 321:522-525 (1986); Riechmann et al., Nature 332:323-327
(1988); Verhoeyen et al., Science, 239:1534-1536 (1988)], by
substituting rodent CDRs or CDR sequences for the corresponding
sequences of a human antibody. Accordingly, such "humanized"
antibodies are chimeric antibodies (U.S. Pat. No. 4,816,567),
wherein substantially less than an intact human variable domain has
been substituted by the corresponding sequence from a non-human
species. In practice, humanized antibodies are typically human
antibodies in which some CDR residues and possibly some FR residues
are substituted by residues from analogous sites in rodent
antibodies.
[0761] Human antibodies can also be produced using various
techniques known in the art, including phage display libraries
[Hoogenboom and Winter, J. Mol. Biol. 227:381 (1991); Marks et al.,
J. Mol. Biol. 222:581 (1991)]. The techniques of Cole et al. and
Boerner et al. are also available for the preparation of human
monoclonal antibodies (Cole et al., Monoclonal Antibodies and
Cancer Therany, Alan R. Liss, p.77 (1985) and Boerner et al., J.
Immunol., 147(1):86-95 (1991)]. Similarly, human antibodies can be
made by introducing of human immunoglobulin loci into transgenic
animals, e.g., mice in which the endogenous immunoglobulin genes
have been partially or completely inactivated. Upon challenge,
human antibody production is observed, which closely resembles that
seen in humans in all respects, including gene rearrangement,
assembly, and antibody repertoire. This approach is described, for
example, in U.S. Pat. Nos. 5,545,807; 5,545,806; 5,569,825;
5,625,126; 5,633,425; 5,661,016, and in the following scientific
publications: Marks etal, Bio/Technology 10, 779-783 (1992);
Lonberg et al., Nature 368 856-859 (1994); Morrison, Nature 368,
812-13 (1994); Fishwild et al., Nature Biotechnology 14, 845-51
(1996); Neuberger, Nature Biotechnology 14, 826 (1996); Lonberg and
Huszar, Intern. Rev. Immunol. 13 65-93 (1995).
[0762] The antibodies may also be affinity matured using known
selection and/or mutagenesis methods as described above. Preferred
affinity matured antibodies have an affinity which is five times,
more preferably 10 times, even more preferably 20 or 30 times
greater than the starting antibody (generally murine, humanized or
human) from which the matured antibody is prepared.
[0763] 4. Bispecific Antibodies
[0764] Bispecific antibodies are monoclonal, preferably human or
humanized, antibodies that have binding specificities for at least
two different antigens. In the present case, one of the binding
specificities is for the PRO, the other one is for any other
antigen, and preferably for a cell-surface protein or receptor or
receptor subunit.
[0765] Methods for making bispecific antibodies are known in the
art. Traditionally, the recombinant production of bispecific
antibodies is based on the co-expression of two immunoglobulin
heavy-chain/light-chain pairs, where the two heavy chains have
different specificities [Milstein and Cuello, Nature 305:537-539
(1983)]. Because of the random assortment of immunoglobulin heavy
and light chains, these hybridomas (quadromas) produce a potential
mixture of ten different antibody molecules, of which only one has
the correct bispecific structure. The purification of the correct
molecule is usually accomplished by affinity chromatography steps.
Similar procedures are disclosed in WO 93/08829, published 13 May
1993, and in Traunecker et al., EMBO J., 10:3655-3659 (1991).
[0766] Antibody variable domains with the desired binding
specificities (antibody-antigen combining sites) can be fused to
immunoglobulin constant domain sequences. The fusion preferably is
with an immunoglobulin heavy-chain constant domain, comprising at
least part of the hinge, CH2, and CH3 regions. It is preferred to
have the first heavy-chain constant region (CHI) containing the
site necessary for light-chain binding present in at least one of
the fusions. DNAs encoding the immunoglobulin heavy-chain fusions
and, if desired, the immunoglobulin light chain, are inserted into
separate expression vectors, and are co-transfected into a suitable
host organism. For further details of generating bispecific
antibodies see, for example, Suresh et al., Methods in Enzymology,
121:210 (1986).
[0767] According to another approach described in WO 96/27011, the
interface between a pair of antibody molecules can be engineered to
maximize the percentage of heterodimers which are recovered from
recombinant cell culture. The preferred interface comprises at
least a part of the CH3 region of an antibody constant domain. In
this method, one or more small amino acid side chains from the
interface of the first antibody molecule are replaced with larger
side chains (e.g. tyrosine or tryptophan). Compensatory "cavities"
of identical or similar size to the large side chain(s) are created
on the interface of the second antibody molecule by replacing large
amino acid side chains with smaller ones (e.g. alanine or
threonine). This provides a mechanism for increasing the yield of
the heterodimer over other unwanted end-products such as
homodimers.
[0768] Bispecific antibodies can be prepared as full length
antibodies or antibody fragments (e.g. F(ab').sub.2 bispecific
antibodies). Techniques for generating bispecific antibodies from
antibody fragments have been described in the literature. For
example, bispecific antibodies can be prepared can be prepared
using chemical linkage. Brennan et al., Science 229:81 (1985)
describe a procedure wherein intact antibodies are proteolytically
cleaved to generate F(ab').sub.2 fragments. These fragments are
reduced in the presence of the dithiol complexing agent sodium
arsenite to stabilize vicinal dithiols and prevent intermolecular
disulfide formation. The Fab' fragments generated are then
converted to thionitrobenzoate (TNB) derivatives. One of the
Fab'-TNB derivatives is then reconverted to the Fab'-thiol by
reduction with mercaptoethylamine and is mixed with an equimolar
amount of the other Fab'-TNB derivative to form the bispecific
antibody. The bispecific antibodies produced can be used as agents
for the selective immobilization of enzymes.
[0769] Fab' fragments may be directly recovered from E. coli and
chemically coupled to form bispecific antibodies. Shalaby et al.,
J. Exp. Med. 175:217-225 (1992) describe the production of a fully
humanized bispecific antibody F(ab').sub.2 molecule. Each Fab'
fragment was separately secreted from E. coli and subjected to
directed chemical coupling in vitro to form the bispecific
antibody. The bispecific antibody thus formed was able to bind to
cells overexpressing the ErbB2 receptor and normal human T cells,
as well as trigger the lytic activity of human cytotoxic
lymphocytes against human breast tumor targets.
[0770] Various technique for making and isolating bispecific
antibody fragments directly from recombinant cell culture have also
been described. For example, bispecific antibodies have been
produced using leucine zippers. Kostelny etal, J. Immunol.
148(5):1547-1553 (1992). The leucine zipper peptides from the Fos
and Jun proteins were linked to the Fab' portions of two different
antibodies by gene fusion. The antibody homodimers were reduced at
the hinge region to form monomers and then re-oxidized to form the
antibody heterodimers. This method can also be utilized for the
production of antibody homodimers. The "diabody" technology
described by Hollinger et al., Proc. Natl. Acad. Sci. USA
90:6444-6448 (1993) has provided an alternative mechanism for
making bispecific antibody fragments. The fragments comprise a
heavy-chain variable domain (V.sub.H) connected to a light-chain
variable domain (V.sub.L) by a linker which is too short to allow
pairing between the two domains on the same chain. Accordingly, the
V.sub.H and V.sub.L domains of one fragment are forced to pair with
the complementary V.sub.L and V.sub.H domains of another fragment,
thereby forming two antigen-binding sites. Another strategy for
making bispecific antibody fragments by the use of single-chain Fv
(sFv) dimers has also been reported. See, Gruber et al., J.
Immunol. 152:5368 (1994).
[0771] Antibodies with more than two valencies are contemplated.
For example, trispecific antibodies can be prepared. Tutt et al.,
J. Immunol. 147:60 (1991).
[0772] Exemplary bispecific antibodies may bind to two different
epitopes on a given PRO polypeptide herein. Alternatively, an
anti-PRO polypeptide arm may be combined with an arm which binds to
a triggering molecule on a leukocyte such as a T-cell receptor
molecule (e.g. CD2, CD3, CD28, or B7), or Fc receptors for IgG
(Fc.gamma.R), such as Fc.gamma.RI (CD64), Fc.gamma.RII (CD32) and
Fc.gamma.RIII (CD16) so as to focus cellular defense mechanisms to
the cell expressing the particular PRO polypeptide. Bispecific
antibodies may also be used to localize cytotoxic agents to cells
which express a particular PRO polypeptide. These antibodies
possess a PRO-binding arm and an arm which binds a cytotoxic agent
or a radionuclide chelator, such as EOTUBE, DPTA, DOTA, or TETA.
Another bispecific antibody of interest binds the PRO polypeptide
and further binds tissue factor (Th).
[0773] 5. Heteroconjugate Antibodies
[0774] Heteroconjugate antibodies are also within the scope of the
present invention. Heteroconjugate antibodies are composed of two
covalently joined antibodies. Such antibodies have, for example,
been proposed to target immune system cells to unwanted cells [U.S.
Pat. No.4,676,980], and for treatment of HIV infection [WO
91/00360; WO 92/200373; EP 03089]. It is contemplated that the
antibodies may be prepared in vitro using known methods in
synthetic protein chemistry, including those involving crosslinking
agents. For example, immunotoxins may be constructed using a
disulfide exchange reaction or by forming a thioether bond.
Examples of suitable reagents for this purpose include
irninothiolate and methyl-4-mercaptobutyrimidate and those
disclosed, for example, in U.S. Pat. No. 4,676,980.
[0775] 6. Effector Function Engineering
[0776] It may be desirable to modify the antibody of the invention
with respect to effector function, so as to enhance, e.g., the
effectiveness of the antibody in treating cancer. For example,
cysteine residue(s) may be introduced into the Fc region, thereby
allowing interchain disulfide bond formation in this region. The
homodimeric antibody thus generated may have improved
internalization capability and/or increased complement-mediated
cell killing and antibody-dependent cellular cytotoxicity (ADCC).
See Caron et al., J. Exp Med., 176:
[0777] 1191-1195 (1992) and Shopes, J. Immunol., 148: 2918-2922
(1992). Homodimeric antibodies with enhanced anti-tumoractivity may
also be prepared using heterobifunctional cross-linkers as
described in Wolff et al. Cancer Research, 53: 2560-2565 (1993).
Alternatively, an antibody can be engineered that has dual Fc
regions and may thereby have enhanced complementlysis andADCC
capabilities. See Stevenson et al., Anti-Cancer Drug Design. 3:
219-230 (1989).
[0778] 7. Immunoconjugates
[0779] The invention also pertains to immunoconjugates comprising
an antibody conjugated to a cytotoxic agent 20 such as a
chemotherapeutic agent, toxin (e.g., an enzymatically active toxin
of bacterial, fungal, plant, or animal origin, or fragments
thereof), or a radioactive isotope (i.e., a radioconjugate).
[0780] Chemotherapeutic agents useful in the generation of such
immunoconjugates have been described above. Enzymatically active
toxins and fragments thereof that can be used include diphtheria A
chain, nonbinding active fragments of diphtheria toxin, exotoxin A
chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain,
modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin
proteins, Phytolaca americana proteins (PAPI, PAPII, and PAP-S),
momordica charantia inhibitor, curcin, crotin, sapaonaria
officinalis inhibitor, gelonin, mitogellin, restrictocin,
phenomycin, enomycin, and the tricothecenes. A variety of
radionuclides are available for the production of radioconjugated
antibodies. Examples include .sup.212Bi, .sup.131I, .sup.131In,
.sup.90Y, and .sup.186Re. Conjugates of the antibody and cytotoxic
agent are made using a variety of bifunctional protein-coupling
agents such as N-succinimidyl-3-(2-pyridyldithiol) propionate
(SPDP), iminothiolane (IT), bifunctional derivatives of imidoesters
(such as dimethyl adipimidate HCL), active esters (such as
disuccinimidyl suberate), aldehydes (such as glutareldehyde),
bis-azido compounds (such as his (p-azidobenzoyl) hexanediamine),
bis-diazonium derivatives (such as
bis-(p-diazoniumbenzoyl)-ethylenediamine), diisocyanates (such as
tolyene 2,6-diisocyanate), and bis-active fluorine compounds (such
as 1,5-difluoro-2,4-dinitrobenzene). For example, a ricin
immunotoxin can be prepared as described in Vitetta et al.,
Science, 238: 1098 (1987). Carbon-14-labeled
1-isothiocyanatobenzyl-3-methyldiethylene triaminepentaacetic acid
(MX-DTPA) is an exemplary chelating agent for conjugation of
radionucleotide to the antibody. See WO94/11026.
[0781] In another embodiment, the antibody may be conjugated to a
"receptor" (such streptavidin) for utilization in tumor
pretargeting wherein the antibody-receptor conjugate is
administered to the patient, followed by removal of unbound
conjugate from the circulation using a clearing agent and then
administration of a "ligand" (e.g., avidin) that is conjugated to a
cytotoxic agent (e.g., a radionucleotide).
[0782] 8. Immunoliposomes
[0783] The antibodies disclosed herein may also be formulated as
immunoliposomes. Liposomes containing the antibody are prepared by
methods known in the art, such as described in Epstein et al.,
Proc. Natl. Acad. Sci. USA, 82: 3688 (1985); Hwang et al., Proc.
Natl Acad. Sci. USA, 77: 4030 (1980); and U.S. Pat. Nos. 4,485,045
and 4,544,545. Liposomes with enhanced circulation time are
disclosed in U.S. Pat. No. 5,013,556.
[0784] Particularly useful liposomes can be generated by the
reverse-phase evaporation method with a lipid composition
comprising phosphatidylcholine, cholesterol, and PEG-derivatized
phosphatidylethanolamine (PEG-PE). Liposomes are extruded through
filters of defined pore size to yield liposomes with the desired
diameter. Fab' fragments of the antibody of the present invention
can be conjugated to the liposomes as described in Martin et al.,
J. Biol. Chem. 257: 286-288 (1982) via adisulfide-interchange
reaction. A chemotherapeutic agent (such as Doxorubicin) is
optionally contained within the liposome. See Gabizon et al., J.
National Cancer Inst.,81(19): 1484 (1989).
[0785] 9. Pharmaceutical Compositions of Antibodies
[0786] Antibodies specifically binding a PRO polypeptide identified
herein, as well as other molecules identified by the screening
assays disclosed hereinbefore, can be administered for the
treatment of various disorders in the form of pharmaceutical
compositions.
[0787] If the PRO polypeptide is intracellular and whole antibodies
are used as inhibitors, internalizing antibodies are preferred.
However, lipofections or liposomes can also be used to deliver the
antibody, or an antibody fragment, into cells. Where antibody
fragments are used, the smallest inhibitory fragment that
specifically binds to the binding domain of the target protein is
preferred. For example, based upon the variable-region sequences of
an antibody, peptide molecules can be designed that retain the
ability to bind the target protein sequence. Such peptides can be
synthesized chemically and/or produced by recombinant DNA
technology. See, e.g., Marasco et al., Proc. Natl. Acad. Sci. USA,
90:7889-7893 (1993). The formulation herein may also contain more
than one active compound as necessary for the particular indication
being treated, preferably those with complementary activities that
do not adversely affect each other. Alternatively, or in addition,
the composition may comprise an agent that enhances its function,
such as, for example, a cytotoxic agent, cytokine, chemotherapeutic
agent, or growth-inhibitory agent. Such molecules are suitably
present in combination in amounts that are effective for the
purpose intended.
[0788] The active ingredients may also be entrapped in
microcapsules prepared, for example, by coacervation techniques or
by interfacial polymerization, for example, hydroxymethylcellulose
or gelatin-microcapsules and poly-(methylmethacylate)
microcapsules, respectively, in colloidal drug delivery systems
(for example, liposomes, albumin microspheres, microemulsions,
nano-particles, and nanocapsules) or in macroemulsions. Such
techniques are disclosed in Remington's Pharmaceutical Sciences,
supra.
[0789] The formulations to be used for in vivo administration must
be sterile. This is readily accomplished by filtration through
sterile filtration membranes.
[0790] Sustained-release preparations may be prepared. Suitable
examples of sustained-release preparations include semipermeable
matrices of solid hydrophobic polymers containing the antibody,
which matrices are in the form of shaped articles, e.g., films, or
microcapsules. Examples of sustained-release matrices include
polyesters, hydrogels (for example,
poly(2-hydroxyethyl-methacrylate), orpoly(vinylalcohol)),
polylactides (U.S. Pat. No. 3,773,919), copolymers of L-glutarnic
acid and .gamma. ethyl-L-glutamate, non-degradable ethylene-vinyl
acetate, degradable lactic acid-glycolic acid copolymers such as
the LUPRON DEPOT.TM. (injectable microspheres composed of lactic
acid-glycolic acid copolymer and leuprolide acetate), and
poly-D-(-)-3-hydroxybutyric acid. While polymers such as
ethylene-vinyl acetate and lactic acid-glycolic acid enable release
of molecules for over 100 days, certain hydrogels release proteins
for shorter time periods. When encapsulated antibodies remain in
the body for a long time, they may denature or aggregate as a
result of exposure to moisture at 37 .degree. C., resulting in a
loss of biological activity and possible changes in immunogenicity.
Rational strategies can be devised for stabilization depending on
the mechanism involved. For example, if the aggregation mechanism
is discovered to be intermolecular S-S bond formation through
thio-disulfide interchange, stabilization may be achieved by
modifying sulfhydryl residues, lyophilizing from acidic solutions,
controlling moisture content, using appropriate additives, and
developing specific polymer matrix compositions.
[0791] G. Uses for anti-PRO Antibodies
[0792] The anti-PRO antibodies of the invention have various
utilities. For example, anti-PRO antibodies may be used in
diagnostic assays for PRO, e.g., detecting its expression (and in
some cases, differential expression) in specific cells, tissues, or
serum. Various diagnostic assay techniques known in the art may be
used, such as competitive binding assays, direct or indirect
sandwich assays and inmunoprecipitation assays conducted in either
heterogeneous or homogeneous phases [Zola, Monoclonal Antibodies: A
Manual of Techniques, CRC Press, Inc. (1987) pp. 147-158]. The
antibodies used in the diagnostic assays can be labeled with a
detectable moiety. The detectable moiety should be capable of
producing, either directly or indirectly, a detectable signal. For
example, the detectable moiety may be a radioisotope, such as
.sup.3H, .sup.14C, .sup.32P, .sup.35S, or .sup.125I, a fluorescent
or chemiluminescent compound, such as fluorescein isothiocyanate,
rhodamine, or luciferin, or an enzyme, such as alkaline
phosphatase, beta-galactosidase or horseradish peroxidase. Any
method known in the art for conjugating the antibody to the
detectable moiety may be employed, including those methods
described by Hunter et al., Nature, 144:945 (1962); David et al.,
Biochemistry, 13:1014 (1974); Pain et al., J. Immunol. Meth.,
40:219 (1981); and Nygren, J. Histochem and Cytochem., 30:407
(1982).
[0793] Anti-PRO antibodies also are useful for the affinity
purification of PRO from recombinant cell culture or natural
sources. In this process, the antibodies against PRO are
immobilized on a suitable support, such a Sephadex resin or filter
paper, using methods well known in the art. The immobilized
antibody then is contacted with a sample containing the PRO to be
purified, and thereafter the support is washed with a suitable
solvent that will remove substantially all the material in the
sample except the PRO, which is bound to the immobilized antibody.
Finally, the support is washed with another suitable solvent that
will release the PRO from the antibody.
[0794] The following examples are offered for illustrative purposes
only, and are not intended to limit the scope of the present
invention in any way.
[0795] All patent and literature references cited in the present
specification are hereby incorporated by reference in their
entirety.
EXAMPLES
[0796] Commercially available reagents referred to in the examples
were used according to manufacturer's instructions unless otherwise
indicated. The source of those cells identified in the following
examples, and throughout the specification, by ATCC accession
numbers is the American Type Culture Collection, Manassas, Va.
Example 1
[0797] Extracellular Domain Homology Screening to Identify Novel
Polypeptides and cDNA Encoding Therefor
[0798] The extracellular domain (ECD) sequences (including the
secretion signal sequence, if any) from about 950 known secreted
proteins from the Swiss-Prot public database were used to search
EST databases. The EST databases included public databases (e.g.,
Dayhoff, GenBank), and proprietary databases (e.g. LIFESEQ.TM.,
Incyte Pharmaceuticals, Palo Alto, Calif.). The search was
performed using the computer program BLAST or BLAST-2 (Altschul et
al., Methods in Enzvmology 266:460-480 (1996)) as a comparison of
the ECD protein sequences to a 6 frame translation of the EST
sequences. Those comparisons with a BLAST score of 70 (or in some
cases 90) or greater that did not encode known proteins were
clustered and assembled into consensus DNA sequences with the
program "phrap" (Phil Green, University of Washington, Seattle,
Wash.).
[0799] Using this extracellular domain homology screen, consensus
DNA sequences were assembled relative to the other identified EST
sequences using phrap. In addition, the consensus DNA sequences
obtained were often (but not always) extended using repeated cycles
of BLAST or BLAST-2 and phrap to extend the consensus sequence as
far as possible using the sources of EST sequences discussed
above.
[0800] Based upon the consensus sequences obtained as described
above, oligonucleotides were then synthesized and used to identify
by PCR a cDNA library that contained the sequence of interest and
for use as probes to isolate a clone of the full-length coding
sequence for a PRO polypeptide. Forward and reverse PCR primers
generally range from 20 to 30 nucleotides and are often designed to
give a PCR product of about 100-1000 bp in length. The probe
sequences are typically 40-55 bp in length. In some cases,
additional oligonucleotides are synthesized when the consensus
sequence is greater than about 1-1.5 kbp. In order to screen
several libraries for a full-length clone, DNA from the libraries
was screened by PCR amplification, as per Ausubel et al., Current
Protocols in Molecular Biology, with the PCR primer pair. A
positive library was then used to isolate clones encoding the gene
of interest using the probe oligonucleotide and one of the primer
pairs.
[0801] The cDNA libraries used to isolate the cDNA clones were
constructed by standard methods using commercially available
reagents such as those from Invitrogen, San Diego, CA. The cDNA was
primed with oligo dT containing a NotI site, linked with blunt to
SalI hemikinased adaptors, cleaved with NotI, sized appropriately
by gel electrophoresis, and cloned in a defined orientation into a
suitable cloning vector (such as pRKB or pRKD; pRK5B is a precursor
of pRK5D that does not contain the SfiI site; see, Holmes et al.,
Science, 253:1278-1280 (1991)) in the unique XhoI and Noti
sites.
Example 2
[0802] Isolation of cDNA clones by Amylase Screening
[0803] 1. Preparation of Oligo dT Primed cDNA Library
[0804] mRNA was isolated from a human tissue of interest using
reagents and protocols from Invitrogen, San Diego, CA (Fast Track
2). This RNA was used to generate an oligo dT primed cDNA library
in the vector pRK5D using reagents and protocols from Life
Technologies, Gaithersburg, MD (Super Script Plasmid System). In
this procedure, the double stranded cDNA was sized to greater than
1000 bp and the SalIINotl linkered cDNA was cloned into Xhol/Notl
cleaved vector. pRK5D is a cloning vector that has an sp6
transcription initiation site followed by an SfiI restriction
enzyme site preceding the XhoILNotI cDNA cloning sites.
[0805] 2. Preparation of Random Primed cDNA Library
[0806] A secondary cDNA library was generated in order to
preferentially represent the 5' ends of the primary cDNA clones.
Sp6 RNA was generated from the primary library (described above),
and this RNA was used to generate a random primed cDNA library in
the vector pSST-AMY.0 using reagents and protocols from Life
Technologies (Super Script Plasmid System, referenced above). In
this procedure the double stranded cDNA was sized to 500-1000 bp,
linkered with blunt to NotI adaptors, cleaved with SfiI, and cloned
into SfiI/NotI cleaved vector. pSST-AMY.0 is a cloning vector that
has a yeast alcohol dehydrogenase promoter preceding the cDNA
cloning sites and the mouse amylase sequence (the mature sequence
without the secretion signal) followed by the yeast alcohol
dehydrogenase terminator, after the cloning sites. Thus, cDNAs
cloned into this vector that are fused in frame with amylase
sequence will lead to the secretion of amylase from appropriately
transfected yeast colonies.
[0807] 3. Transformation and Detection
[0808] DNA from the library described in paragraph 2 above was
chilled on ice to which was added electrocompetent DH1OB bacteria
(Life Technologies, 20 ml). The bacteria and vector mixture was
then electroporated as recommended by the manufacturer.
Subsequently, SOC media (Life Technologies, 1 ml) was added and the
mixture was incubated at 37.degree. C. for 30 minutes. The
transformants were then plated onto 20 standard 150 mm LB plates
containing ampicillin and incubated for 16 hours (37.degree. C.).
Positive colonies were scraped off the plates and the DNA was
isolated from the bacterial pellet using standard protocols, e.g.
CsCl-gradient. The purified DNA was then carried on to the yeast
protocols below.
[0809] The yeast methods were divided into three categories: (1)
Transformation of yeast with the plasmid/cDNA combined vector; (2)
Detection and isolation of yeast clones secreting amylase; and (3)
PCR amplification of the insert directly from the yeast colony and
purification of the DNA for sequencing and further analysis.
[0810] The yeast strain used was HD56-5A (ATCC-90785). This strain
has the following genotype: MAT alpha, ura3-52, leu2-3, leu2-112,
his3-11, his3-15, MAL.sup.+, SUC.sup.+, GAL.sup.+. Preferably,
yeast mutants can be employed that have deficient
post-translational pathways. Such mutants may have translocation
deficient alleles in sec71, sec72, sec62, with truncated sec71
being most preferred. Alternatively, antagonists (including
antisense nucleotides and/or ligands) which interfere with the
normal operation of these genes, other proteins implicated in this
post translation pathway (e.g., SEC61p, SEC72p, SEC62p, SEC63p,
TDJ1p or SSA1p-4p) or the complex formation of these proteins may
also be preferably employed in combination with the
amylase-expressing yeast.
[0811] Transformation was performed based on the protocol outlined
by Gietz et al., Nucl. Acid. Res., 20:1425 (1992). Transformed
cells were then inoculated from agar into YEPD complex media broth
(100 ml) and grown overnight at 30.degree. C. The YEPD broth was
prepared as described in Kaiser et al., Methods in Yeast Genetics,
Cold Spring Harbor Press, Cold Spring Harbor, N.Y., p. 207 (1994).
The overnight culture was then diluted to about 2.times.10.sup.6
cells/nlm (approx. OD.sub.600=0.1) into fresh YEPD broth (500 ml)
and regrown to 1.times.10.sup.7 cells/ml (approx.
OD.sub.600=0.4-0.5).
[0812] The cells were then harvested and prepared for
transformation by transfer into GS3 rotor bottles in a Sorval GS3
rotor at 5,000 rpm for 5 minutes, the supernatant discarded, and
then resuspended into sterile water, and centrifuged again in 50 ml
falcon tubes at 3,500 rpm in a Beckman GS-6KR centrifuge. The
supernatant was discarded and the cells were subsequently washed
with LiAc/TE (10 ml, 10 mM Tris--HCl, 1 mM EDTA pH 7.5, 100 mM
Li.sub.2OOCCH.sub.3), and resuspended into LiAc/TE (2.5 ml).
[0813] Transformation took place by mixing the prepared cells (100
.mu.l) with freshly denatured single stranded salmon testes DNA
(Lofstrand Labs, Gaithersburg, Md.) and transforming DNA (1 .mu.g,
vol. <10 .mu.l) in microfuge tubes. The mixture was mixed
briefly by vortexing, then 40% PEG/TE (600 .mu.l , 40% polyethylene
glycol-4000, 10 mM Tris--HCl, 1 mM EDTA, 100 mM
Li.sub.2OOCCH.sub.3, pH 7.5) was added. This mixture was gently
mixed and incubated at 30.degree. C. while agitating for 30
minutes. The cells were then heat shocked at 42.degree. C. for 15
minutes, and the reaction vessel centrifuged in a microfuge at
12,000 rpm for 5-10 seconds, decanted and resuspended into TE (500
.mu.l, 10 mM Tris--HCl, 1 mM EDTA pH 7.5) followed by
recentrifugation. The cells were then diluted into TE (1 ml) and
aliquots (200 .mu.l) were spread onto the selective media
previously prepared in 150 mm growth plates (VWR).
[0814] Alternatively, instead of multiple small reactions, the
transformation was performed using a single, large scale reaction,
wherein reagent amounts were scaled up accordingly.
[0815] The selective media used was a synthetic complete dextrose
agar lacking uracil (SCD-Ura) prepared as described in Kaiser et
al., Methods in Yeast Genetics, Cold Spring Harbor Press, Cold
Spring Harbor, N.Y., p.208-210 (1994). Transformants were grown at
30.degree. C. for 2-3 days.
[0816] The detection of colonies secreting amylase was performed by
including red starch in the selective growth media. Starch was
coupled to the red dye (Reactive Red-120, Sigrna) as per the
procedure described by Biely et al., Anal. Biochem. 172:176-179
(1988). The coupled starch was incorporated into the SCD-Ura agar
plates atafinal concentration of 0.15% (w/v), and was buffered
withpotassiumphosphateto apH of 7.0 (50-100 mM final
concentration).
[0817] The positive colonies were picked and streaked across fresh
selective media (onto 150 mm plates) in order to obtain well
isolated and identifiable single colonies. Well isolated single
colonies positive for amylase secretion were detected by direct
incorporation of red starch into buffered SCD-Ura agar. Positive
colonies were determined by their ability to break down starch
resulting in a clear halo around the positive colony visualized
directly.
[0818] 4. Isolation of DNA by PCR Amplification
[0819] When a positive colony was isolated, a portion of it was
picked by a toothpick and diluted into sterile water (30 .mu.l) in
a 96 well plate. At this time, the positive colonies were either
frozen and stored for subsequent analysis or immediately amplified.
An aliquot of cells (5 .mu.l) was used as a template for the PCR
reaction in a 25 ul volume containing: 0.5 .mu.l Klentaq (Clontech,
Palo Alto, Calif.); 4.0 .mu.l 10 mM dNfP's (Perkin Elmer-Cetus);
2.5 .mu.l Kentaq buffer (Clontech); 0.25 .mu.l forward oligo 1;
0.25 .mu.l reverse oligo 2; 12.5 .mu.l distilled water. The
sequence of the forward oligonucleotide 1 was:
[0820] 5'-TGTAAAACGACGGCCAGTTAAATAGACCTGCAATTATTAATCT-3' (SEQ ID
NO:553) The sequence of reverse oligonucleotide 2 was:
[0821] 5'-CAGGAAACAGCTATGACCACCTGCACACCTGCAAATCCATT-3' (SEQ ID
NO:554)
[0822] PCR was then performed as follows:
6 a. Denature 92.degree. C., 5 minutes b. 3 cycles of: Denature
92.degree. C., 30 seconds Anneal 59.degree. C., 30 seconds Extend
72.degree. C., 60 seconds c. 3 cycles of: Denature 92.degree. C.,
30 seconds Anneal 57.degree. C., 30 seconds Extend 72.degree. C.,
60 seconds d. 25 cycles of: Denature 92.degree. C., 30 seconds
Anneal 55.degree. C., 30 seconds Extend 72.degree. C., 60 seconds
e. Hold 4.degree. C.
[0823] The underlined regions of the oligonucleotides annealed to
the ADH promoter region and the amylase region, respectively, and
amplified a 307 bp region from vector pSST-AMY.0 when no insert was
present. Typically, the first 18 nucleotides of the 5' end of these
oligonucleotides contained annealing sites for the sequencing
primers. Thus, the total product of the PCR reaction from an empty
vector was 343 bp. However, signal sequence-fused cDNA resulted in
considerably longer nucleotide sequences.
[0824] Following the PCR, an aliquot of the reaction (5 .mu.l) was
examined by agarose gel electrophoresis in a 1% agarose gel using a
Tris-Borate-EDTA (THE) buffering system as described by Sambrook et
al., supra. Clones resulting in a single strong PCR product larger
than 400 bp were further analyzed by DNA sequencing after
purification with a 96 Qiaquick PCR clean-up column (Qiagen Inc.,
Chatsworth, Calif.).
Example 3
[0825] Isolation of cDNA Clones Using Signal Algorithm Analysis
[0826] Various polypeptide-encoding nucleic acid sequences were
identified by applying a proprietary signal sequence finding
algorithm developed by Genentech, Inc. (South San Francisco,
Calif.) upon ESTs as well as clustered and assembled EST fragments
from public (e.g., GenBank) and/or private (LIFESEQ.RTM., Incyte
Pharmaceuticals, Inc., Palo Alto, Calif.) databases. The signal
sequence algorithm computes a secretion signal score based on the
character of the DNA nucleotides surrounding the first and
optionally the second methionine codon(s) (ATG) at the 5'-end of
the sequence or sequence fragment under consideration. The
nucleotides following the first ATG must code for at least 35
unambiguous amino acids without any stop codons. If the first ATG
has the required amnino acids, the second is not examined. If
neither meets the requirement, the candidate sequence is not
scored. In order to determine whether the EST sequence contains an
authentic signal sequence, the DNA and corresponding amino acid
sequences surrounding the ATG codon are scored using a set of seven
sensors (evaluation parameters) known to be associated with
secretion signals. Use of this algorithm resulted in the
identification of numerous polypeptide-encoding nucleic acid
sequences.
Example 4
[0827] Isolation of cDNA Clones Encoding Human PRO Polypeptides
[0828] Using the techniques described in Examples 1 to 3 above,
numerous full-length cDNA clones were identified as encoding PRO
polypeptides as disclosed herein. These cDNAs were then deposited
under the terms of the Budapest Treaty with the American Type
Culture Collection, 10801 University Blvd., Manassas, Va.
20110-2209, USA (ATCC) as shown in Table 7 below.
7 TABLE 7 Material ATCC Dep. No. Deposit Date DNA16438-1387 209771
Apr. 14, 1998 DNA19360-2552 203654 Feb. 9, 1999 DNA33455-1548
PTA-127 May 25, 1999 DNA37155-2651 PTA-429 Jul. 27, 1999
DNA38269-2654 PTA-432 Jul. 27, 1999 DNA40619-1220 209525 Dec. 10,
1997 DNA44174-2513 203577 Jan. 12, 1999 DNA44675-2662 PTA-430 Jul.
27, 1999 DNA45408-2615 PTA-203 Jun. 8, 1999 DNA48606-1479 203040
Jul. 1, 1998 DNA52753-2656 PTA-611 Aug. 31, 1999 DNA53915-1258
209593 Jan. 21, 1998 DNA53991-2553 203649 Feb. 9, 1999
DNA54009-2517 203574 Jan. 12, 1999 DNA56055-1643 PTA-129 May 25,
1999 DNA57033-1403 209905 May 27, 1998 DNA57252-1453 203585 Jan.
12, 1999 DNA58799-1652 203665 Feb. 9, 1999 DNA59770-2652 PTA-427
Jul. 27, 1999 DNA59774-2665 PTA-615 Aug. 31, 1999 DNA60281-2518
203582 Jan. 12, 1999 DNA60736-2559 203838 Mar. 9, 1999
DNA61875-2653 PTA-428 Jul. 27, 1999 DNA62312-2558 203836 Mar. 9,
1999 DNA62849-1604 PTA-205 Jun. 8, 1999 DNA66307-2661 PTA-431 Jul.
27, 1999 DNA66677-2535 203659 Feb. 9, 1999 DNA71235-1706 203584
Jan. 12, 1999 DNA71289-2547 PTA-126 May 25, 1999 DNA73775-1707
PTA-128 May 25, 1999 DNA76385-1692 203664 Feb. 9, 1999
DNA76395-2527 203578 Jan. 12, 1999 DNA77622-2516 203554 Dec. 22,
1998 DNA77629-2573 203850 Mar. 16, 1999 DNA77645-2648 PTA-45 May
11, 1999 DNA79302-2521 203545 Dec. 22, 1998 DNA79865-2519 203544
Dec. 22, 1998 DNA80135-2655 PTA-234 Jun. 15, 1999 DNA80794-2568
203848 Mar. 16, 1999 DNA80796-2523 203555 Dec. 22, 1998
DNA80840-2605 203949 Apr. 20, 1999 DNA80899-2501 203539 Dec. 15,
1998 DNA81228-2580 203871 Mar. 23, 1999 DNA81761-2583 203862 Mar.
23, 1999 DNA82358-2738 PTA-510 Aug. 10, 1999 DNA82364-2538 203603
Jan. 20, 1999 DNA82424-2566 203813 Mar. 2, 1999 DNA82430-2557
203812 Mar. 2, 1999 DNA83500-2506 203391 Oct. 29, 1998
DNA83509-2612 203965 Apr. 27, 1999 DNA83560-2569 203816 Mar. 2,
1999 DNA84139-2555 203814 Mar. 2, 1999 DNA84141-2556 203810 Mar. 2,
1999 DNA84142-2613 PTA-22 May 4, 1999 DNA84318-2520 203580 Jan. 12,
1999 DNA84909-2590 203889 Mar. 30, 1999 DNA84912-2610 203964 Apr.
27, 1999 DNA84925-2514 203548 Dec. 22, 1998 DNA84928-2564 203817
Mar. 2, 1999 DNA84932-2657 PTA-235 Jun. 15, 1999 DNA86592-2607
203968 Apr. 27, 1999 DNA86594-2587 203894 Mar. 30, 1999
DNA86647-2591 203893 Mar. 30, 1999 DNA87185-2563 203811 Mar. 2,
1999 DNA87656-2582 203867 Mar. 23, 1999 DNA87974-2609 203963 Apr.
27, 1999 DNA88001-2565 203815 Mar. 2, 1999 DNA88004-2575 203890
Mar. 30, 1999 DNA89220-2608 PTA-130 May 25, 1999 DNA89947-2618
203970 Apr. 27, 1999 DNA90842-2574 203845 Mar. 16, 1999
DNA91775-2581 203861 Mar. 23, 1999 DNA91779-2571 203844 Mar. 16,
1999 DNA92217-2697 PTA-513 Aug. 10, 1999 DNA92219-2541 203663 Feb.
9, 1999 DNA92223-2567 203851 Mar. 16, 1999 DNA92225-2603 203950
Apr. 20, 1999 DNA92232-2589 203895 Mar. 30, 1999 DNA92233-2599
PTA-134 May 25, 1999 DNA92243-2549 203852 Mar. 16, 1999
DNA92253-2671 PTA-258 Jun. 22, 1999 DNA92254-2672 PTA-259 Jun. 22,
1999 DNA92255-2584 203866 Mar. 23, 1999 DNA92269-2570 203853 Mar.
16, 1999 DNA92288-2588 203892 Mar. 30, 1999 DNA92290-2550 203847
Mar. 16, 1999 DNA93012-2622 PTA-21 May 4, 1999 DNA93020-2642
PTA-121 May 25, 1999 DNA94830-2604 203951 Apr. 20, 1999
DNA94833-2579 203869 Mar. 23, 1999 DNA94838-2658 PTA-232 Jun. 15,
1999 DNA94844-2686 PTA-385 Jul. 20, 1999 DNA94854-2586 203864 Mar.
23, 1999 DNA96868-2677 PTA-262 Jun. 22, 1999 DNA96871-2683 PTA-381
Jul. 20, 1999 DNA96880-2624 PTA-15 May 4, 1999 DNA96986-2660
PTA-239 Jun. 15, 1999 DNA96988-2685 PTA-384 Jul. 20, 1999
DNA96995-2709 PTA-475 Aug. 3, 1999 DNA97004-2562 203854 Mar. 16,
1999 DNA97005-2687 PTA-378 Jul. 20, 1999 DNA97009-2668 PTA-257 Jun.
22, 1999 DNA97013-2667 PTA-231 Jun. 15, 1999 DNA98380-2690 PTA-388
Jul. 20, 1999 DNA98561-2696 PTA-620 Aug. 31, 1999 DNA98575-2644
PTA-118 May 25, 1999 DNA98593-2694 PTA-477 Aug. 3, 1999
DNA98600-2703 PTA-488 Aug. 3, 1999 DNA99391-2572 203849 Mar. 16,
1999 DNA99393-2560 203837 Mar. 9, 1999 DNA100276-2684 PTA-380 Jul.
20, 1999 DNA100312-2645 PTA-44 May 11, 1999 DNA100902-2646 PTA-42
May 11, 1999 DNA102899-2679 PTA-123 May 25, 1999 DNA104875-2720
PTA-482 Aug. 3, 1999 DNA105680-2710 PTA-483 Aug. 3, 1999
DNA105779-2708 PTA-485 Aug. 3, 1999 DNA105794-2695 PTA-480 Aug. 3,
1999 DNA105838-2702 PTA-476 Aug. 3, 1999 DNA107698-2715 PTA-472
Aug. 3, 1999 DNA107701-2711 PTA-487 Aug. 3, 1999 DNA107781-2707
PTA-484 Aug. 3, 1999 DNA108670-2744 PTA-546 Aug. 17, 1999
DNA108688-2725 PTA-515 Aug. 10, 1999 DNA108769-2765 PTA-861 Oct.
19, 1999 DNA108935-2721 PTA-518 Aug. 10, 1999 DNA110700-2716
PTA-512 Aug. 10, 1999 DNA111750-2706 PTA-489 Aug. 3, 1999
DNA123430-2755 PTA-614 Aug. 31, 1999 DNA125154-2785 PTA-957 Nov.
16, 1999 DNA142238-2768 PTA-819 Oct. 5, 1999 DNA22779-1130 209280
Sept. 18, 1997 DNA26847-1395 209772 Apr. 14, 1998 DNA27864-1155
209375 Oct. 16, 1997 DNA27865-1091 209296 Sept. 23, 1997
DNA28497-1130 209279 Sept. 18, 1997 DNA29101-1122 209653 Mar. 5,
1998 DNA32286-1191 209385 Oct. 16, 1997 DNA32288-1132 209261 Sept.
16, 1997 DNA32290-1164 209384 Oct. 16, 1997 DNA32292-1131 209258
Sept. 16, 1997 DNA32298-1132 209257 Sept. 16, 1997 DNA33085-1110
209087 May 30, 1997 DNA33087-1158 209381 Oct. 16, 1997
DNA33089-1132 209262 Sept. 16, 1997 DNA33092-1202 209420 Oct. 28,
1997 DNA33094-1131 209256 Sept. 16, 1997 DNA33107-1135 209251 Sept.
16, 1997 DNA33221-1133 209263 Sept. 16, 1997 DNA33223-1136 209264
Sept. 16, 1997 DNA33460-1166 209376 Oct. 16, 1997 DNA33473-1176
209391 Oct. 17, 1997 DNA33785-1143 209417 Oct. 28, 1997
DNA33786-1132 209253 Sept. 16, 1997 DNA34353-1428 209855 May 12,
1998 DNA34392-1170 209526 Dec. 10, 1997 DNA34434-1139 209252 Sept.
16, 1997 DNA35558-1167 209374 Oct. 16, 1997 DNA35595-1228 209528
Dec. 10, 1997 DNA35638-1216 209265 Sept. 16, 1997 DNA35639-1172
209396 Oct. 17, 1997 DNA35663-1129 209201 Aug. 18, 1997
DNA35674-1142 209416 Oct. 28, 1997 DNA35841-1173 209403 Oct. 17,
1997 DNA35916-1161 209419 Oct. 28, 1997 DNA35918-1174 209402 Oct.
17, 1997 DNA36350-1158 209378 Oct. 16, 1997 DNA37140-1234 209489
Nov. 21, 1997 DNA37150-1178 209401 Oct. 17, 1997 DNA38260-1180
209397 Oct. 17, 1997 DNA40021-1154 209389 Oct. 17, 1997
DNA40587-1231 209438 Nov. 7, 1997 DNA40592-1242 209492 Nov. 21,
1997 DNA40620-1183 209388 Oct. 17, 1997 DNA40628-1216 209432 Nov.
7, 1997 DNA40981-1234 209439 Nov. 7, 1997 DNA40982-1235 209433 Nov.
7, 1997 DNA41234-1242 209618 Feb. 5, 1998 DNA43046-1225 209484 Nov.
21, 1997 DNA43316-1237 209487 Nov. 21, 1997 DNA44167-1243 209434
Nov. 7, 1997 DNA44184-1319 209704 Mar. 26, 1998 DNA44194-1317
209808 Apr. 28, 1998 DNA44196-1353 209847 May 6, 1998 DNA45419-1252
209616 Feb. 5, 1998 DNA46777-1253 209619 Feb. 5, 1998 DNA47394-1572
203109 Aug. 11, 1998 DNA48331-1329 209715 Mar. 31, 1998
DNA48336-1309 209669 Mar. 11, 1998 DNA49142-1430 203002 Jun. 23,
1998 DNA49646-1327 209705 Mar. 26, 1998 DNA49821-1562 209981 Jun.
16, 1998 DNA49829-1346 209749 Apr. 7, 1998 DNA50921-1458 209859 May
12, 1998 DNA52187-1354 209845 May 6, 1998 DNA52196-1348 209748 Apr.
7, 1998 DNA52598-1518 203107 Aug. 11, 1998 DNA54228-1366 209801
Apr. 23, 1998 DNA56047-1456 209948 Jun. 9, 1998 DNA56112-1379
209883 May 20, 1998 DNA56113-1378 203049 Jul. 1, 1998 DNA56352-1358
209846 May 6, 1998 DNA56433-1406 209857 May 12, 1998 DNA56439-1376
209864 May 14, 1998 DNA57530-1375 209880 May 20, 1998 DNA57689-1385
209869 May 14, 1998 DNA57690-1374 209950 Jun. 9, 1998 DNA57693-1424
203008 Jun. 23, 1998 DNA57838-1337 203014 Jun. 23, 1998
DNA58721-1475 203110 Aug. 11, 1998 DNA59205-1421 203009 Jun. 23,
1998 DNA59215-1425 209961 Jun. 9, 1998 DNA59220-1514 209962 Jun. 9,
1998 DNA59294-1381 209866 May 14, 1998 DNA59488-1603 203157 Aug.
25, 1998 DNA59588-1571 203106 Aug. 11, 1998 DNA59606-1471 209945
Jun. 9, 1998 DNA59620-1463 209989 Jun. 16, 1998 DNA59767-1489
203108 Aug. 11, 1998 DNA59777-1480 203111 Aug. 11, 1998
DNA59814-1486 203359 Oct. 20, 1998 DNA59839-1461 209988 Jun. 16,
1998 DNA59846-1503 209978 Jun. 16, 1998 DNA59847-1511 203098 Aug.
4, 1998 DNA60615-1483 209980 Jun. 16, 1998 DNA60621-1516 203091
Aug. 4, 1998 DNA60622-1525 203090 Aug. 4, 1998 DNA60627-1508 203092
Aug. 4, 1998 DNA60764-1533 203452 Nov. 10, 1998 DNA60775-1532
203173 Sept. 1, 1998 DNA61185-1646 203464 Nov. 17, 1998
DNA61873-1574 203132 Aug. 18, 1998 DNA62306-1570 203254 Sept. 9,
1998 DNA62808-1582 203358 Oct. 20, 1998 DNA62814-1521 203093 Aug.
4, 1998 DNA64885-1529 203457 Nov. 3, 1998 DNA64886-1601 203241
Sept. 9, 1998 DNA64888-1542 203249 Sept. 9, 1998 DNA64889-1541
203250 Sept. 9, 1998 DNA64890-1612 203131 Aug. 18, 1998
DNA64903-1553 203223 Sept. 15, 1998 DNA64905-1558 203233 Sept. 15,
1998 DNA65402-1540 203252 Sept. 9, 1998 DNA65405-1547 203476 Nov.
17, 1998 DNA65412-1523 203094 Aug. 4, 1998 DNA66309-1538 203235
Sept. 15, 1998 DNA66667-1596 203267 Sept. 22, 1998 DNA66675-1587
203282 Sept. 22, 1998 DNA68818-2536 203657 Feb. 9, 1999
DNA68864-1629 203276 Sept. 22, 1998 DNA68872-1620 203160 Aug. 25,
1998 DNA71159-1617 203135 Aug. 18, 1998 DNA73727-1673 203459 Nov.
3, 1998 DNA73739-1645 203270 Sept. 22, 1998 DNA76400-2528 203573
Jan. 12, 1999 DNA76510-2504 203477 Nov. 17, 1998 DNA76529-1666
203315 Oct. 6, 1998 DNA76538-1670 203313 Oct. 6, 1998 DNA77301-1708
203407 Oct. 27, 1998 DNA77624-2515 203553 Dec. 22, 1998
DNA79230-2525 203549 Dec. 22, 1998 DNA79862-2522 203550 Dec. 22,
1998 DNA80145-2594 PTA-204 Jun. 8, 1999 DNA83500-2506 203391 Oct.
29, 1998 DNA84917-2597 203863 Mar. 23, 1999 DNA92218-2554 203834
Mar. 9, 1999 DNA96042-2682 PTA-382 Jul. 20, 1999
[0829] These deposits were made under the provisions of the
Budapest Treaty on the International Recognition of the Deposit of
Microorganisms for the Purpose of Patent Procedure and the
Regulations thereunder (Budapest Treaty). This assures maintenance
of a viable culture of the deposit for 30 years from the date of
deposit. The deposits will be made available by ATCC under the
terms of the Budapest Treaty, and subject to an agreement between
Genentech, Inc. and ATCC, which assures permanent and unrestricted
availability of the progeny of the culture of the deposit to the
public upon issuance of the pertinent U.S. patent or upon laying
open to the public of any U.S. or foreign patent application,
whichever comes first, and assures availability of the progeny to
one determined by the U.S. Commissioner of Patents and Trademarks
to be entitled thereto according to 35 USC .sctn. 122 and the
Commissioner's rules pursuant thereto (including 37 CFR .sctn. 1.14
with particular reference to 886 OG 638).
[0830] The assignee of the present application has agreed that if a
culture of the materials on deposit should die or be lost or
destroyed when cultivated under suitable conditions, the materials
will be promptly replaced on notification with another of the same.
Availability of the deposited material is not to be construed as a
license to practice the invention in contravention of the rights
granted under the authority of any government in accordance with
its patent laws.
Example 5
[0831] Use of PRO as a hybridization probe
[0832] The following method describes use of a nucleotide sequence
encoding PRO as a hybridization probe.
[0833] DNA comprising the coding sequence of full-length or mature
PRO as disclosed herein is employed as a probe to screen for
homologous DNAs (such as those encoding naturally-occurring
variants of PRO) in human tissue cDNA libraries or human tissue
genomic libraries.
[0834] Hybridization and washing of filters containing either
library DNAs is performed under the following high stringency
conditions. Hybridization of radiolabeled PRO-derived probe to the
filters is performed in a solution of 50% formamide, 5.times.SSC,
0.1% SDS, 0.1% sodium pyrophosphate, 50 mM sodiumphosphate, pH 6.8,
2.times.Denhardt's solution, and 10% dextran sulfate at 42.degree.
C. for 20 hours. Washing of the filters is performed in an aqueous
solution of O. lx SSC and 0.1% SDS at 42.degree. C.
[0835] DNAs having a desired sequence identity with the DNA
encoding full-length native sequence PRO can then be identified
using standard techniques known in the art.
Example 6
[0836] Expression of PRO in E. coli
[0837] This example illustrates preparation of an unglycosylated
form of PRO by recombinant expression in E. coli.
[0838] The DNA sequence encoding PRO is initially amplified using
selected PCR primers. The primers should contain restriction enzyme
sites which correspond to the restriction enzyme sites on the
selected expression vector. A variety of expression vectors may be
employed. An example of a suitable vector is pBR322 (derived from
E. coli; see Bolivar et al., Gene, 2:95 (1977)) which contains
genes for ampicillin and tetracycline resistance. The vector is
digested with restriction enzyme and dephosphorylated. The PCR
amplified sequences are then ligated into the vector. The vector
will preferably include sequences which encode for an antibiotic
resistance gene, a trp promoter, a polyhis leader (including the
first six STh codons, polyhis sequence, and enterokinase cleavage
site), the PRO coding region, lambda transcriptional terminator,
and an argU gene.
[0839] The ligation mixture is then used to transform a selected E.
coli strain using the methods described in Sambrook et al., supra.
Transformants are identified by their ability to grow on LB plates
and antibiotic resistant colonies are then selected. Plasmid DNA
can be isolated and confirmed by restriction analysis and DNA
sequencing.
[0840] Selected clones can be grown overnight in liquid culture
medium such as LB broth supplemented with antibiotics. The
overnight culture may subsequently be used to inoculate a larger
scale culture. The cells are then grown to a desired optical
density, during which the expression promoter is turned on.
[0841] After culturing the cells for several more hours, the cells
can be harvested by centrifugation. The cell pellet obtained by the
centrifugation can be solubilized using various agents known in the
art, and the solubilized PRO protein can then be purified using a
metal chelating column under conditions that allow tight binding of
the protein.
[0842] PRO may be expressed in E. coli in a poly-His tagged form,
using the following procedure. The DNA encoding PRO is initially
amplified using selected PCR primers. The primers will contain
restriction enzyme sites which correspond to the restriction enzyme
sites on the selected expression vector, and other useful sequences
providing for efficient and reliable translation initiation, rapid
purification on a metal chelation column, and proteolytic removal
with enterokinase. The PCR-amplified, poly-His tagged sequences are
then ligated into an expression vector, which is used to transform
an E. coli host based on strain 52 (W3 110 fuhA(tonA) lon galE
rpoHts(htpRts) clpP(laclq). Transformants are first grown in LB
containing 50 mg/ml carbenicillin at 30.degree. C. with shaking
until an O.D.600 of 3-5 is reached. Cultures are then diluted
50-100 fold into CRAP media (prepared by mixing 3.57 g
(NH.sub.4).sub.2SO.sub.4, 0.71 g sodium citrate .cndot.2H20, 1.07 g
KCl, 5.36 g Difco yeast extract, 5.36 g Sheffield hycase SF in 500
mL water, as well as 110 mM MPOS, pH 7.3, 0.55% (w/v) glucose and 7
mM MgSO.sub.4) and grown for approximately 20-30 hours at
30.degree. C. with shaking. Samples are removed to verify
expression by SDS-PAGE analysis, and the bulk culture is
centrifuged to pellet the cells. Cell pellets are frozen until
purification and refolding.
[0843] E. coli paste from 0.5 to 1 L fermentations (6-10 g pellets)
is resuspended in 10 volumes (w/v) in 7 M guanidine, 20 mM Tris, pH
8 buffer. Solid sodium sulfite and sodium tetrathionate is added to
make final concentrations of 0.1M and 0.02 M, respectively, and the
solution is stirred overnight at 4.degree. C. This step results in
a denatured protein with all cysteine residues blocked by
sulfitolization. The solution is centrifuged at 40,000 rpm in a
Beckman Ultracentifuge for 30 min. The supernatant is diluted with
3-5 volumes of metal chelate column buffer (6 M guanidine, 20 mM
Tris, pH 7.4) and filtered through 0.22 micron filters to clarify.
The clarified extract is loaded onito a 5 ml Qiagen Ni-NTA metal
chelate column equilibrated in the metal chelate column buffer. The
column is washed with additional buffer containing 50 mM imidazole
(Calbiochem, Utrol grade), pH 7.4. The protein is eluted with
buffer containing 250 mM imidazole. Fractions containing the
desired protein are pooled and stored at 4.degree. C. Protein
concentration is estimated by its absorbance at 280 nm using the
calculated extinction coefficient based on its amino acid
sequence.
[0844] The proteins are refolded by diluting the sample slowly into
freshly prepared refolding buffer consisting of: 20 mM Tris, pH
8.6, 0.3 M NaCl, 2.5 M urea, 5 mM cysteine, 20 mM glycine and 1 mM
EDTA. Refolding volumes are chosen so that the final protein
concentration is between 50 to 100 micrograms/ml. The refolding
solution is stirred gently at 4.degree. C. for 12-36 hours. The
refolding reaction is quenched by the addition of TFA to a final
concentration of 0.4% (pH of approximately 3). Before further
purification of the protein, the solution is filtered through a
0.22 micron filter and acetonitrile is added to 2-10% final
concentration. The refolded protein is chromatographed on a Poros
Ri/H reversed phase column using a mobile buffer of 0.1% TFA with
elution with a gradient of acetonitrile from 10 to 80%. Aliquots of
fractions with A280 absorbance are analyzed on SDS polyacrylamide
gels and fractions containing homogeneous refolded protein are
pooled. Generally, the properly refolded species of most proteins
are eluted at the lowest concentrations of acetonitrile since those
species are the most compact with their hydrophobic interiors
shielded from interaction with the reversed phase resin. Aggregated
species are usually eluted at higher acetonitrile concentrations.
In addition to resolving misfolded forms of proteins from the
desired formn, the reversed phase step also removes endotoxin from
the samples.
[0845] Fractions containing the desired folded PRO polypeptide are
pooled and the acetonitrile removed using a gentle stream of
nitrogen directed at the solution. Proteins are formulated into 20
mM Hepes, pH 6.8 with 0.14 M sodium chloride and 4% mannitol by
dialysis or by gel filtration using G25 Superfine (Pharmacia)
resins equilibrated in the formulation buffer and sterile
filtered.
[0846] Many of the PRO polypeptides disclosed herein were
successfully expressed as described above.
Example 7
[0847] Expression of PRO in Mammalian Cells
[0848] This example illustrates preparation of a potentially
glycosylated form of PRO by recombinant expression in mammalian
cells.
[0849] The vector, pRK5 (see EP 307,247, published March 15, 1989),
is employed as the expression vector. Optionally, the PRO DNA is
ligated into pRK5 with selected restriction enzymes to allow
insertion of the PRO DNA using ligation methods such as described
in Sambrook et al., supra. The resulting vector is called
pRK5-PRO.
[0850] In one embodiment, the selected host cells may be 293 cells.
Human 293 cells (ATCC CCL 1573) are grown to confluence in tissue
culture plates in medium such as DMEM supplemented with fetal calf
serum and optionally, nutrient components and/or antibiotics. About
10 Ig pRK5-PRO DNA is mixed with about 1 .mu.g DNA encoding the VA
RNA gene [Thimmappaya et al., Cell, 31:543 (1982)] and dissolved in
500 .mu.l of 1 mnM Tris--HCl, 0.1 mM EDTA, 0.227 M CaCl.sub.2. To
this mixture is added, dropwise, 500 .mu.l of 50 mM HEPES (pH
7.35), 280 mM NaCl, 1.5 mM NAPO.sub.4, and a precipitate is allowed
to form for 10 minutes at 25.degree. C. The precipitate is
suspended and added to the 293 cells and allowed to settle for
about four hours at 37.degree. C. The culture medium is aspirated
off and 2 ml of 20% glycerol in PBS is added for 30 seconds. The
293 cells are then washed with serum free medium, fresh medium is
added and the cells are incubated for about 5 days.
[0851] Approximately 24 hours after the transfections, the culture
medium is removed and replaced with culture medium (alone) or
culture medium containing 200 .mu.Ci/mn .sup.35S-cysteine and 200
.mu.Ci/ml .sup.35S-methionine. After a 12 hour incubation, the
conditioned medium is collected, concentrated on a spin filter, and
loaded onto a 15% SDS gel. The processed gel may be dried and
exposed to film for a selected period of time to reveal the
presence of PRO polypeptide. The cultures containing transfected
cells may undergo further incubation (in serum free medium) and the
medium is tested in selected bioassays.
[0852] In an alternative technique, PRO may be introduced into 293
cells transiently using the dextran sulfate method described by
Somparyrac et al., Proc. Natl. Acad. Sci., 12:7575 (1981). 293
cells are grown to maximal density in a spinner flask and 700 ug
pRK5-PRO DNA is added. The cells are first concentrated from the
spinner flask by centrifugation and washed with PBS. The
DNA-dextran precipitate is incubated on the cell pellet for four
hours. The cells are treated with 20% glycerol for 90 seconds,
washed with tissue culture medium, and re-introduced into the
spinner flask containing tissue culture medium, 5 .mu.g/ml bovine
insulin and 0.1 .mu.g/ml bovine transferrin. After about four days,
the conditioned media is centrifuged and filtered to remove cells
and debris. The sample containing expressed PRO can then be
concentrated and purified by any selected method, such as dialysis
and/or column chromatography.
[0853] In another embodiment, PRO can be expressed in CHO cells.
The pRK5-PRO can be transfected into CHO cells using known reagents
such as CaPO.sub.4 or DEAE-dextran. As described above, the cell
cultures can be incubated, and the medium replaced with culture
medium (alone) or medium containing a radiolabel such as
.sup.35S-methionine. After determining the presence of PRO
polypeptide, the culture medium may be replaced with serum free
medium. Preferably, the cultures are incubated for about 6 days,
and then the conditioned medium is harvested. The medium containing
the expressed PRO can then be concentrated and purified by any
selected method.
[0854] Epitope-tagged PRO may also be expressed in host CHO cells.
The PRO may be subcloned out of the pRK5 vector. The subclone
insert can undergo PCR to fuse in frame with a selected epitope tag
such as a poly-his tag into a Baculovirus expression vector. The
poly-his tagged PRO insert can then be subcloned into a SV40 driven
vector containing a selection marker such as DHFR for selection of
stable clones. Finally, the CHO cells can be transfected (as
described above) with the SV40 driven vector. Labeling may be
performed, as described above, to verify expression. The culture
medium containing the expressed poly-His tagged PRO can then be
concentrated and purified by any selected method, such as by
Ni.sup.2+-chelate affinity chromatography.
[0855] PRO may also be expressed in CHO and/or COS cells by a
transient expression procedure or in CHO cells by another stable
expression procedure.
[0856] Stable expression in CHO cells is performed using the
following procedure. The proteins are expressed as an IgG construct
(immunoadhesin), in which the coding sequences for the soluble
forms (e.g. extracellular domains) of the respective proteins are
fused to an IgGI constant region sequence containing the hinge, CH2
and CH2 domains and/or is a poly-His tagged form.
[0857] Following PCR amplification, the respective DNAs are
subcloned in a CHO expression vector using standard techniques as
described in Ausubel et al., Current Protocols of Molecular
Biology, Unit 3.16, John Wiley and Sons (1997). CHO expression
vectors are constructed to have compatible restriction sites 5' and
3' of the DNA of interest to allow the convenient shuttling of
cDNA's. The vector used expression in CHO cells is as described in
Lucas et al., Nucl. Acids Res. 24:9 (1774-1779 (1996), and uses the
SV40 early promoter/enhancer to drive expression of the cDNA of
interest and dihydrofolate reductase (DHFR). DHFR expression
permits selection for stable maintenance of the plasmid following
transfection.
[0858] Twelve micrograms of the desired plasmid DNA is introduced
into approximately 10 million CHO cells using commercially
available transfection reagents Superfect.RTM. (Quiagen),
Dosper.RTM. or Fugene.RTM. (Boehringer Mannheim). The cells are
grown as described in Lucas et al., supra Approximately
3.times.10.sup.-7 cells are frozen in an ampule for further growth
and production as described below.
[0859] The ampules containing the plasmid DNA are thawed by
placement into water bath and mixed by vortexing. The contents are
pipetted into a centrifuge tube containing 10 niLs of media and
centrifuged at 1000 rpm for 5 minutes. The supernatant is aspirated
and the cells are resuspended in 10 mL of selective media (0.2
.mu.m filtered PS20 with 5% 0.2 .mu.m diafiltered fetal bovine
serum). The cells are then aliquoted into a 100 mL spinner
containing 90 mL of selective media. After 1-2 days, the cells are
transferred into a 250 mL spinner filled with 150 mL selective
growth medium and incubated at 37.degree. C. After another 2-3
days, 250 mL, 500 mL and 2000 mL spinners are seeded with
3.times.10.sup.5 cells/mL. The cell media is exchanged with fresh
media by centrifugation and resuspension in production medium.
Although any suitable CHO media may be employed, a production
medium described in U.S. Pat. No. 5,122,469, issued June 16, 1992
may actually be used. A 3L production spinner is seeded at
1.2.times.10.sup.6 cells/mL. On day 0, the cell number pH ie
determined. On day 1, the spinner is sampled and sparging with
filtered air is commenced. On day 2, the spinner is sampled, the
temperature shifted to 33.degree. C., and 30 mL of 500 .mu.g/L
glucose and 0.6 mL of 10% antifoam (e.g., 35% polydimethylsiloxane
emulsion, Dow Corning 365 Medical Grade Emulsion) taken. Throughout
the production, the pH is adjusted as necessary to keep it at
around 7.2. After 10 days, or until the viability dropped below
70%, the cell culture is harvested by centrifugation and filtering
through a 0.22 .mu.m filter. The filtrate was either stored at
4.degree. C. or immediately loaded onto columns for
purification.
[0860] For the poly-His tagged constructs, the proteins are
purified using a Ni-NTA column (Qiagen). Before purification,
imidazole is added to the conditioned media to a concentration of 5
mM. The conditioned media is pumped onto a 6 ml Ni-NTA column
equilibrated in 20 mM Hepes, pH 7.4, buffer containing 0.3 M NaCl
and 5 mM imidazole at a flow rate of 4-5 ml/min. at 4.degree. C.
After loading, the column is washed with additional equilibration
buffer and the protein eluted with equilibration buffer containing
0.25 M imidazole. The highly purified protein is subsequently
desalted into a storage buffer containing 10 mM Hepes, 0.14 M NaCl
and 4% mannitol, pH 6.8, with a 25 ml G25 Superfine (Pharmacia)
column and stored at -80.degree. C.
[0861] Immunoadhesin (Fc-containing) constructs are purified from
the conditioned media as follows. The conditioned medium is pumped
onto a 5 ml Protein A column (Pharmacia) which had been
equilibrated in 20 mM Na phosphate buffer, pH 6.8. After loading,
the column is washed extensively with equilibration buffer before
elution with 100 mM citric acid, pH 3.5. The eluted protein is
immediately neutralized by collecting 1 ml fractions into tubes
containing 275 .mu.L of 1 M Tris buffer, pH 9. The highly purified
protein is subsequently desalted into storage buffer as described
above for the poly-His tagged proteins. The homogeneity is assessed
by SDS polyacrylamide gels and by N-terminal amino acid sequencing
by Edman degradation.
[0862] Many of the PRO polypeptides disclosed herein were
successfully expressed as described above.
Example 8
[0863] Expression of PRO in Yeast
[0864] The following method describes recombinant expression of PRO
in yeast.
[0865] First, yeast expression vectors are constructed for
intracellular production or secretion of PRO from the ADH2/GAPDH
promoter. DNA encoding PRO and the promoter is inserted into
suitable restriction enzyme sites in the selected plasmid to direct
intracellular expression of PRO. For secretion, DNA encoding PRO
can be cloned into the selected plasmid, together with DNA encoding
the ADH2/GAPDH promoter, a native PRO signal peptide or other
mammalian signal peptide, or, for example, a yeast alpha-factor or
invertase secretory signal/leader sequence, and linker sequences
(if needed) for expression of PRO.
[0866] Yeast cells, such as yeast strain AB 110, can then be
transformed with the expression plasmids described above and
cultured in selected fermentation media. The transformed yeast
supernatants can be analyzed by precipitation with 10%
trichloroacetic acid and separation by SDS-PAGE, followed by
staining of the gels with Coomassie Blue stain.
[0867] Recombinant PRO can subsequently be isolated and purified by
removing the yeast cells from the fermentation medium by
centrifugation and then concentrating the medium using selected
cartridge filters. The concentrate containing PRO may further be
purified using selected column chromatography resins.
[0868] Many of the PRO polypeptides disclosed herein were
successfully expressed as described above.
Example 9
[0869] Expression of PRO in Baculovirus-Infected Insect Cells
[0870] The following method describes recombinant expression of PRO
in Baculovirus-infected insect cells.
[0871] The sequence coding for PRO is fused upstream of an epitope
tag contained within a baculovirus expression vector. Such epitope
tags include poly-his tags and immunoglobulin tags (like Fc regions
of IgG). A variety of plasmids may be employed, including plasmids
derived from commercially available plasmids such as pVL1393
(Novagen). Briefly, the sequence encoding PRO or the desired
portion of the coding sequence of PRO such as the sequence encoding
the extracellular domain of a transmembrane protein or the sequence
encoding the mature protein if the protein is extracellular is
amplified by PCR with primers complementary to the 5' and 3'
regions. The 5' primer may incorporate flanking (selected)
restriction enzyme sites. The product is then digested with those
selected restriction enzymes and subcloned into the expression
vector.
[0872] Recombinant baculovirus is generated by co-transfecting the
above plasmid and BaculoGold.TM. virus DNA (Pharmingen) into
Spodoptera frugiperda ("Sf9") cells (ATCC CRL 1711) using
lipofectin (commercially available from GIBCO-BRL). After 4-5 days
of incubation at 28.degree. C., the released viruses are harvested
and used for further amplifications. Viral infection and protein
expression are performed as described by O'Reilley et al.,
Baculovirus expression vectors: A Laboratory Manual, Oxford: Oxford
University Press (1994).
[0873] Expressed poly-his tagged PRO can then be purified, for
example, by Ni.sup.2+-chelate affinity chromatography as follows.
Extracts are prepared from recombinant virus-infected Sf9 cells as
described by Rupert et al., Nature, 362:175-179 (1993). Briefly,
Sf9 cells are washed, resuspended in sonication buffer (25 mL
Hepes, pH 7.9; 12.5 mM MgCl.sub.2; 0.1 mM EDTA; 10% glycerol; 0.1%
NP40; 0.4 M KCl), and sonicated twice for 20 seconds on ice. The
sonicates are cleared by centrifugation, and the supernatant is
diluted 50-fold in loading buffer (50 mM phosphate, 300 mM NaCl,
10% glycerol, pH 7.8) and filtered through a 0.45 .mu.m filter. A
Ni.sup.2+-NTA agarose column (comrnercially available from Qiagen)
is prepared with a bed volume of 5 mL, washed with 25 rnL of water
and equilibrated with 25 mL of loading buffer. The filtered cell
extract is loaded onto the column at 0.5 mL per minute. The column
is washed to baseline A.sub.280 with loading buffer, at which point
fraction collection is started. Next, the column is washed with a
secondary wash buffer (50 mM phosphate; 300 mM NaCl, 10% glycerol,
pH 6.0), which elutes nonspecifically bound protein. After reaching
A.sub.280 baseline again, the column is developed with a 0 to 500
mM Irnidazole gradient in the secondary wash buffer. One mL
fractions are collected and analyzed by SDS-PAGE and silver
staining or Western blot with Ni.sup.2+-NTA-conjugated to alkaline
phosphatase (Qiagen). Fractions containing the eluted
His.sub.10-tagged PRO are pooled and dialyzed against loading
buffer.
[0874] Alternatively, purification of the IgG tagged (or Fc tagged)
PRO can be performed using known chromatography techniques,
including for instance, Protein A or protein G column
chromatography.
[0875] Many of the PRO polypeptides disclosed herein were
successfully expressed as described above.
Example 10
[0876] Preptaration of Antibodies that Bind PRO
[0877] This example illustrates preparation of monoclonal
antibodies which can specifically bind PRO.
[0878] Techniques for producing the monoclonal antibodies are known
in the art and are described, for instance, in Goding, supra.
Immunogens that may be employed include purified PRO, fusion
proteins containing PRO, and cells expressing recombinant PRO on
the cell surface. Selection of the immunogen can be made by the
skilled artisan without undue experimentation.
[0879] Mice, such as Balb/c, are immunized with the PRO immunogen
emulsified in complete Freund's adjuvant and injected
subcutaneously or intraperitoneally in an amount from 1-100
micrograms. Alternatively, the immunogen is emulsified in MPL-TDM
adjuvant (Ribi Immunochemical Research, Hamilton, Mont.) and
injected into the animal's hind foot pads. The immunized mice are
then boosted 10 to 12 days later with additional immunogen
emulsified in the selected adjuvant. Thereafter, for several weeks,
the mice may also be boosted with additional immunization
injections. Serum samples may be periodically obtained from the
mice by retro-orbital bleeding for testing in ELISA assays to
detect anti-PRO antibodies.
[0880] After a suitable antibody titer has been detected, the
animals "positive" for antibodies canbe injected with a final
intravenous injection of PRO. Three to four days later, the mice
are sacrificed and the spleen cells are harvested. The spleen cells
are then fused (using 35% polyethylene glycol) to a selected murine
myeloma cell line such as P3X63AgU.1, available from ATCC, No. CRL
1597. The fusions generate hybridoma cells which can then be plated
in 96 well tissue culture plates containing HAT (hypoxanthine,
aminopterin, and thymidine) medium to inhibit proliferation of
non-fused cells, myeloma hybrids, and spleen cell hybrids.
[0881] The hybridoma cells will be screened in an ELISA for
reactivity against PRO. Determination of "positive" hybridoma cells
secreting the desired monoclonal antibodies against PRO is within
the skill in the art.
[0882] The positive hybridoma cells can be injected
intraperitoneally into syngeneic Balb/c mice to produce ascites
containing the anti-PRO monoclonal antibodies. Alternatively, the
hybridoma cells can be grown in tissue culture flasks or roller
bottles. Purification of the monoclonal antibodies produced in the
ascites can be accomplished using ammonium sulfate precipitation,
followed by gel exclusion chromatography. Alternatively, affinity
chromatography based upon binding of antibody to protein A or
protein G can be employed.
Example 11
[0883] Purification of PRO Polypeptides Using Specific
Antibodies
[0884] Native or recombinant PRO polypeptides may be purified by a
variety of standard techniques in the art of protein purification.
For example, pro-PRO polypeptide, mature PRO polypeptide, or
pre-PRO polypeptide is purified by immunoaffinity chromatography
using antibodies specific for the PRO polypeptide of interest. In
general, an immunoaffinity column is constructed by covalently
coupling the anti-PRO polypeptide antibody to an activated
chromatographic resin.
[0885] Polyclonal immunoglobulins are prepared from immune sera
either by precipitation with ammonium sulfate or by purification on
immobilizedProtein A (Pharmacial.KB Biotechnology, Piscataway,
N.J.). Likewise, monoclonal antibodies are prepared from mouse
ascites fluid by ammonium sulfate precipitation or chromatography
on immobilized Protein A. Partially purified immunoglobulin is
covalently attached to a chromatographic resin such as
CnBr-acfivated SEPHAROSE.TM. (Pharmacia LKB Biotechnology). The
antibody is coupled to the resin, the resin is blocked, and the
derivative resin is washed according to the manufacturer's
instructions.
[0886] Such an immunoaffinity column is utilized in the
purification of PRO polypeptide by preparing a fraction from cells
containing PRO polypeptide in a soluble form. This preparation is
derived by solubilization of the whole cell or of a subcellular
fraction obtained via differential centrifugation by the addition
of detergent or by other methods well known in the art.
Alternatively, soluble PRO polypeptide containing a signal sequence
may be secreted in useful quantity into the medium in which the
cells are grown.
[0887] A soluble PRO polypeptide-containing preparation is passed
over the immunoaffinity column, and the column is washed under
conditions that allow the preferential absorbance of PRO
polypeptide (e.g., high ionic strength buffers in the presence of
detergent). Then, the column is eluted under conditions that
disrupt antibody/PRO polypeptide binding (e.g., a low pH buffer
such as approximately pH 2-3, or a high concentration of a
chaotrope such as urea or thiocyanate ion), and PRO polypeptide is
collected.
Example 12
[0888] Drug Screening
[0889] This invention is particularly useful for screening
compounds by using PRO polypeptides or binding fragment thereof in
any of a variety of drug screening techniques. The PRO polypeptide
or fragment employed in such a test may either be free in solution,
affixed to a solid support, borne on a cell surface, or located
intracellularly. One method of drug screening utilizes eukaryotic
or prokaryotic host cells which are stably transformed with
recombinant nucleic acids expressing the PRO polypeptide or
fragment. Drugs are screened against such transformed cells in
competitive binding assays. Such cells, either in viable or fixed
form, can be used for standard binding assays. One may measure, for
example, the formation of complexes between PRO polypeptide or a
fragment and the agent being tested. Alternatively, one can examine
the diminution in complex formation between the PRO polypeptide and
its target cell or target receptors caused by the agent being
tested.
[0890] Thus, the present invention provides methods of screening
for drugs or any other agents which can affect a PRO
polypeptide-associated disease or disorder. These methods comprise
contacting such an agent with an PRO polypeptide or fragment
thereof and assaying (1) for the presence of a complex between the
agent and the PRO polypeptide or fragment, or (ii) for the presence
of a complex between the PRO polypeptide or fragment and the cell,
by methods well known in the art. In such competitive binding
assays, the PRO polypeptide or fragment is typically labeled. After
suitable incubation, free PRO polypeptide or fragment is separated
from that present in bound form, and the amount of free or
uncomplexed label is a measure of the ability of the particular
agent to bind to PRO polypeptide or to interfere with the PRO
polypeptide/cell complex.
[0891] Another technique for drug screening provides high
throughput screening for compounds having suitable binding affinity
to a polypeptide and is described in detail in WO 84/03564,
published on Sep. 13, 1984. Briefly stated, large numbers of
different small peptide test compounds are synthesized on a solid
substrate, such as plastic pins or some other surface. As applied
to a PRO polypeptide, the peptide test compounds are reacted with
PRO polypeptide and washed. Bound PRO polypeptide is detected by
methods well known in the art. Purified PRO polypeptide can also be
coated directly onto plates for use in the aforementioned drug
screening techniques. In addition, non-neutralizing antibodies can
be used to capture the peptide and immobilize it on the solid
support.
[0892] This invention also contemplates the use of competitive drug
screening assays in which neutralizing antibodies capable of
binding PRO polypeptide specifically compete with a test compound
for binding to PRO polypeptide or fragments thereof. In this
manner, the antibodies can be used to detect the presence of any
peptide which shares one or more antigenic determinants with PRO
polypeptide.
Example 13
[0893] Rational Drug Design
[0894] The goal of rational drug design is to produce structural
analogs of biologically active polypeptide of interest (i.e., a PRO
polypeptide) or of small molecules with which they interact, e.g.,
agonists, antagonists, or inhibitors. Any of these examples can be
used to fashion drugs which are more active or stable forms of the
PRO polypeptide or which enhance or interfere with the function of
the PRO polypeptide in vivo (c.f., Hodgson, Bio/Technology, 9:
19-21 (1991)).
[0895] In one approach, the three-dimensional structure of the PRO
polypeptide, or of an PRO polypeptide-inhibitor complex, is
determined by x-ray crystallography, by computer modeling or, most
typically, by a combination of the two approaches. Both the shape
and charges of the PRO polypeptide must be ascertained to elucidate
the structure and to determine active site(s) of the molecule. Less
often, useful information regarding the structure of the PRO
polypeptide may be gained by modeling based on the structure of
homologous proteins. In both cases, relevant structural information
is used to design analogous PRO polypeptide-like molecules or to
identify efficient inhibitors. Useful examples of rational drug
design may include molecules which have improved activity or
stability as shown by Braxton and Wells, Biochemistry, 31:7796-7801
(1992) or which act as inhibitors, agonists, or antagonists of
native peptides as shown by Athauda et al., J. Biochem.,
113:742-746 (1993).
[0896] It is also possible to isolate a target-specific antibody,
selected by functional assay, as described above, and then to solve
its crystal structure. This approach, in principle, yields a
pharmacore upon which subsequent drug design can be based. It is
possible to bypass protein crystallography altogether by generating
anti-idiotypic antibodies (anti-ids) to a functional,
pharmacologically active antibody. As a mirror image of a mirror
image, the binding site of the anti-ids would be expected to be an
analog of the original receptor. The anti-id could then be used to
identify and isolate peptides from banks of chemically or
biologically produced peptides. The isolated peptides would then
act as the pharmacore.
[0897] By virtue of the present invention, sufficient amounts of
the PRO polypeptide may be made available to perform such
analytical studies as X-ray crystallography. In addition, knowledge
of the PRO polypeptide amino acid sequence provided herein will
provide guidance to those employing computer modeling techniques in
place of or in addition to x-ray crystallography.
Example 14
[0898] Identification of PRO Polypeptides That Stimulate
TNF-.alpha. Release In Human Blood (Assay 128)
[0899] This assay shows that certain PRO polypeptides of the
present invention act to stimulate the release of TNF-.alpha. in
human blood. PRO polypeptides testing positive in this assay are
useful for, among other things, research purposes where stimulation
of the release of TNF-.alpha. would be desired and for the
therapeutic treatment of conditions wherein enhanced TNF-.alpha.
release would be beneficial. Specifically, 200 .mu.l of human blood
supplemented with 50 mM Hepes buffer (pH 7.2) is aliquoted per well
in a 96 well test plate. To each well is then added 300 .mu.l of
either the test PRO polypeptide in 50 mM Hepes buffer (at various
concentrations) or 50 mM Hepes buffer alone (negative control) and
the plates are incubated at 37.degree. C. for 6 hours. The samples
are then centrifuged and 50 .mu.l of plasma is collected from each
well and tested for the presence of TNF-.alpha. by ELISA assay. A
positive in the assay is a higher amount of TNF-.alpha. in the PRO
polypeptide treated samples as compared to the negative control
samples.
[0900] The following PRO polypeptides tested positive in this
assay: PRO195, PRO202, PRO215, PRO221, PRO217, PRO222, PRO198,
PRO245, PRO172, PRO265, PRO266, PRO344, PRO337, PRO322, PRO1286,
PRO1279, PRO1338 and PRO1343.
Example 15
[0901] Detection of Polypeptides That Affect Glucose or FFA Uptake
in Skeletal Muscle (Assay 106)
[0902] This assay is designed to determine whether PRO polypeptides
show the ability to affect glucose or FFA uptake by skeletal muscle
cells. PRO polypeptides testing positive in this assay would be
expected to be useful for the therapeutic treatment of disorders
where either the stimulation or inhibition of glucose uptake by
skeletal muscle would be beneficial including, for example,
diabetes or hyper- or hypo-insulinemia.
[0903] In a 96 well format, PRO polypeptides to be assayed are
added to primary rat differentiated skeletal muscle, and allowed to
incubate overnight. Then fresh media with the PRO polypeptide and
+/- insulin are added to the wells. The sample media is then
monitored to determine glucose and FFA uptake by the skeletal
muscle cells. The insulin will stimulate glucose and FFA uptake by
the skeletal muscle, and insulin in media without the PRO
polypeptide is used as a positive control, and a limit for scoring.
As the PRO polypeptide being tested may either stimulate or inhibit
glucose and FFA uptake, results are scored as positive in the assay
if greater than 1.5 times or less than 0.5 times the insulin
control.
[0904] The following PRO polypeptides tested positive as being
capable of affecting glucose and/or FFA uptake by skeletal muscle
in this assay: PRO182, PRO366, PRO198, PRO172 and PRO719.
Example 16
[0905] Chondrocyte Re-differentiation Assay (Assay 110)
[0906] This assay shows that certain polypeptides of the invention
act to induce redifferentiation of chondrocytes, therefore, are
expected to be useful for the treatment of various bone and/or
cartilage disorders such as, for example, sports injuries and
arthritis. The assay is performed as follows. Porcine chondrocytes
are isolated by overnight collagenase digestion of articulary
cartilage of metacarpophalangealjoints of 4-6 month old female
pigs. The isolated cells are then seeded at 25,000 cells/cm.sup.2
in Ham F-12 containing 10% FBS and 4 .mu.g/ml gentamycin. The
culture media is changed every third day and the cells are then
seeded in 96 well plates at 5,000 cells/well in 100 .mu.l of the
same media without serum and 100 .mu.l of the test PRO polypeptide,
5 nM staurosporin (positive control) or medium alone (negative
control) is added to give a final volume of 200 .mu.l/well. After 5
days of incubation at 37.degree. C., a picture of each well is
taken and the differentiation state of the chondrocytes is
determined. A positive result in the assay occurs when the
redifferentiation of the chondrocytes is determined to be more
similar to the positive control than the negative control.
[0907] The following polypeptide tested positive in this assay:
PRO182, PRO366, PRO198 and PRO1868.
Example 17
[0908] Chondrocyte Proliferation Assay (Assay 111)
[0909] This assay is designed to determine whether PRO polypeptides
of the present invention show the ability to induce the
proliferation and/or redifferentiation of chondrocytes in culture.
PRO polypeptides testing positive in this assay would be expected
to be useful for the therapeutic treatment of various bone and/or
cartilage disorders such as, for example, sports injuries and
arthritis.
[0910] Porcine chondrocytes are isolated by overnight collagenase
digestion of articular cartilage of the metacarpophalangeal joint
of 4-6 month old female pigs. The isolated cells are then seeded at
25,000 cells/cm.sup.2 in Ham F-12 containing 10% FBS and 4 [Lg/mnl
gentamycin. The culture media is changed every third day and the
cells are reseeded to 25,000 cells/cm.sup.2 every five days. On day
12, the cells are seeded in 96 well plates at 5,000 cells/well in
100 .mu.l of the same media without serum and 100 .mu.l of either
serum-free medium (negative control), staurosporin (final
concentration of 5 nM; positive control) or the test PRO
polypeptide are added to give a final volume of 200 .mu.l/well.
After 5 days at 37.degree. C., 20 .mu.l of Alamar blue is added to
each well and the plates are incubated for an additional 3 hours at
37.degree. C. The fluorescence is then measured in each well
(Ex:530 nm; Em: 590 nm). The fluorescence of a plate containing 200
.mu.l of the serum-free medium is measured to obtain the
background. A positive result in the assay is obtained when the
fluorescence of the PRO polypeptide treated sample is more like
that of the positive control than the negative control.
[0911] The following PRO polypeptides tested positive in this
assay: PRO202, PRO224, PRO172 and PRO1312.
Example 18
[0912] Detection of PRO Polypeptides That Affect Glucose or FFA
Uptake by Primary Rat Adipocytes (Assay 94)
[0913] This assay is designed to determine whether PRO polypeptides
show the ability to affect glucose or FFA uptake by adipocyte
cells. PRO polypeptides testing positive in this assay would be
expected to be useful for the therapeutic treatrnent of disorders
where either the stimulation or inhibition of glucose uptake by
adipocytes would be beneficial including, for example, obesity,
diabetes or hyper- or hypo-insulinemia.
[0914] In a 96 well format, PRO polypeptides to be assayed are
added to primary rat adipocytes, and allowed to incubate overnight.
Samples are taken at 4 and 16 hours and assayed for glycerol,
glucose and FFA uptake. After the 16 hour incubation, insulin is
added to the media and allowed to incubate for 4 hours. At this
time, a sample is taken and glycerol, glucose and FFA uptake is
measured. Media containing insulin without the PRO polypeptide is
used as a positive reference control. As the PRO polypeptide being
tested may either stimulate or inhibit glucose and FFA uptake,
results are scored as positive in the assay if greater than 1.5
times or less than 0.5 times the insulin control.
[0915] The following PRO polypeptides tested positive as being
capable of affecting glucose and/or FFA uptake in this assay:
PRO202, PRO211, PRO344 and PRO1338.
Example 19
[0916] Gene Expression in Bovine Pericytes (Assay 105)
[0917] This assay is designed to identify PRO polypeptides which
activate gene expression in pericytes. Such polypeptides would be
expected to be useful as growth factors and/or for situations where
the activation of gene expression is desired or beneficial. Bovine
pericytes are plated on 60mm culture dishes in growth media forl
week. On day 1, various PRO polypeptides are diluted (1%) and
incubated with the pericytes for 1,4 and 24 hr. Iimepoints. The
cells are harvested and the RNA isolated using TRI-Reagent
following the included instructions. The RNA is then quantified by
reading the 260/280 OD using a spectrophotometer. The gene
expression analysis is done by TaqMan reactions using Perkin Elmer
reagents and specially designed bovine probes and primers.
Expression of the following genes is analyzed: GAPDH,
beta-integrin, connective tissue growth factor (CTGF), ICAM-1,
monocyte chemoattractant protein-1 (MCP-1), osteopontin,
transforming growth factor-beta (TGF-beta), TGF-beta receptor,
tissue inhibitor of metalloproteinase (TIMP), tissue factor (TF),
VEGF-.alpha., thrombospondin, VEGF-.beta., angiopoeitin-2, and
collagenase. Replicates are then averaged and the SD determined.
The gene expression levels are then normalized to GAPDH. These are
then normalized to the expression levels obtained with a protein
(PIN32) which does not significantly induce gene expression in
bovine pericytes when compared to untreated controls. Any PRO
polypeptide that gives a gene expression level 2-fold or higher
over the PIN32 control is considered a positive hit.
[0918] The following PRO polypeptides tested positive in this
assay: PRO366.
Example 20
[0919] Identification of PRO Polypeptides That Activate Pericytes
(Assay 125)
[0920] This assay shows that certain polypeptides of the invention
act to activate proliferation of pericyte cells and, therefore, are
useful not only as diagnostic markers for particular types of
pericyte-associated tumors but also for giving rise to antagonists
which would be expected to be useful for the therapeutic treatment
of pericyte-associated tumors. Such PRO polypeptides also would be
expected to be useful as growth factors and/or for situations where
the induction of cell proliferation is desired or beneficial.
Activation of pericyte proliferation also correlates with the
induction of angiogenesis and, as such, PRO polypeptides capable of
inducing pericyte proliferation would be expected to be useful for
the treatment of conditions where induced angiogenesis would be
beneficial including, for example, wound healing, and the like.
Specifically, on day 1, pericytes are received from VEC
Technologies, and all but 5 ml media is removed from the flask. On
day 2, the pericytes are trypsinized, washed, spun and plated on 96
well plates. On day 7, the media is removed and the pericytes are
treated with 100 .mu.l of either the specific PRO polypeptide or
control treatments (positive control=DME+5%+/- PDGF @ 500 ng/.mu.l;
negative control=PIN32, a polypeptide determined to have no
significant effect on pericyte proliferation). C-fos and GAPDH gene
expression levels are then determined and the replicates are
averaged and the SD is determined. The c-fos values are normalized
to GAPDH and the results are expressed as fold increase over PIN32.
Anything providing at least a 2-fold or higher response as compared
to the negative control is considered positive for the assay.
[0921] The following polypeptides tested positive in this assay:
PRO366.
Example 21
[0922] Ability of PRO Polyyeptides to Stimulate the Release of
Proteoglvcans from Cartilage (Assay 97)
[0923] The ability of various PRO polypeptides to stimulate the
release of proteoglycans from cartilage tissue was tested as
follows.
[0924] The metacarphophalangeal joint of 4-6 month old pigs was
aseptically dissected, and articular cartilage was removed by free
hand slicing being careful to avoid the underlying bone. The
cartilage was minced and cultured in bulk for 24 hours in a
humidified atmosphere of 95% air,5% CO.sub.2 in serum free (SF)
media (DME/F12 1:1) with 0.1% BSA and 100U/ml penicillin and 100
.mu.g/ml streptomycin. After washing three times, approximately 100
mg of articular cartilage was aliquoted into micronics tubes and
incubated for an additional 24 hours in the above SF media. PRO
polypeptides were then added at 1% either alone or in combination
with 18 ng/nlm interleukin-la, a known stimulator of proteoglycan
release from cartilage tissue. The supernatant was then harvested
and assayed for the amount of proteoglycans using the
1,9-dimethyl-methylene blue (DMB) colorimetric assay (Farndale and
Buttle, Biochem. Biophys. Acta 883:173-177 (1985)). A positive
result in this assay indicates that the test polypeptide will find
use, for example, in the treatment of sports-related joint
problems, articular cartilage defects, osteoarthritis or rheumatoid
arthritis.
[0925] When various PRO polypeptides were tested in the above
assay, the polypeptides demonstrated amarked ability to stimulate
release of proteoglycans from cartilage tissue both basally and
after stimulation with interleukin-la and at 24 and 72 hours after
treatment, thereby indicating that these PRO polypeptides are
useful for stimulating proteoglycan release from cartilage tissue.
As such, these PRO polypeptides are useful for the treatment of
sports-related joint problems, articular cartilage defects,
osteoarthritis or rheumatoid arthritis. The polypeptides testing
positive in this assay are: PRO216.
Example 22
[0926] Proliferation of Rat Utricular Supporting Cells (Assay
54)
[0927] This assay shows that certain polypeptides of the invention
act as potent mitogens for inner ear supporting cells which are
auditory hair cell progenitors and, therefore, are useful for
inducing the regeneration of auditory hair cells and treating
hearing loss in mammals. The assay is performed as follows. Rat
UEC-4 utricular epithelial cells are aliquoted into 96 well plates
with a density of 3000 cells/well in 200 .mu.l of serum-containing
medium at 33.degree. C. The cells are cultured overnight and are
then switched to serum-free medium at 37.degree. C. Various
dilutions of PRO polypeptides (or nothing for a control) are then
added to the cultures and the cells are incubated for 24 hours.
After the 24 hour incubation, .sup.3H-thymidine (1 .mu.Ci/well) is
added and the cells are then cultured for an additional 24 hours.
The cultures are then washed to remove unincorporated radiolabel,
the cells harvested and Cpm per well determined. Cpm of at least
30% or greater in the PRO polypeptide treated cultures as compared
to the control cultures is considered a positive in the assay.
[0928] The following polypeptides tested positive in this assay:
PRO172.
Example 23
[0929] Stimulatory Activity in Mixed Lymphocyte Reaction (MLR)
Assay (Assay 24)
[0930] This example shows that certain polypeptides of the
invention are active as a stimulator of the proliferation of
stimulated T-lymphocytes. Compounds which stimulate proliferation
of lymphocytes are useful therapeutically where enhancement of an
immune response is beneficial. A therapeutic agent may take the
form of antagonists of the polypeptide of the invention, for
example, murine-human chimeric, humanized or human antibodies
against the polypeptide.
[0931] The basic protocol for this assay is described in Current
Protocols in Immunology, unit 3.12; edited by J E Coligan, A M
Kruisbeek, D H Marglies, E M Shevach, W Strober, National
Institutes of Health, Published by John Wiley & Sons, Inc.
[0932] More specifically, in one assay variant, peripheral blood
mononuclear cells (PBMC) are isolated from mammalian individuals,
for example a human volunteer, by leukopheresis (one donor will
supply stimulator PBMCs, the other donor will supply responder
PBMCs). If desired, the cells are frozen in fetal bovine serum and
DMSO after isolation. Frozen cells may be thawed overnight in assay
media (37.degree. C., 5% CO.sub.2) and then washed and resuspended
to 3.times.10.sup.6 cells/mil of assay media (RPMI; 10% fetal
bovine serum, 1% penicillin/streptomycin, 1% glutamnine, 1% HEPES,
1% non-essential amino acids, 1% pyruvate). The stimulator PBMCs
are prepared by irradiating the cells (about 3000 Rads).
[0933] The assay is prepared by plating in triplicate wells a
mixture of:
[0934] 100:1 of test sample diluted to 1% or to 0.1%,
[0935] 50:1 of irradiated stimulator cells, and
[0936] 50:1 of responder PBMC cells.
[0937] 100 microliters of cell culture media or 100 microliter of
CD4-IgG is used as the control. The wells are then incubated at
37.degree. C., 5% CO.sub.2 for 4 days. On day 5, each well is
pulsed with tritiated thymidine (1.0 mC/well; Amersham). After 6
hours the cells are washed 3 times and then the uptake of the label
is evaluated.
[0938] In another variant of this assay, PBMCs are isolated from
the spleens of Balb/c mice and C57B6 mice. The cells are teased
from freshly harvested spleens in assay media (RPMI; 10% fetal
bovine serum, 1% penicillin/streptomycin, 1% glutamine, 1% HEPES,
1% non-essential amino acids, 1% pyruvate) and the PBMCs are
isolated by overlaying these cells over Lympholyte M (Organon
Teknika), centrifuging at 2000 rpm for 20 minutes, collecting and
washing the mononuclear cell layer inassay media and resuspending
the cells to 1.times.10.sup.7 cells/ml of assay media. The assay is
then conducted as described above.
[0939] Positive increases over control are considered positive with
increases of greater than or equal to 180% being preferred.
However, any value greater than control indicates a stimulatory
effect for the test protein.
[0940] The following PRO polypeptides tested positive in this
assay: PRO344.
Example 24
[0941] Pericyte c-Fos Induction (Assay 93)
[0942] This assay shows that certain polypeptides of the invention
act to induce the expression of c-fos in pericyte cells and,
therefore, are useful not only as diagnostic markers for particular
types of pericyte-associated tumors but also for giving rise to
antagonists which would be expected to be useful for the
therapeutic treatment of pericyte-associated tumors. Induction of
c-fos expression in pericytes is also indicative of the induction
of angiogenesis and, as such, PRO polypeptides capable of inducing
the expression of c-fos would be expected to be useful for the
treatment of conditions where induced angiogenesis would be
beneficial including, for example, wound healing, and the like.
Specifically, on day 1, pericytes are received from VEC
Technologies and all but 5 ml of media is removed from flask. On
day 2, the pericytes are trypsinized, washed, spun and then plated
onto 96 well plates. On day 7, the media is removed and the
pericytes are treated with 100 .mu.l of PRO polypeptide test
samples and controls (positive control=DME+5% serum +/-PDGF at 500
ng/ml; negative control=protein 32). Replicates are averaged and
SD/CV are determined. Fold increase over Protein 32 (buffer
control) value indicated by chemiluminescence units (RLU)
luminometer reading verses frequency is plotted on a histogram.
Two-fold above Protein 32 value is considered positive for the
assay. ASY Matrix: Growth media=low glucose DMEM=20% FBS +1X pen
strep +1X fungizone. Assay Media=low glucose DMEM +5% FBS.
[0943] The following polypeptides tested positive in this assay:
PRO301, PRO619, PRO1066 and PRO1265.
Example 25
[0944] Cytokine Release Assay (Assay 120)
[0945] This assay is designed to determine whether PRO polypeptides
of the present invention are capable of inducing the release of
cytokines from peripheral blood mononuclear cells (PBMCs). PRO
polypeptides capable of inducing the release of cytokines from
PBMCs are useful from the treatment of conditions which would
benefit from enhanced cytokine release and will be readily evident
to those of ordinary skill in thie art. Specifically,
1.times.10.sup.6 cells/ml of peripheral blood mononuclear cells
(PBMC) are cultured with 1% of a PRO polypeptide for 3 days in
complete RPMI media. The supernatant is then harvested and tested
for increased concentrations of various cytokines by ELISA as
compared to a human IgG treated control. A positive in the assay is
a 10-fold or greater increase in cytokine concentration in the PRO
polypeptide treated sample as compared to the human IgG treated
control.
[0946] The following polypeptides tested positive in this assay:
PRO526 and PRO1343.
Example 26
[0947] Inhibition of A-Peptide Binding to Factor VIIA (Assay
118)
[0948] This assay is designed to identify PRO polypeptides which
are capable of inhibiting the binding of A-peptide to factor VIIA,
thereby affecting the blood coagulation cascade. PRO polypeptides
testing positive in this assay are expected to be useful for the
treatment of conditions where alteration of the blood coagulation
cascade would be beneficial including, for example, stroke, heart
attack and various coagulation disorders. These PRO polypeptides
are also useful for the identification of agonist and antagonist
molecules which would also be useful for treatment of those
conditions.
[0949] Specifically,384 well plates are coated with soluble factor
VIIA and are incubated overnight at 4.degree. C. The wells are then
decanted and are blocked by the addition of 0.5% BSA for 1 hour.
The wells are then washed and 2011l of biotinylated A-peptide and
either various concentration of the PRO polypeptide (test) or
nothing (negative control) are added to each well. The plates are
then incubated for 1 hour at room temperature. The wells are again
washed and then 40 .mu.l of streptavidin-europium is added to each
well. The plates are then incubated for 30 minutes at room
temperature and then washed. 40 .mu.l of a fluorescence enhancement
solution is then added to each well, the plates incubated for 5
minutes at room temperature and each well is then read on Wallac
Victor reader under europium delayed fluorescence settings. Percent
inhibition of binding of the A-peptide to the factor VIIA is then
determined (as compared to the negative control), wherein a
positive in the assay is a percent inhibition of 30% or
greater.
[0950] The following PRO polypeptides tested positive in this
assay: PRO182.
Example 27
[0951] Inhibition of Adipocyte Differentiation Assay (Assay 66)
[0952] This assay is designed to identify PRO polypeptides which
are capable of inhibiting insulin-induced differentiation of
adipocytes. PRO polypeptides testing positive in this assay would
be expected to be useful for the treatment of conditions associated
with obesity, diabetes, etc.
[0953] Specifically, 3T3-L1 cells are seeded into the wells of 96
well plates at 6.times.10.sup.4 cells/well and allowed to grow to
confluency for 7 days. At day 7, the cells are treated with various
concentrations of the PRO polypeptide (or nothing for the negative
control) in the presence of 1 .mu.g/ml insulin,
0.25.times.10.sup.-6 M dexamethasone and 0.5 mM IBMX. The samples
are then incubated at 37.degree. C. in 7% CO.sub.2 for 2 days.
After the incubation, the media is removed by aspiration and the
cells are washed with PBS and re-exposed to the PRO polypeptide (or
nothing for the negative control) and 1 .mu.g/ml insulin. After 5
days, the media is removed and replaced with fresh PRO polypeptide
(or nothing for the negative control) and insulin. After 5 days,
the cells are lysed and the cell lysate is assayed using Sigma's
Triglyceride [INT] kit (Sigma procedure #336). A positive in the
assay is 20% greater inhibition of adipocyte differentiation in the
PRO polypeptide treated samples as compared to the negative
control.
[0954] The following PRO polypeptides tested positive in this
assay: PRO185 and PRO198.
Example 28
[0955] HUVEC Stimulation by PRO Polypeptides (Assay 131)
[0956] This assay is designed to identify PRO polypeptides which
are capable of stimulating the proliferation of HUVEC cells. PRO
polypeptides testing positive in this assay would be expected to be
useful for inducing angiogenesis for the treatmnent of conditions
where angiogenesis would be beneficial including, for example,
wound healing, and the like. Antagonists of these PRO polypeptides
would be expected to be useful for inhibiting angiogenesis for the
treatment of, for example, tumors, and the like.
[0957] Specifically, COSTAR.RTM. flat bottom black plates are
treated with fibronectin for 20 minutes and then washed twice with
PBS. HUVEC cells are then plated at 2000 cells/well in an
appropriate growth medium. The plates are then incubated overnight
and then the PRO polypeptide (1% final concentration), nothing
(negative control) or IL1.beta. (3.3 ng/ml final concentration;
positive control) is added. The plates are again incubated
overnight, stained with ICAMI-Cy5 and read on FMAT. A positive in
the assay is a 2-fold or greater increase in fluorescence as
compared to the positive control.
[0958] The following PRO polypeptides tested positive in this
assay: PRO222.
Example 29
[0959] Promotion of Chondrocyte Redifferentiation (Assay 129)
[0960] This assay is designed to determine whether PRO polypeptides
of the present invention show the ability to induce the
proliferation and/or redifferentiation of chondrocytes in culture.
PRO polypeptides testing positive in this assay would be expected
to be useful for the therapeutic treatment of various bone and/or
cartilage disorders such as, for example, sports injuries and
arthritis.
[0961] Porcine chondrocytes are isolated by overnight collagenase
digestion of articular cartilage of the metacarpophalangealjoint of
4-6 month old female pigs. The isolated cells are then seeded at
25,000 cells/cm.sup.2 in Ham F-12 containing 10% FBS and 4 .mu.g/ml
gentamycin. The culture media is changed every third day. On day
12, the cells are seeded in 96 well plates at 5,000 cells/well in
100 .mu.l of the same media without serum and 100 .mu.l of either
serum-free medium (negative control), staurosporin (final
concentration of 5 nM; positive control) or the test PRO
polypeptide are added to give a final volume of 200 .mu.l/well.
After 5 days at 37.degree. C., 22 .mu.l of media comtaining 100
.mu.g/ml Hoechst 33342 and 50 .mu.g/ml 5-CFDA is added to each well
and incubated for an additional 10 minutes at 37.degree. C. A
picture of the green fluorescence is taken for each well and the
differentiation state of the chondrocytes is calculated by
morphometric analysis. A positive result in the assay is obtained
when the >50% of the PRO polypeptide treated cells are
differentiated (compared to the background obtained by the negative
control).
[0962] The following PRO polypeptides tested positive in this
assay: PRO301.
Example 30
[0963] Microarray Analysis to Detect Overexpression of PRO
Polypelptides in Cancerous Tumors
[0964] Nucleic acid microarrays, often containing thousands of gene
sequences, are useful for identifying differentially expressed
genes in diseased tissues as compared to their normal counterparts.
Using nucleic acid nicroarrays, test and control mRNA samples from
test and control tissue samples are reverse transcribed and labeled
to generate cDNA probes. The cDNA probes are then hybridized to an
array of nucleic acids immobilized on a solid support. The array is
configured such that the sequence and position of each member of
the array is known. For example, a selection of genes known to be
expressed in certain disease states may be arrayed on a solid
support. Hybridization of a labeled probe with a particular array
member indicates that the sample from which the probe was derived
expresses that gene. If the hybridization signal of a probe from a
test (disease tissue) sample is greater than hybridization signal
of a probe from a control (normal tissue) sample, the gene or genes
overexpressed in the disease tissue are identified. The implication
of this result is that an overexpressed protein in a diseased
tissue is useful not only as a diagnostic marker for the presence
of the disease condition, but also as a therapeutic target for
treatment of the disease condition.
[0965] The methodology of hybridization of nucleic acids and
microarray technology is well known in the art. In the present
example, the specific preparation of nucleic acids for
hybridization and probes, slides, and hybridization conditions are
all detailed in U.S. Provisional Patent Application Serial No.
60/193,767, filed on Mar. 31, 2000 and which is herein incorporated
by reference.
[0966] In the present example, cancerous tumors derived from
various human tissues were studied for PRO polypeptide-encoding
gene expression relative to non-cancerous human tissue in an
attempt to identify those PRO polypeptides which are overexpressed
in cancerous tumors. Two sets of experimental data were generated.
In one set, cancerous human colon tumor tissue and matched
non-cancerous human colon tumor tissue from the same patient
("matched colon control") were obtained and analyzed for PRO
polypeptide expression using the above described microarray
technology. In the second set of data, cancerous human tumor tissue
from any of a variety of different human tumors was obtained and
compared to a "universal" epithelial control sample which was
prepared by pooling non-cancerous human tissues of epithelial
origin, including liver, kidney, and lung. mRNA isolated from the
pooled tissues represents a mixture of expressed gene products from
these different tissues. Microarray hybridization experiments using
the pooled control samples generated a linear plot in a 2-color
analysis. The slope of the line generated in a 2-color analysis was
then used to normalize the ratios of (test:control detection)
within each experiment. The normalized ratios from various
experiments were then compared and used to identify clustering of
gene expression. Thus, the pooled "universal control" sample not
only allowed effective relative gene expression determinations in a
simple 2-sample comparison, it also allowed multi-sample
comparisons across several experiments.
[0967] In the present experiments, nucleic acid probes derived from
the herein described PRO polypeptide-encoding nucleic acid
sequences were used in the creation of the microarray and RNA from
the tumor tissues listed above were used for the hybridization
thereto. A value based upon the normalized ratio:experimental ratio
was designated as a "cutoff ratio". Only values that were above
this cutoff ratio were determined to be significant. Table 8 below
shows the results of these experiments, demonstrating that various
PRO polypeptides of the preent invention are significantly
overexpressed in various human tumor tissues as compared to a
non-cancerous human tissue control. As described above, these data
demonstrate that the PRO polypeptides of the present invention are
useful not only as diagnostic markers for the presence of one or
more cancerous tumors, but also serve as therapeutic targets for
the treatment of those tumors.
8 TABLE 8 Molecule is overexpressed in: as compared to: PRO177
breast tumor universal normal control PRO177 liver tumor universal
normal control PRO177 lung tumor universal normal control PRO3574
breast tumor universal normal control PRO3574 colon tumor matched
normal colon control PRO1280 breast tumor universal normal control
PRO1280 lung tumor universal normal control PRO4984 lung tumor
universal normal control PRO4988 colon tumor universal normal
control PRO4988 lung tumor universal normal control PRO305 lung
tumor universal normal control PRO305 colon tumor universal normal
control PRO1866 prostate tumor universal normal control PRO1866
lung tumor universal normal control PRO1866 colon tumor universal
normal control PRO4996 breast tumor universal normal control
PRO4996 lung tumor universal normal control PRO4406 lung tumor
universal normal control PRO4406 colon tumor universal normal
control PRO1120 colon tumor universal normal control PRO1120 breast
tumor universal normal control PRO1120 rectal tumor universal
normal control PRO4990 lung tumor universal normal control PRO738
cervical tumor universal normal control PRO738 lung tumor universal
normal control PRO738 breast tumor universal normal control PRO3577
lung tumor universal normal control PRO1879 breast tumor universal
normal control PRO1879 lung tumor universal normal control PRO1879
colon tumor universal normal control PRO1471 lung tumor universal
normal control PRO1076 prostate tumor universal normal control
PRO1483 lung tumor universal normal control PRO4985 rectal tumor
universal normal control PRO4985 colon tumor universal normal
control PRO4985 breast tumor universal normal control PRO4985 lung
tumor universal normal control PRO5000 lung tumor universal normal
control PRO1881 liver tumor universal normal control PRO1881 lung
tumor universal normal control PRO1881 breast tumor universal
normal control PRO4314 lung tumor universal normal control PRO4314
breast tumor universal normal control PRO4987 lung tumor universal
normal control PRO4313 lung tumor universal normal control PRO4313
breast tumor universal normal control PRO4799 colon tumor universal
normal control PRO4995 liver tumor universal normal control PRO4995
colon tumor universal normal control PRO4995 colon tumor matched
normal colon control PRO1341 prostate tumor universal normal
control PRO1341 lung tumor universal normal control PRO1341 colon
tumor universal normal control PRO1341 colon tumor matched normal
colon control PRO1777 lung tumor universal normal control PRO1777
colon tumor matched normal colon control PRO3580 lung tumor
universal normal control PRO3580 prostate tumor universal normal
control PRO1779 lung tumor universal normal control PRO1779 colon
tumor universal normal control PRO1779 cervical tumor universal
normal control PRO1754 breast tumor universal normal control
PRO1754 lung tumor universal normal control PRO1906 breast tumor
universal normal control PRO1906 colon tumor universal normal
control PRO1906 prostate tumor universal normal control PRO1870
breast tumor universal normal control PRO4329 lung tumor universal
normal control PRO4979 colon tumor universal normal control PRO1885
rectal tumor universal normal control PRO1885 colon tumor universal
normal control PRO1885 colon tumor matched normal colon control
PRO1882 prostate tumor universal normal control PRO1882 lung tumor
universal normal control PRO1882 colon tumor universal normal
control PRO1882 breast tumor universal normal control PRO1882
cervical tumor universal normal control PRO4989 rectal tumor
universal normal control PRO4989 breast tumor universal normal
control PRO4989 colon tumor matched normal colon control PRO4989
colon tumor universal normal control PRO4323 lung tumor universal
normal control PRO4323 liver tumor universal normal control PRO1886
breast tumor universal normal control PRO1886 lung tumor universal
normal control PRO1886 rectal tumor universal normal control
PRO4395 colon tumor universal normal control PRO4395 prostate tumor
universal normal control PRO4395 lung tumor universal normal
control PRO4395 cervical tumor universal normal control PRO1782
colon tumor universal normal control PRO1782 lung tumor universal
normal control PRO4388 lung tumor universal normal control PRO4341
breast tumor universal normal control PRO4341 lung tumor universal
normal control PRO3438 lung tumor universal normal control PRO4321
breast tumor universal normal control PRO4321 lung tumor universal
normal control PRO4321 colon tumor universal normal control PRO4304
breast tumor universal normal control PRO4304 lung tumor universal
normal control PRO4403 colon tumor universal normal control PRO4403
breast tumor universal normal control PRO4403 lung tumor universal
normal control PRO4324 lung tumor universal normal control PRO4324
breast tumor universal normal control PRO4303 cervical tumor
universal normal control PRO4303 lung tumor universal normal
control PRO4303 breast tumor universal normal control PRO4303 colon
tumor universal normal control PRO4303 prostate tumor universal
normal control PRO4305 breast tumor universal normal control
PRO4305 lung tumor universal normal control PRO4305 colon tumor
universal normal control PRO4305 liver tumor universal normal
control PRO4404 lung tumor universal normal control PRO4404 breast
tumor universal normal control PRO4404 rectal tumor universal
normal control PRO1884 lung tumor universal normal control PRO4349
colon tumor universal normal control PRO4349 lung tumor universal
normal control PRO4401 colon tumor universal normal control PRO4401
lung tumor universal normal control PRO1867 lung tumor universal
normal control PRO1867 liver tumor universal normal control PRO4319
breast tumor universal normal control PRO4319 lung tumor universal
normal control PRO4991 lung tumor universal normal control PRO4991
colon tumor universal normal control PRO4398 lung tumor universal
normal control PRO4346 lung tumor universal normal control PRO4350
colon tumor universal normal control PRO4350 prostate tumor
universal normal control PRO4350 lung tumor universal normal
control PRO4318 prostate tumor universal normal control PRO4318
lung tumor universal normal control PRO4340 breast tumor universal
normal control PRO4340 lung tumor universal normal control PRO4400
breast tumor universal normal control PRO4400 lung tumor universal
normal control PRO4320 lung tumor universal normal control PRO4409
lung tumor universal normal control PRO4409 cervical tumor
universal normal control PRO4409 colon tumor universal normal
control PRO4399 lung tumor universal normal control PRO4399 breast
tumor universal normal control PRO4418 lung tumor universal normal
control PRO4418 breast tumor universal normal control PRO4330
cervical tumor universal normal control PRO4330 colon tumor matched
normal colon control PRO4339 breast tumor universal normal control
PRO4339 colon tumor universal normal control PRO4326 lung tumor
universal normal control PRO4326 colon tumor universal normal
control PRO6014 breast tumor universal normal control PRO3446 colon
tumor universal normal control PRO3446 lung tumor universal normal
control PRO4322 lung tumor universal normal control PRO4322 rectal
tumor universal normal control PRO4322 colon tumor matched normal
colon control PRO4381 breast tumor universal normal control PRO4381
lung tumor universal normal control PRO4381 colon tumor universal
normal control PRO4348 lung tumor universal normal control PRO4348
prostate tumor universal normal control PRO4371 breast tumor
universal normal control PRO3742 colon tumor universal normal
control PRO3742 lung tumor universal normal control PRO5773 lung
tumor universal normal control PRO5773 colon tumor universal normal
control PRO5773 prostate tumor universal normal control PRO5774
colon tumor universal normal control PRO4343 colon tumor universal
normal control PRO4325 lung tumor universal normal control PRO4347
lung tumor universal normal control PRO4347 colon tumor universal
normal control PRO4347 rectal tumor universal normal control
PRO3743 colon tumor universal normal control PRO3743 lung tumor
universal normal control PRO3743 prostate tumor universal normal
control PRO4426 colon tumor universal normal control PRO4500 colon
tumor universal normal control PRO4389 breast tumor universal
normal control PRO4389 lung tumor universal normal control PRO4337
colon tumor universal normal control PRO4337 breast tumor universal
normal control PRO4337 lung tumor universal normal control PRO4992
lung tumor universal normal control PRO5996 lung tumor universal
normal control PRO4345 lung tumor universal normal control PRO4345
colon tumor universal normal control PRO5780 lung tumor universal
normal control PRO5780 breast tumor universal normal control
PRO5992 lung tumor universal normal control PRO5992 colon tumor
universal normal control PRO5992 breast tumor universal normal
control PRO4428 prostate tumor universal normal control PRO4994
lung tumor universal normal control PRO5995 lung tumor universal
normal control PRO5995 colon tumor universal normal control PRO6094
lung tumor universal normal control PRO6094 colon tumor universal
normal control PRO4317 lung tumor universal normal control PRO4317
colon tumor universal normal control PRO4317 liver tumor universal
normal control PRO4317 colon tumor matched normal colon control
PRO5997 colon tumor universal normal control PRO5997 lung tumor
universal normal control PRO5005 lung tumor universal normal
control PRO5005 colon tumor universal normal control PRO5004 colon
tumor universal normal control PRO6001 breast tumor universal
normal control PRO6013 colon tumor universal normal control PRO4502
lung tumor universal normal control PRO4502 colon tumor universal
normal control PRO6007 breast tumor universal normal control
PRO6028 breast tumor universal normal control PRO6028 colon tumor
universal normal control PRO4327 prostate tumor universal normal
control PRO4315 colon tumor universal normal control PRO5993 lung
tumor universal normal control PRO5993 colon tumor universal normal
control PRO4503 colon tumor universal normal control PRO4976 lung
tumor universal normal control PRO5798 lung tumor universal normal
control PRO5798 colon tumor universal normal control PRO6242 colon
tumor universal normal control PRO6242 colon tumor matched normal
colon control PRO6242 breast tumor universal normal control PRO6242
liver tumor universal normal control PRO6242 rectal tumor universal
normal control PRO6095 breast tumor universal normal control
PRO6095 lung tumor universal normal control PRO6093 colon tumor
universal normal control PRO6093 breast tumor universal normal
control PRO6093 lung tumor universal normal control PRO6093 colon
tumor matched normal colon control PRO6012 colon tumor universal
normal control PRO6027 lung tumor universal normal control PRO6027
colon tumor universal normal control PRO6027 rectal tumor universal
normal control PRO6181 prostate tumor universal normal control
PRO6181 lung tumor universal normal control PRO6181 colon tumor
universal normal control PRO6097 colon tumor universal normal
control PRO6097 lung tumor universal normal control PRO6090 lung
tumor universal normal control PRO7171 lung tumor universal normal
control PRO7171 colon tumor universal normal control PRO7171 breast
tumor universal normal control PRO6258 prostate tumor universal
normal control PRO6258 breast tumor universal normal control
PRO6258 cervical tumor universal normal control PRO6258 liver tumor
universal normal control PRO6258 colon tumor universal normal
control PRO9820 prostate tumor universal normal control PRO6243
lung tumor universal normal control PRO6182 lung tumor universal
normal control PRO6079 lung tumor universal normal control PRO6079
colon tumor universal normal control PRO6079 breast tumor universal
normal control PRO6079 prostate tumor universal normal control
PRO7434 lung tumor universal normal control PRO9865 colon tumor
universal normal control PRO9828 colon tumor universal normal
control PRO196 colon tumor universal normal control PRO196 lung
tumor universal normal control PRO196 breast tumor universal normal
control PRO197 colon tumor universal normal control PRO197 lung
tumor universal normal control PRO197 breast tumor universal normal
control PRO195 colon tumor universal normal control PRO195 lung
tumor universal normal control PRO195 breast tumor universal normal
control PRO187 lung tumor universal normal control PRO187 liver
tumor universal normal control PRO182 colon tumor universal normal
control PRO182 lung tumor universal normal control PRO182 breast
tumor universal normal control PRO188 rectal tumor universal normal
control PRO183 colon tumor universal normal control PRO183 lung
tumor universal normal control PRO183 breast tumor universal normal
control PRO183 rectal tumor universal normal control PRO184 lung
tumor universal normal control PRO184 breast tumor universal normal
control PRO185 lung tumor universal normal control PRO200 colon
tumor universal normal control PRO200 lung tumor universal normal
control PRO200 breast tumor universal normal control PRO200 rectal
tumor universal normal control PRO202 colon tumor universal normal
control PRO202 lung tumor universal normal control PRO202 breast
tumor universal normal control PRO202 rectal tumor universal normal
control PRO202 liver tumor universal normal control PRO214 colon
tumor universal normal control PRO214 lung tumor universal normal
control PRO215 colon tumor universal normal control PRO215 lung
tumor universal normal control PRO215 breast tumor universal normal
control PRO219 colon tumor universal normal control PRO219 lung
tumor universal normal control PRO219 breast tumor universal normal
control PRO219 liver tumor universal normal control PRO211 lung
tumor universal normal control PRO211 breast tumor universal normal
control PRO220 colon tumor universal normal control PRO220 lung
tumor universal normal control PRO220 breast tumor universal normal
control PRO366 colon tumor universal normal control PRO366 lung
tumor universal normal control PRO366 breast tumor universal normal
control PRO216 lung tumor universal normal control PRO221 colon
tumor universal normal control PRO221 lung tumor universal normal
control PRO221 breast tumor universal normal control PRO228 lung
tumor universal normal control PRO228 breast tumor universal normal
control PRO217 lung tumor universal normal control PRO217 breast
tumor universal normal control PRO222 colon tumor universal normal
control PRO222 lung tumor universal normal control PRO222 breast
tumor universal normal control PRO224 colon tumor universal normal
control PRO224 lung tumor universal normal control PRO224 breast
tumor universal normal control PRO224 prostate tumor universal
normal control PRO224 rectal tumor universal normal control PRO230
colon tumor universal normal control PRO230 lung tumor universal
normal control PRO230 breast tumor universal normal control PRO230
prostate tumor universal normal control
PRO198 colon tumor universal normal control PRO198 lung tumor
universal normal control PRO198 breast tumor universal normal
control PRO198 liver tumor universal normal control PRO226 lung
tumor universal normal control PRO226 breast tumor universal normal
control PRO261 lung tumor universal normal control PRO242 colon
tumor universal normal control PRO242 lung tumor universal normal
control PRO242 breast tumor universal normal control PRO227 colon
tumor universal normal control PRO227 lung tumor universal normal
control PRO237 colon tumor universal normal control PRO237 lung
tumor universal normal control PRO237 breast tumor universal normal
control PRO237 prostate tumor universal normal control PRO241 colon
tumor universal normal control PRO241 lung tumor universal normal
control PRO241 breast tumor universal normal control PRO231 colon
tumor universal normal control PRO231 lung tumor universal normal
control PRO231 breast tumor universal normal control PRO231 rectal
tumor universal normal control PRO235 colon tumor universal normal
control PRO235 lung tumor universal normal control PRO235 breast
tumor universal normal control PRO235 liver tumor universal normal
control PRO323 lung tumor universal normal control PRO323 breast
tumor universal normal control PRO323 rectal tumor universal normal
control PRO245 colon tumor universal normal control PRO245 lung
tumor universal normal control PRO245 breast tumor universal normal
control PRO245 cervical tumor universal normal control PRO245 liver
tumor universal normal control PRO246 colon tumor universal normal
control PRO246 lung tumor universal normal control PRO246 breast
tumor universal normal control PRO288 lung tumor universal normal
control PRO288 breast tumor universal normal control PRO248 lung
tumor universal normal control PRO248 rectal tumor universal normal
control PRO257 colon tumor universal normal control PRO257 lung
tumor universal normal control PRO257 prostate tumor universal
normal control PRO172 colon tumor universal normal control PRO172
lung tumor universal normal control PRO172 breast tumor universal
normal control PRO258 colon tumor universal normal control PRO258
lung tumor universal normal control PRO258 breast tumor universal
normal control PRO265 lung tumor universal normal control PRO265
breast tumor universal normal control PRO265 rectal tumor universal
normal control PRO326 colon tumor universal normal control PRO326
lung tumor universal normal control PRO326 breast tumor universal
normal control PRO326 liver tumor universal normal control PRO266
colon tumor universal normal control PRO266 lung tumor universal
normal control PRO266 breast tumor universal normal control PRO269
lung tumor universal normal control PRO269 rectal tumor universal
normal control PRO285 colon tumor universal normal control PRO285
lung tumor universal normal control PRO285 breast tumor universal
normal control PRO328 colon tumor universal normal control PRO328
lung tumor universal normal control PRO328 breast tumor universal
normal control PRO344 breast tumor universal normal control PRO272
lung tumor universal normal control PRO301 colon tumor universal
normal control PRO301 lung tumor universal normal control PRO301
breast tumor universal normal control PRO331 colon tumor universal
normal control PRO331 lung tumor universal normal control PRO331
breast tumor universal normal control PRO332 colon tumor universal
normal control PRO332 lung tumor universal normal control PRO332
breast tumor universal normal control PRO353 colon tumor universal
normal control PRO353 lung tumor universal normal control PRO353
breast tumor universal normal control PRO310 colon tumor universal
normal control PRO310 lung tumor universal normal control PRO310
breast tumor universal normal control PRO310 rectal tumor universal
normal control PRO337 colon tumor universal normal control PRO337
lung tumor universal normal control PRO337 breast tumor universal
normal control PRO346 lung tumor universal normal control PRO350
lung tumor universal normal control PRO350 breast tumor universal
normal control PRO526 colon tumor universal normal control PRO526
lung tumor universal normal control PRO526 breast tumor universal
normal control PRO381 colon tumor universal normal control PRO381
lung tumor universal normal control PRO381 breast tumor universal
normal control PRO381 prostate tumor universal normal control
PRO846 colon tumor universal normal control PRO846 lung tumor
universal normal control PRO363 colon tumor universal normal
control PRO363 lung tumor universal normal control PRO365 lung
tumor universal normal control PRO365 breast tumor universal normal
control PRO1310 breast tumor universal normal control PRO731 colon
tumor universal normal control PRO731 lung tumor universal normal
control PRO731 breast tumor universal normal control PRO322 colon
tumor universal normal control PRO322 lung tumor universal normal
control PRO322 breast tumor universal normal control PRO322 rectal
tumor universal normal control PRO322 liver tumor universal normal
control PRO536 lung tumor universal normal control PRO536 breast
tumor universal normal control PRO536 liver tumor universal normal
control PRO719 colon tumor universal normal control PRO719 lung
tumor universal normal control PRO719 breast tumor universal normal
control PRO619 colon tumor universal normal control PRO619 lung
tumor universal normal control PRO619 breast tumor universal normal
control PRO771 colon tumor universal normal control PRO771 lung
tumor universal normal control PRO771 breast tumor universal normal
control PRO1083 colon tumor universal normal control PRO1083 lung
tumor universal normal control PRO1083 breast tumor universal
normal control PRO1083 prostate tumor universal normal control
PRO862 colon tumor universal normal control PRO862 lung tumor
universal normal control PRO862 breast tumor universal normal
control PRO733 colon tumor universal normal control PRO733 lung
tumor universal normal control PRO733 breast tumor universal normal
control PRO733 liver tumor universal normal control PRO1188 lung
tumor universal normal control PRO1188 breast tumor universal
normal control PRO1188 rectal tumor universal normal control PRO770
lung tumor universal normal control PRO770 breast tumor universal
normal control PRO1080 colon tumor universal normal control PRO1080
lung tumor universal normal control PRO1080 breast tumor universal
normal control PRO1017 colon tumor universal normal control PRO1017
lung tumor universal normal control PRO1017 breast tumor universal
normal control PRO1016 colon tumor universal normal control PRO1016
lung tumor universal normal control PRO1016 breast tumor universal
normal control PRO1016 rectal tumor universal normal control PRO792
lung tumor universal normal control PRO938 colon tumor universal
normal control PRO938 lung tumor universal normal control PRO938
breast tumor universal normal control PRO1012 colon tumor universal
normal control PRO1012 lung tumor universal normal control PRO1012
rectal tumor universal normal control PRO1012 liver tumor universal
normal control PRO1008 lung tumor universal normal control PRO1075
colon tumor universal normal control PRO1075 lung tumor universal
normal control PRO1007 colon tumor universal normal control PRO1007
lung tumor universal normal control PRO1007 breast tumor universal
normal control PRO1007 rectal tumor universal normal control
PRO1056 colon tumor universal normal control PRO1056 lung tumor
universal normal control PRO1056 breast tumor universal normal
control PRO791 colon tumor universal normal control PRO791 lung
tumor universal normal control PRO791 breast tumor universal normal
control PRO791 rectal tumor universal normal control PRO1111 colon
tumor universal normal control PRO1111 lung tumor universal normal
control PRO1111 breast tumor universal normal control PRO812 lung
tumor universal normal control PRO812 breast tumor universal normal
control PRO812 rectal tumor universal normal control PRO1066 lung
tumor universal normal control PRO1185 colon tumor universal normal
control PRO1185 lung tumor universal normal control PRO1185 breast
tumor universal normal control PRO1031 lung tumor universal normal
control PRO1360 lung tumor universal normal control PRO1360 breast
tumor universal normal control PRO1309 lung tumor universal normal
control PRO1309 breast tumor universal normal control PRO1107 lung
tumor universal normal control PRO1107 breast tumor universal
normal control PRO836 colon tumor universal normal control PRO836
lung tumor universal normal control PRO1132 lung tumor universal
normal control PRO1132 breast tumor universal normal control
PRO1131 colon tumor universal normal control PRO1131 lung tumor
universal normal control PRO1131 breast tumor universal normal
control PRO1131 liver tumor universal normal control PRO1130 colon
tumor universal normal control PRO1130 lung tumor universal normal
control PRO1130 breast tumor universal normal control PRO844 colon
tumor universal normal control PRO844 lung tumor universal normal
control PRO844 breast tumor universal normal control PRO844 rectal
tumor universal normal control PRO1154 colon tumor universal normal
control PRO1154 lung tumor universal normal control PRO1154 rectal
tumor universal normal control PRO1154 liver tumor universal normal
control PRO1181 lung tumor universal normal control PRO1181 breast
tumor universal normal control PRO1126 colon tumor universal normal
control PRO1126 lung tumor universal normal control PRO1126 breast
tumor universal normal control PRO1126 adrenal tumor universal
normal control PRO1186 colon tumor universal normal control PRO1186
lung tumor universal normal control PRO1186 breast tumor universal
normal control PRO1186 liver tumor universal normal control PRO1198
colon tumor universal normal control PRO1198 lung tumor universal
normal control PRO1159 lung tumor universal normal control PRO1159
breast tumor universal normal control PRO1159 liver tumor universal
normal control PRO1265 colon tumor universal normal control PRO1265
breast tumor universal normal control PRO1250 colon tumor universal
normal control PRO1250 lung tumor universal normal control PRO1250
breast tumor universal normal control PRO1475 colon tumor universal
normal control PRO1475 breast tumor universal normal control
PRO1312 colon tumor universal normal control PRO1312 lung tumor
universal normal control PRO1312 breast tumor universal normal
control PRO1308 colon tumor universal normal control PRO1308 lung
tumor universal normal control PRO1308 liver tumor universal normal
control PRO1326 colon tumor universal normal control PRO1325 lung
tumor universal normal control PRO1326 breast tumor universal
normal control PRO1192 colon tumor universal normal control PRO1192
lung tumor universal normal control PRO1192 breast tumor universal
normal control PRO1246 colon tumor universal normal control PRO1246
lung tumor universal normal control PRO1246 breast tumor universal
normal control PRO1246 prostate tumor universal normal control
PRO1356 colon tumor universal normal control PRO1356 lung tumor
universal normal control PRO1356 breast tumor universal normal
control PRO1275 lung tumor universal normal control PRO1275 breast
tumor universal normal control PRO1274 lung tumor universal normal
control PRO1358 colon tumor universal normal control PRO1358 lung
tumor universal normal control PRO1358 prostate tumor universal
normal control PRO1286 colon tumor universal normal control PRO1286
lung tumor universal normal control PRO1286 prostate tumor
universal normal control PRO1286 rectal tumor universal normal
control PRO1294 colon tumor universal normal control PRO1294 lung
tumor universal normal control PRO1294 breast tumor universal
normal control PRO1294 rectal tumor universal normal control
PRO1273 lung tumor universal normal control PRO1273 rectal tumor
universal normal control PRO1279 colon tumor universal normal
control PRO1279 lung tumor universal normal control PRO1195 lung
tumor universal normal control PRO1195 breast tumor universal
normal control PRO1271 lung tumor universal normal control PRO1271
breast tumor universal normal control PRO1271 liver tumor universal
normal control PRO1338 colon tumor universal normal control PRO1338
lung tumor universal normal control PRO1338 breast tumor universal
normal control PRO1343 colon tumor universal normal control PRO1343
lung tumor universal normal control PRO1343 breast tumor universal
normal control PRO1343 rectal tumor universal normal control
PRO1434 lung tumor universal normal control PRO1418 lung tumor
universal normal control PRO1418 liver tumor universal normal
control PRO1387 colon tumor universal normal control PRO1387 lung
tumor universal normal control PRO1387 prostate tumor universal
normal control PRO1387 rectal tumor universal normal control
PRO1384 colon tumor universal normal control PRO1384 lung tumor
universal normal control PRO1565 colon tumor universal normal
control PRO1565 lung tumor universal normal control PRO1565
prostate tumor universal normal control PRO1474 colon tumor
universal normal control PRO1474 lung tumor universal normal
control PRO1474 breast tumor universal normal control PRO1474
rectal tumor universal normal control PRO1917 colon tumor universal
normal control PRO1917 lung tumor universal normal control PRO1917
breast tumor universal normal control PRO1787 colon tumor universal
normal control PRO1787 lung tumor universal normal control PRO1787
breast tumor universal normal control PRO1556 lung tumor universal
normal control PRO1556 breast tumor universal normal control
PRO1561 colon tumor universal normal control PRO1561 lung tumor
universal normal control PRO1561 rectal tumor universal normal
control PRO1693 colon tumor universal normal control PRO1693 lung
tumor universal normal control PRO1693 breast tumor universal
normal control PRO1868 lung tumor universal normal control PRO1868
breast tumor universal normal control PRO1890 colon tumor universal
normal control PRO1890 lung tumor universal normal control PRO1890
breast tumor universal normal control PRO1890 prostate tumor
universal normal control PRO1887 colon tumor universal normal
control PRO1887 breast tumor universal normal control PRO4353 lung
tumor universal normal control PRO4353 breast tumor universal
normal control PRO1801 colon tumor universal normal control PRO1801
lung tumor universal normal control PRO4357 lung tumor universal
normal control PRO4357 breast tumor universal normal control
PRO4302 colon tumor universal normal control PRO4302 lung tumor
universal normal control PRO4302 breast tumor universal normal
control PRO4302 prostate tumor universal normal control PRO5990
colon tumor universal normal control PRO5990 lung tumor universal
normal control PRO5990 breast tumor universal normal control
Example 31
[0968] Identification of Recentor/Ligand Interactions
[0969] In this assay, various PRO polypeptides are tested for
ability to bind to a panel of potential receptor or ligand
molecules for the purpose of identifying receptor/ligand
interactions. The identification of a ligand for a known receptor,
a receptor for a known ligand or a novel receptor/ligand pair is
useful for a variety of indications including, for example,
targeting bioactive molecules (linked to the ligand or receptor) to
a cell known to express the receptor or ligand, use of the receptor
or ligand as a reagent to detect the presence of the ligand or
receptor in a composition suspected of containing the same, wherein
the composition may comprise cells suspected of expressing the
ligand or receptor, modulating the growth of or another biological
or immunological activity of a cell known to express or respond to
the receptor or ligand, modulating the immune response of cells or
toward cells that express the receptor or ligand, allowing the
preparaion of agonists, antagonists and/or antibodies directed
against the receptor or ligand which will modulate the growth of or
a biological or immunological activity of a cell expressing the
receptor or ligand, and various other indications which will be
readily apparent to the ordinarily skilled artisan.
[0970] The assay is performed as follows. A PRO polypeptide of the
present invention suspected of being a ligand for a receptor is
expressed as a fusion protein containing the Fc domain of human IgG
(an immunoadhesin). Receptor-ligand binding is detected by allowing
interaction of the immunoadhesin polypeptide with cells (e.g. Cos
cells) expressing candidate PRO polypeptide receptors and
visualization of bound immunoadhesin with fluorescent reagents
directed toward the Fc fusion domain and examination by microscope.
Cells expressing candidate receptors are produced by transient
transfection, in parallel, of defined subsets of a library of cDNA
expression vectors encoding PRO polypeptides that may function as
receptor molecules. Cells are then incubated for 1 hour in the
presence of the PRO polypeptide immunoadhesin being tested for
possible receptor binding. The cells are then washed and fixed with
paraformaldehyde. The cells are then incubated with fluorescent
conjugated antibody directed against the Fc portion of the PRO
polypeptide immunoadhesin (e.g. FlTC conjugated goat anti-human-Fc
antibody). The cells are then washed again and examined by
microscope. A positive interaction is judged by the presence of
fluorescent labeling of cells transfected with cDNA encoding a
particular PRO polypeptide receptor or pool of receptors and an
absence of similar fluorescent labeling of similarly prepared cells
that have been transfected with other cDNA or pools of cDNA. If a
defined pool of cDNA expression vectors is judged to be positive
for interaction with a PRO polypeptide immunoadhesin, the
individual cDNA species that comprise the pool are tested
individually (the pool is "broken down") to determine the specific
cDNA that encodes a receptor able to interact with the PRO
polypeptide immunoadhesin.
[0971] In another embodiment of this assay, an epitope-tagged
potential ligand PRO polypeptide (e.g. 8 histidine "His" tag) is
allowed to interact with a panel of potential receptor PRO
polypeptide molecules that have been expressed as fusions with the
Fc domain of human IgG (immunoadhesins). Following a 1 hour
co-incubation with the epitope tagged PRO polypeptide, the
candidate receptors are each immunoprecipitated with protein A
beads and the beads are washed. Potential ligand interaction is
determined by western blot analysis of the immunoprecipitated
complexes with antibody directed towards the epitope tag. An
interaction is judged to occur if a band of the anticipated
molecular weight of the epitope tagged protein is observed in the
western blot analysis with a candidate receptor, but is not
observed to occur with the other members of the panel of potential
receptors.
[0972] Using these assays, the following receptor/ligand
interactions have been herein identified:
[0973] (1) PRO1801 binds to PRO1114 and PRO4978.
[0974] (2) PRO100 binds to PRO1114.
[0975] The foregoing written specification is considered to be
sufficient to enable one skilled in the art to practice the
invention. The present invention is not to be limited in scope by
the construct deposited, since the deposited embodiment is intended
as a single illustration of certain aspects of the invention and
any constructs that are functionally equivalent are within the
scope of this invention. The deposit of material herein does not
constitute an admission that the written description herein
contained is inadequate to enable the practice of any aspect of the
invention, including the best mode thereof, nor is it to be
construed as limiting the scope of the claims to the specific
illustrations that it represents. Indeed, various modifications of
the invention in addition to those shown and described herein will
become apparent to those skilled in the art from the foregoing
description and fall within the scope of the appended claims.
[0976] FIG. 13
GGCGGCGTCATGTGATCCGCTTCCCTGCTCCTTTAAGCGTCCACAGGCGGCGGAGCGGC- CAC
AATCACAGCTCCGTGCAATGGGGGAACCCGAGCCGGCTGCGCCGGGGGAATCCGTGCGGGCG
CCTTCCGTCCCGGTCCCAAATCCTCGCCGCTCCAGCACCTCTGAAGTTTTGCAGCGCCCAGA
AAGGAGGCGAGGAAGGAGGGAGTGTGTGAGAGGAGGGAGCAAAAAGCTCACCCTAAAACATT
TATTTCAAGGAGAAAAGAAAAAGGGGGGGGCGCAAAAATGGCTGGGCAATTATAGAAAACAT
GAGCACCAAGAAGCTGTGCATTGTTGGTGGGATTCTGCTCGTGTTCCAAATCATCGCCTTTC
TGGTGGGAGGCTTGATTGCTCCAGGGCCCACAACGGCAGTGTCCTACATGTCGGTGAAATGT
GTGGATGCCCGTAAGAACCATCACAAGACAAAATGGTTCGTGCCTTGGGGACCCAATCATTG
TGACAAGATCCGAGACATTGAAGAGGCAATTCCAAGGGAAATTGAAGCCAATGACATCGTGT
TTTCTGTTCACATTCCCCTCCCCCACATGGAGATGAGTCCTTGGTTCCAATTCATGCTGTTT
ATCCTGCAGCTGGACATTGCCTTCAAGCTAAACAACCAAATCAGAGAAAATGCAGAAGTCTC
CATGGACGTTTCCCTGGCTTACCGTGATGACGCATTTGCTGAGTGGACTGAAATGGCCCATG
AAAGAGTACCACGGAAACTCAAATGCACCTTCACATCTCCCAAGACTCCAGAGCATGAGGGC
CGTTACTATGAATGTGATGTCCTTCCTTTCATGGAAATTGGGTCTGTGGCCCATAAGTTTTA
CCTTTTAAACATCCGGCTGCCTGTGAATGAGAAGAAGAAAATCAATGTGGGAATTGGGGAGA
TAAAGGATATCCGGTTGGTGGGGATCCACCAAAATGGAGGCTTCACCAAGGTGTGGTTTGCC
ATGAAGACCTTCCTTACGCCCAAAGCATCTTCATCATTATGGTGTGGTATTGGGAGGATCAC
CATGATGTCCCGACCCCCAGTGCTTCTGGAAAAAGTCATCTTTGCCCTTGGGATTTCCATGA
CCTTTATCAATATCCCAGTGGAATGGTTTTCCATCGGGTTTGACTGGACCTGGATGCTGCTG
TTTGGTGACATCCGACAGGGCATCTTCTATGCGATGCTTCTGTCCTTCTOGATCATCTTCTG
TGGCGAGCACATGATGGATCAGCACGAGCGGAACCACATCGCAGGGTATTGGAAGCAAGTCG
GACCCATTGCCGTTGGCTCCTTCTGCCTCTTCATATTTAACATGTGTGAGAGAGGGGTACAA
CTCACGAATCCCTTCTACAGTTATCTGGACTACGACATTGGAACAGAGCTGGCCATGGCCTT
CATCATCGTGGCTGGAATCTGCCTCTGCCTCTACTTCCTGTTTCTATGCTTCATGGTATTTC
AGGTGTTTCGGAAACATCAGTGGGAAGCAGTCCAGCCTCCAGCTATGAGCAAAGTCCGGCGG
CTACACTATGAGGGGCTAATTTTTAGGTTCAAGTTCCTCATGCTTATCACCTTGGCCTGCGC
TGCCATGACTGTCATCTTCTTCATCGTTAGTCAGGTAACGGAAGGCCATTGGAAATGGGGCG
GCGTCACAGTCCAAGTGAACAGTGCCTTTTTCACAGGCATCTATGGGATGTGGAATCTGTAT
GTCTTTGCTCTGATGTTCTTGTATGCACCATCCCATAAAAACTATGGAGAAGACCAGTCCAA
TGGCGATCTGGGTGTCCATAGTGGGGAAGAACTCCAGCTCACCACCACTATCACCCATGTGG
ACGGACCCACTGAGATCTACAAGTTGACCCGCAAGGAGGCCCAGGAGTAGGAGGCTGCAGCG
CCCGGCTGGGACGGTCTCTCCATACCCCAAAGCCCCTCTAACTAGAGTGGGGCATGCCAGAG
AGAGCTCAATGTACAAATGAATGCCTCATGGCTCTTAGCTGTGGTTTCTTGGACCAGCGGCA
TGGACATTTGTCAGTTTGCCTTCTGAACGGTAGCTTTTGGAGGAAGTTCCTGCAGCCACTAA
TGCATTGTGTATGATAACAAAAACTCTGGTATGACACATTTTCTGTGATCATTGTTAATTAG
TGACATAGTAACATCTGTAGCAGCTGGTTAGTAAACCTCATGTGGGGGTGGGGTGGGGGTGT
ATTCCTTGGGGGATGGTTTGGGCCGAATGGGGAGTGGAATATTTGACATTTTTCCTGTTTTA
AATTCTAGGATAGATTTTAACATCCTTTGCGGTCCCAGTCCAAGGTAGGCTGGTGTCATAGT
CTTCTCACTCCTAATCCATGACCACTGTTTTTTTCCTATTTATATCACCAGGTAGCCTACTG
AGTTAATATTTAAGTTGTCAATAGATAAGTGTCCCTGTTTTGTGGCATAATATAACTGAATT
TCATGAGAAGATTTATTCCACCAGGGGTATTTCAGCTTTGAAACCAAATCTGTGTATCTAAT
ACTAACCAATCTGTTGGATGTGGATTTTAAAAAATGTTTGCTAAACTACCCAAGTAAGATTT
ACTGTATTAAATGGCCTTCGGGTCTGAAAAGCTTTTTTTAACCTCTTGCTTAAAAGCGTTTT
ATTTTGATAAGATACTTCAAATAGCCTCCAAAAGTGTAGATCCAATCACTTAAATAAACCTG
TATGTATATGCAAAAAAAAAAAAAAAAAAAAAAA
[0977] FIG. 14
MAGAIIENMSTKKLCIVGGILLVFQIIAFLVGGLIAPGPTTAVSYMSVKCVDARKNHHK- TKW
FVPWGPNHCDKIRDIEERAIPREIANDIVFSVHIPLPHMEMSPWFQFMLFILQLDIAFKLNN
QIRENAEVSMDVSLAYRDDAFAEWTEMAHERVPRKLKCTFTSPKTPEHEGRYYECDVLPFME
IGSVAHKFYLLNIRLPVNEKKKINVGIGEIKDIRLVGIHQNGGFTKVWFAMKTFLTPSIFII
MVWYWRRITMMSRPPVLLEKVIFALGISMTFINIPVEWFSIGFDWTWMLLFGDIRQGIFYAM
LLSFWIIFCGEHMMDQHERNHIAGYWKQVGPIAVGSFCLFIFDMCERGVQLTNPFYSIWTTD
IGTELAMAFIIVAGICLCLYFLFLCFMVFQVFRNISGKQSSLPAMSKVRRLHYEGLIFRFKF
LMLITLACAAMTVIFFIVSQVTEGHWKWGGVTVQVNSAFFTGIYGMWNLYVFALMFLYAPSH
KNYGEDQSNGDLGVHSGEELQLTTTITHVDGPTEIYKLTRKEAQE
[0978] Important features of the protein:
[0979] Signal peptide:
[0980] amino acids 1-42
[0981] Tranamembrane domains:
[0982] amino acids 239-253, 269-284, 302-318, 338-352, 377-399,
434-452, 471-488
[0983] N-glycosylation sites.
[0984] amino acids 8-12, 406-410
[0985] cAMP- and cGMP-dependent protein kinase phosphorylation
site.
[0986] amino acids 254-258
[0987] N-myristoylation sites.
[0988] amino acids 223-229, 274-280, 305-311, 358-364, 374-380,
386-392, 509-515
[0989] FIG. 15
GTGAGGGGAACAGCTGATCCGTCTGTTGGGAGGACAGATATCTCAAGGCCAGGATGGAA- GAA
TCACCACTAAGCCGGGCACCATCCCGTGGTGGAGTCAACTTTCTCAATGTAGCCCGGACCTA
CATCCCCAACACCAAGGTGGAATGTCACTACACCCTTCCCCCAGGCACCATGCCCAGTGCCA
GTGACTGGATTGGAATCTTCAAGGTGGAGGCTGCCTGTGTTCGGGATTACCACACATTTGTG
TGGTCTTCCGTGCCTGAAAGTACAACTGATGGTTCCCCCATTCQCQCCQGTGTCCQGTTCCG
AGCCAGCTACCTGCCCAAACCAGGAGCTCAGCTCTACCAGTTCCGATATGTGAACCGCCAGG
GCCAGGTGTGTGGGCAGAGCCCCCCTTTCCAGTTCCGAGAGCCAAGGCCCQTGGATGAACTG
GTGACCCTGGAGGAGGCTGATGGGGGCTCTGACATCCTGCTGGTTGTCCCCAAGGCAACTGT
GTTACAGAACCAGCTCGATGAGAGCCAGCAAGAACGGAATGACCTGATGCAGCTGAAGCTAC
AGCTGGAGGGACAGGTGACAGAGCTGAGGAGCCGAGTGCAGGAGCTCGAGAGGGCTCTGGCA
ACTGCCAGGCAGGAAGCAQCGGAGCTGATGGAACAGTACAAGGGGATTTCCCGGTCCCATGG
GGAGATCACAAGAGAGGGGAACATCCTGAGCCGGCAACAGGGAGACCATGTGGCACGCATCC
TGGAGCTAGAGGATGACATCCAGACCATCAGTGAGAAAGTGCTGACGAAGGAAGTGGAGCTG
GACAGGCTTAGAGACACAGTGAAGGCCCTGACTCGGGAACAAGAGAAGCTCCTTGGGCAACT
GAAAGAAGTACAAGGGAGGAGGAGCAAAAAGTGGGCTGAGCTCCAAGTGGCACAACAGGAGA
ACCATCACTTAAATTTGGACCTGAAGGAGGCGAAGAGCTGGCAAGAGGAGCAGAGTGCTCAG
GCTCAGCGACTGAAAGACAAGGTGGCCCAGATGAAGGACACCCTAGGCCAGGCCCAGCAGCG
GGTGGCCGAGCTGGAAGCCCTTGAAGGAGCAGCTTCGAGGGCCCAGGAGCTTGCAGCCTCAA
GCCAGCAGAAAGCCACCCTTCTTGGGGAGGAGTTGGCCAGTGCAGCAGCAGCCAGGGACCGC
ACCATAGCCGAAACTACCGCAGCCGCCTGGAAAGTGGCTGAAGTTAACGGCAGGCTGGCTGA
GCTCGGTTTGCACTTGAAGGAAGAAAAATGCCAATGGAGCAAGGAGCGGGCAGGCCTGCTGC
AGAGTGTGGAGGCAGAGAAGGACAAGATCCTGAAGCTGAGTGCAGAGATACTTCGATTGGAG
AAGGCAGTTCAGGAGGAGAGGACCCAAAACCAAGTGTTCAAGACTGAGCTGGCCCGGGAGAA
GGATTCTAGCCTGGTACAGTTGTCAGAAAGTAAGCGGGAGCTGACAGAGCTGCGGTCAGCCC
TGCGTGTGCTCCAGAAGGAAAAGGAGCAGTTACAGGAGGAGAAACAGGAATTGCTAGAGTAC
ATGAGAAAGCTAGAAGGCCCGCCTGGAAGAAGGTGGAGATGAGAAGTGGAATAGGATGCCAC
CACGAGGATGAGGAGGCCGCTGTGGGGCTGAAGCTGCCCGGCAGCTCTGACAGACTCAGAGG
ACGAGTCCCCAGAAGACATGAGGCTCCCACCCTATGGCCTTTGTGAGCGTGGAGACCCAGGC
TCCTCTCCTGCTGGGCCTCGAGAGGCTTCTCCCCTTGTTGTCATCAGCCAGCCGGCTCCCAT
TTCTCCTCACCTCTCTGGGCCAGCTGAGGACAGTAGCTCTGACTCGGAGGCTGAAGATGAGA
AGTCAGTCCTGATGGCAGCTGTGCAGAGTGaGGGTGAGGAGGCCAACTTACTGCTTCCTGAA
CTGGGCAGTGCCTTCTATGACATGGCCAGTGGCTTTACAGTGGGTACCCTGTCAGAAACCAG
CACTGGGGGCCCTGCCACCCCCACATGGAAGGAGTGTCCTATCTGTAAGGAGCGCTTTCCTG
CTGAGAGTGACAAGGATGCCCTGGAGGACCACATGAATGGACACTTCTTTTTCAGCACCCAG
GACCCCTTCACCTTTGAGTGATCTTACTCCCTCGTACATGCACAAATACACACTCATGCACA
CACACACTCACACACATGCATACACTTAGGTTTCATGCCCATTTTCTATCACACTGGGCTCC
ATGATATTCTGTTCCCTAAGAACTGCTTCTGTGTGCCCTGTTTTCATCCCAAGATTTCTCAC
TTCATCCTCTCCTACCTGGCTCTTTTGTCCCAGGGAGGGGTCCTGTTCGGAAGCAGTGGCTG
AATTTATCCCCTGAAAGTGGTTTTGGAGGAACCGGGATGGAGGAGGCCTTCCCCTGTGGGAA
TAGAATCGTCCACTCCTAGCCCTGGTTGCTTCTGATACACAGCCACTGCACACACACACTCA
CACTCACACTCCCTTGTCTGATGCCCCAAAGCCAATTCCTGGGGCACCCTACCCTCTCTTAT
TTGGAGTTTCCGTTGGTTTACCTGAGTTTTCTCTGGGGTCTGCACAGAGGCAGCAGCATGGA
CATCATGGCCTCTCAGGTCCCTTTTGGTTCTCAGTTTCATTGGTTCCTCTTTCTGTTCCCCC
ATTGACTTCTGTGCCCCACCCTAGCCTTTTCCATAACCTTAGGTATTCAGTTTGGAGGGGTT
TTTTGTATTTTTGAGGATTCCTGTATTCTGTATCCTCTCCTCGCATCTCCTCACATGGAAAG
AAATAATGTATTTGTGCCTTCTGTGAGGAATGGGGGGAACAAGTGGTCCCAGGTATCCCCAT
TTCCAAGGCCCCCCTCCCTCTCCAGGTCCCCCCACAGCAATAAAAGCTTCCCCCTGATATCC
ATCCCTTTGTAGTTTGAACAAATATATTTATATGATATGTAA
[0990] FIG. 16
MEESPLSRAPSRGGVNFLNVARTYIPNTKVECHYTLPPGTMPSASDWIGIFKVEAACVR- DYH
TFVWSSVPESTTDGSPIHTSVQFQASYLPKPGAQLYQFRYVNRQGQVCGQSPPFQFREPRPM
DELVTLEEADGGSDILLWVPKATVLQNQLDESQQERNDLMQLKLQLEGQVTELRSRVQELER
ALATARQEHTELMEQYKGISRSHGEITEERDILSRQQGDHVARILELEDDIQTISEKVLTKE
VELDRLRDTVKALTREQEKLLGQLKEVQADKEQSEAELQVAQQENHHLNLDLKEAKSWQEEQ
SAQAQRLKDKVAQMKDTLGQAQQRVAELEPLKEQLRGAQELAASSQQKATLLGEELASAAAA
RDRTIAELHRSRLEVAEVNGRLAELGLHLKEEKCQWSKERAGLLQSVEAEKDKILKLSAEIL
RLEKAVQEERTQNQVFKTELAREKDSSLVQLSESKRELTELRSALRVLQKEKEQLQEEKQEL
LEYMRKLEARLEKVADEKWNEDATTEDEEAAVGLSCPAALTDSEDESPEDMRLPPYGLCERG
DPGSSPAGPREASPLVVISQPAPISPHLSGPAEDSSSDSEAEDEKSVLMAAVQSGGEEANLL
LPELGSAFYDMASGFTVGTLSETSTGGPATPTWKECPICKERFPAESDKDALEDHMDGHFFF
STQDPFTFE
[0991] Iortant features:
[0992] Casein kinase II phosphorylation sites:
[0993] amino acids 28-31, 43-46, 68-71, 72-75, 129-132, 156-159,
208-211, 239-242, 282-285, 305-308, 376-379, 383-383, 468-471,
520-523, 521-524, 537-540, 539-542, 543-546, 593-596, 595-598,
597-600, 612-615, 639-642, 652-655, 667-670, 683-686
[0994] N-myristoylation sites:
[0995] amino acids 39-44, 107-112, 204-209, 414-419, 561-566,
613-618
[0996] Cell attachment sequence:
[0997] amino acids 557-559
[0998] Leucine zipper pattern seqence:
[0999] amino acids 163-184, 475-496, 482-503
Sequence CWU 0
0
* * * * *
References