U.S. patent application number 10/602220 was filed with the patent office on 2004-02-05 for production of lysosomal enzymes in plants by transient expression.
Invention is credited to Erwin, Robert L., Grill, Laurence K., Kumagai, Monto H., Pogue, Gregory P., Turpen, Thomas H..
Application Number | 20040023281 10/602220 |
Document ID | / |
Family ID | 24509050 |
Filed Date | 2004-02-05 |
United States Patent
Application |
20040023281 |
Kind Code |
A1 |
Turpen, Thomas H. ; et
al. |
February 5, 2004 |
Production of lysosomal enzymes in plants by transient
expression
Abstract
The invention relates to .alpha.-galactosidase truncated at the
carboxy terminus and the production of enzymatically active
recombinant human and animal lysosomal enzymes involving
construction and expression of recombinant expression constructs
comprising coding sequences of human or animal lysosomal enzymes in
a plant expression system. The plant expression system provides for
post-translational modification and processing to produce a
recombinant gene product exhibiting enzymatic activity. The
invention is demonstrated by working examples in which transgenic
tobacco plants express recombinant expression constructs comprising
human glucocerebrosidase nucleotide sequences. The invention is
also demonstrated by working examples in which transfected tobacco
plants express recombinant viral expression constructs comprising
human .alpha. galactosidase nucleotide sequences. The recombinant
lysosomal enzymes produced in accordance with the invention may be
used for a variety of purposes, including but not limited to enzyme
replacement therapy for the therapeutic treatment of human and
animal lysosomal storage diseases.
Inventors: |
Turpen, Thomas H.;
(Vacaville, CA) ; Kumagai, Monto H.; (Kailua,
HI) ; Pogue, Gregory P.; (Vacaville, CA) ;
Erwin, Robert L.; (Davis, CA) ; Grill, Laurence
K.; (Vacaville, CA) |
Correspondence
Address: |
LARGE SCALE BIOLOGY CORPORATION
3333 VACA VALLEY PARKWAY
SUITE 1000
VACAVILLE
CA
95688
US
|
Family ID: |
24509050 |
Appl. No.: |
10/602220 |
Filed: |
June 23, 2003 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
10602220 |
Jun 23, 2003 |
|
|
|
09993059 |
Nov 13, 2001 |
|
|
|
09993059 |
Nov 13, 2001 |
|
|
|
09626127 |
Jul 26, 2000 |
|
|
|
09626127 |
Jul 26, 2000 |
|
|
|
09316572 |
May 21, 1999 |
|
|
|
09316572 |
May 21, 1999 |
|
|
|
08324003 |
Oct 14, 1994 |
|
|
|
5977438 |
|
|
|
|
08324003 |
Oct 14, 1994 |
|
|
|
08176414 |
Dec 29, 1993 |
|
|
|
5811653 |
|
|
|
|
08176414 |
Dec 29, 1993 |
|
|
|
07997733 |
Dec 30, 1992 |
|
|
|
08324003 |
|
|
|
|
08184237 |
Jan 19, 1994 |
|
|
|
5589367 |
|
|
|
|
08184237 |
Jan 19, 1994 |
|
|
|
07923692 |
Jul 31, 1992 |
|
|
|
5316931 |
|
|
|
|
07923692 |
Jul 31, 1992 |
|
|
|
07600244 |
Oct 22, 1990 |
|
|
|
07600244 |
Oct 22, 1990 |
|
|
|
07310881 |
Feb 17, 1989 |
|
|
|
07310881 |
Feb 17, 1989 |
|
|
|
07160766 |
Feb 26, 1988 |
|
|
|
07310881 |
Feb 17, 1989 |
|
|
|
07160771 |
Feb 26, 1988 |
|
|
|
Current U.S.
Class: |
435/6.16 ;
435/208; 435/320.1; 435/419; 435/69.1; 536/23.2 |
Current CPC
Class: |
C12N 9/2465 20130101;
C12N 9/84 20130101; C12N 2770/32722 20130101; C12N 2770/00022
20130101; C12P 41/003 20130101; C07K 14/415 20130101; C12N 15/8203
20130101; C12N 15/8242 20130101; C12N 9/20 20130101; C12N 15/8257
20130101; C12N 9/14 20130101; C12Y 302/01022 20130101; C12N 9/1074
20130101; C12Y 114/18001 20130101; C12N 15/8289 20130101; C12N
9/0071 20130101; C12N 9/16 20130101; C07K 14/005 20130101; C12N
9/18 20130101; C12N 9/2402 20130101; C07K 2319/00 20130101; C12N
9/0059 20130101; C12Y 302/01045 20130101; C07K 14/445 20130101;
C12Y 302/01031 20130101; C12Y 304/21069 20130101; C12N 15/86
20130101; C12N 15/8216 20130101; C12N 9/6459 20130101; C12N 9/78
20130101 |
Class at
Publication: |
435/6 ; 435/69.1;
435/208; 435/320.1; 435/419; 536/23.2 |
International
Class: |
C12Q 001/68; C07H
021/04; C12N 009/40; C12P 021/02; C12N 005/04 |
Claims
We claim:
1. A polypeptide comprising the amino acid sequence of rGAL-12,
wherein the C-terminus of said polypeptide is the amino sequence
depicted in SEQ ID NO: 29
2. The polypeptide according to claim 1, wherein said polypeptide
is glycosylated at least at one amino acid position selected from
the group consisting of amino acid positions 108, 161, 184, and 337
relative to rGAL-12.
3. The polypeptide according to claim 1, wherein said polypeptide
is glycosylated at least at one amino acid position selected from
the group consisting of amino acid positions 108, 161, and 184
relative to rGAL-12.
4. The polypeptide according to claim 1, wherein said polypeptide
has a plant glycosylation pattern at amino acid positions 108, 161,
and 184 relative to rGAL-12, wherein an alpha 1, 3 fucose is
present on the proximal GlcNac.
5. The polypeptide according to claim 1, wherein said polypeptide
has a plant glycosylation pattern at amino acid positions 108, 161,
and 184 relative to rGAL-12, wherein an beta 1, 2 xylose is present
on a beta-linked mannose of the core.
6. A polynucleotide encoding the polypeptide according to claim
1.
7. The polypeptide according to claim 1, wherein said polypeptide
consists of the amino acid sequence of rGAL-12.
8. The polypeptide according to claim 7, wherein said polypeptide
is glycosylated at least at one amino acid position selected from
the group consisting of amino acid positions 108, 161, 184, and 337
relative to rGAL-12.
9. The polypeptide according to claim 7, wherein said polypeptide
is glycosylated at least at one amino acid position selected from
the group consisting of amino acid positions 108, 161, and 184
relative to rGAL-12.
10. The polypeptide according to claim 7, wherein said polypeptide
has a plant glycosylation pattern at amino acid positions 108, 161,
and 184 relative to rGAL-12, wherein an alpha 1, 3 fucose is
present on the proximal GlcNac.
11. The polypeptide according to claim 7 wherein said polypeptide
has a plant glycosylation pattern at amino acid positions 108, 161,
and 184 relative to rGAL-12, wherein an beta 1, 2 xylose is present
on a beta-linked mannose of the core.
12. A polynucleotide encoding the polypeptide according to claim
7.
13. A polypeptide comprising the amino acid sequence of rGAL-12R,
wherein the C-terminus of said polypeptide is the amino sequence
depicted in SEQ ID NO: 30.
14. The polypeptide according to claim 13, wherein said polypeptide
is glycosylated at least at one amino acid position selected from
the group consisting of amino acid positions 108, 161, 184, and 337
relative to rGAL-12R.
15. The polypeptide according to claim 13, wherein said polypeptide
is glycosylated at least at one amino acid position selected from
the group consisting of amino acid positions 108, 161, and 184
relative to rGAL-12R.
16. The polypeptide according to claim 13, wherein said polypeptide
has a plant glycosylation pattern at amino acid positions 108, 161,
and 184 relative to rGAL-12R, wherein an alpha 1, 3 fucose is
present on the proximal GlcNac.
17. The polypeptide according to claim 13, wherein said polypeptide
has a plant glycosylation pattern at amino acid positions 108, 161,
and 184 relative to rGAL-12R, wherein an beta 1, 2 xylose is
present on a beta-linked mannose of the core.
18. A polynucleotide encoding the polypeptide according to claim
13.
19. The polypeptide according to claim 13, wherein said polypeptide
consists of the amino acid sequence of rGAL-12R.
20. The polypeptide according to claim 19, wherein said polypeptide
is glycosylated at least at one amino acid position selected from
the group consisting of amino acid positions 108, 161, 184, and 337
relative to rGAL-12R.
21. The polypeptide according to claim 19, wherein said polypeptide
is glycosylated at least at one amino acid position selected from
the group consisting of amino acid positions 108, 161, and 184
relative to rGAL-12R.
22. The polypeptide according to claim 19, wherein said polypeptide
has a plant glycosylation pattern at amino acid positions 108, 161,
and 184 relative to rGAL-12R, wherein an alpha 1, 3 fucose is
present on the proximal GlcNac.
23. The polypeptide according to claim 19, wherein said polypeptide
has a plant glycosylation pattern at amino acid positions 108, 161,
and 184 relative to rGAL-12R, wherein an beta 1, 2 xylose is
present on a beta-linked mannose of the core.
24. A polynucleotide encoding the polypeptide according to claim
9.
25. The polypeptide according to claim 19, wherein said polypeptide
comprises the amino acid sequence of rGAL-25, wherein the
C-terminus of said polypeptide is the amino sequence depicted in
SEQ ID NO: 31.
26. The polypeptide according to claim 25, wherein said polypeptide
is glycosylated at least at one amino acid position selected from
the group consisting of amino acid positions 108, 161, 184, and 337
relative to rGAL-25.
27. The polypeptide according to claim 25, wherein said polypeptide
is glycosylated at least at one amino acid position selected from
the group consisting of amino acid positions 108, 161, and 184
relative to rGAL-25.
28. The polypeptide according to claim 25, wherein said polypeptide
has a plant glycosylation pattern at amino acid positions 108, 161,
and 184 relative to rGAL-25, wherein an alpha 1, 3 fucose is
present on the proximal GlcNac.
29. The polypeptide according to claim 25, wherein said polypeptide
has a plant glycosylation pattern at amino acid positions 108, 161,
and 184 relative to rGAL-25, wherein an beta 1, 2 xylose is present
on a beta-linked mannose of the core.
30. A polynucleotide encoding the polypeptide according to claim
25.
31. The polypeptide according to claim 25, wherein said polypeptide
consists of the amino acid sequence of rGAL-25.
32. The polypeptide according to claim 31, wherein said polypeptide
is glycosylated at least at one amino acid position selected from
the group consisting of amino acid positions 108, 161, 184, and 337
relative to rGAL-25.
33. The polypeptide according to claim 31, wherein said polypeptide
is glycosylated at least at one amino acid position selected from
the group consisting of amino acid positions 108, 161, and 184
relative to rGAL-25.
34. The polypeptide according to claim 31, wherein said polypeptide
has a plant glycosylation pattern at amino acid positions 108, 161,
and 184 relative to rGAL-25, wherein an alpha 1, 3 fucose is
present on the proximal GlcNac.
35. The polypeptide according to claim 31, wherein said polypeptide
has a plant glycosylation pattern at amino acid positions 108, 161,
and 184 relative to rGAL-25, wherein an beta 1, 2 xylose is present
on a beta-linked mannose of the core.
36. A polynucleotide encoding the polypeptide according to claim
31.
37. The polypeptide according to claim 19, wherein said polypeptide
comprises the amino acid sequence of rGAL-25R, wherein the
C-terminus of said polypeptide is the amino sequence depicted in
SEQ ID NO: 32.
38. The polypeptide according to claim 37, wherein said polypeptide
is glycosylated at least at one amino acid position selected from
the group consisting of amino acid positions 108, 161, 184, and 337
relative to rGAL-25R.
39. The polypeptide according to claim 37, wherein said polypeptide
is glycosylated at least at one amino acid position selected from
the group consisting of amino acid positions 108, 161, and 184
relative to rGAL-25R.
40. The polypeptide according to claim 37, wherein said polypeptide
has a plant glycosylation pattern at amino acid positions 108, 161,
and 184 relative to rGAL-25R, wherein an alpha 1, 3 fucose is
present on the proximal GlcNac.
41. The polypeptide according to claim 37, wherein said polypeptide
has a plant glycosylation pattern at amino acid positions 108, 161,
and 184 relative to rGAL-25R, wherein an beta 1, 2 xylose is
present on a beta-linked mannose of the core.
42. A polynucleotide encoding the polypeptide according to claim
37.
43. The polypeptide according to claim 37, wherein said polypeptide
consists of the amino acid sequence of rGAL-25R.
44. The polypeptide according to claim 43, wherein said polypeptide
is glycosylated at least at one amino acid position selected from
the group consisting of amino acid positions 108, 161, 184, and 337
relative to rGAL-25R.
45. The polypeptide according to claim 43, wherein said polypeptide
is glycosylated at least at one amino acid position selected from
the group consisting of amino acid positions 108, 161, and 184
relative to rGAL-25R.
46. The polypeptide according to claim 43, wherein said polypeptide
has a plant glycosylation pattern at amino acid positions 108, 161,
and 184 relative to rGAL-25R, wherein an alpha 1, 3 fucose is
present on the proximal GlcNac.
47. The polypeptide according to claim 43, wherein said polypeptide
has a plant glycosylation pattern at amino acid positions 108, 161,
and 184 relative to rGAL-25R, wherein an beta 1, 2 xylose is
present on a beta-linked mannose of the core.
48. A polynucleotide encoding the polypeptide according to claim
43.
Description
RELATED APPLICATIONS
[0001] The present application is a continuation of U.S. patent
application Ser. No. 09/993,059, filed Nov. 13, 2001, which is a
continuation-in-part of U.S. patent application Ser. No.
09/626,127, filed Jul. 26, 2000, which is a continuation-in-part of
U.S. patent application Ser. No. 09/316,572, filed May 21, 1999,
which is a continuation of application Ser. No. 08/324,003, filed
Oct. 14, 1994, now U.S. Pat. No. 5,977,438, which is a
continuation-in-part of application Ser. No. 08/176,414, filed on
Dec. 29, 1993, now U.S. Pat. No. 5,811,653, which is a
continuation-in-part of application Ser. No. 07/997,733, filed Dec.
30, 1992, now abandoned. application Ser. No. 08/324,003, filed
Oct. 14, 1994, now U.S. Pat. No. 5,977,438 is also a
continuation-in-part of application Ser. No. 08/184,237, filed Jan.
19, 1994, now U.S. Pat. No. 5,589,367, which is a
continuation-in-part of application Ser. No. 07/923,692, filed Jul.
31, 1992, now U.S. Pat. No. 5,316,931, which is a
continuation-in-part of applications Ser. No. 07/600,244, filed
Oct. 22, 1990, now abandoned, Ser. No. 07/641,617, filed Jan. 16,
1991, now abandoned, application Ser. No. 07/737,899, filed Jul.
26, 1991, now abandoned, and application Ser. No. 07/739,143, filed
Aug. 1, 1991, now abandoned. application Ser. No. 07/600,244 is a
continuation of application Ser. No. 07/310,881, filed Feb. 17,
1989, now abandoned, which is a continuation-in-part of
applications Ser. No. 07/160,766 and Ser. No. 07/160,771, both
filed on Feb. 26, 1988 and now abandoned. Application Ser. No.
07/641,617 is a continuation of application Ser. No. 07/347,637,
filed May 5, 1989, now abandoned. application Ser. No. 07/737,899
is a continuation of application Ser. No. 07/363,138, filed Jun. 8,
1989, now abandoned, which is a continuation-in-part of application
Ser. No. 07/219,279, filed Jul. 15, 1988, now abandoned.
Application Ser. No. 07/739,143 is a continuation-in-part of
applications Ser. No. 07/600,244, filed Oct. 22, 1990, now
abandoned, Ser. No. 07/641,617, filed Jan. 16, 1991, now abandoned,
and Ser. No. 07/737,899, filed Jul. 26, 1991, now abandoned.
FIELD OF THE INVENTION
[0002] This invention is in the field of therapeutic peptides.
Specifically this invention relates to the production of
pharmaceutical peptides and proteins encoded on a recombinant plant
virus or and produced by an infected plant or produced by a
recombinant plant. The present invention relates especially to the
production of human and animal lysosomal enzymes in plants
comprising expressing the genetic coding sequence of a human or
animal lysosomal enzyme in a plant expression system. The plant
expression system provides for post-translational modification and
processing to produce recombinant protein having enzymatic
activity. The invention is demonstrated herein by working examples
in which transgenic or transfected tobacco plants produce a
modified human .alpha. galactosidase and a glucocerebrosidase, both
of which are enzymatically active. The recombinant lysosomal
enzymes produced in accordance with the invention may be used for a
variety of purposes including but not limited to enzyme replacement
therapy for the therapeutic treatment of lysosomal storage
diseases, research for development of new approaches to medical
treatment of lysosomal storage diseases, and industrial processes
involving enzymatic substrate hydrolysis.
BACKGROUND OF THE INVENTION
[0003] Lysosomes, which are present in all animal cells, are acidic
cytoplasmic organelles that contain an assortment of hydrolytic
enzymes. These enzymes function in the degradation of internalized
and endogenous macromolecular substrates. When there is a lysosomal
enzyme deficiency, the deficient enzyme's undegraded substrates
gradually accumulate within the lysosomes causing a progressive
increase in the size and number of these organelles within the
cell. This accumulation within the cell eventually leads to
malfunction of the organ and to the gross pathology of a lysosomal
storage disease, with the particular disease depending on the
particular enzyme deficiency. More than thirty distinct, inherited
lysosomal storage diseases have been characterized in humans.
Enzyme Replacement Therapy
[0004] One proven treatment for lysosomal storage diseases is
enzyme replacement therapy in which an active form of the enzyme is
administered directly to the patient. However, abundant,
inexpensive and safe supplies of therapeutic lysosomal enzymes are
not commercially available for the treatment of any of the
lysosomal storage diseases. There are a large number of metabolic
storage disorders known to affect man. As a group, these diseases
are the most prevalent genetic abnormalities of humans, yet
individually they are quite rare. One of the three major classes of
these conditions, comprising the majority of patients, is the
sphingolipidoses in which excessive quantities of undegraded fatty
components of cell membranes accumulate because of inherited
deficiencies of specific catabolic enzymes. Principal disorders in
this category are Gaucher disease, Niemann-Pick disease, Fabry
disease, and Tay-Sachs disease. All of these disorders are caused
by harmful mutations in the genes that code for specific
housekeeping enzymes within lysosomes. Thus, to be effective,
enzyme replacement therapy requires that the requisite exogenous
enzyme be taken up by the cells in which the materials are
catabolized and that they be incorporated into lysosomes within
these cells. Fabry disease is an ideal candidate for enzyme
replacement therapy because the disease does not involve the
central nervous system. The therapeutic enzyme does not need to be
delivered across the blood-brain barrier (1, 2).
[0005] The effectiveness of enzyme replacement therapy has been
dramatically documented in the treatment of patients with Gaucher
disease. This condition is the most frequent of all metabolic
storage disorders. It is estimated that there are 15,000 patients
with this condition in the United States and about 80,000
worldwide. Soon after the enzymatic defect in Gaucher disease was
established, consideration was given to the possibility of treating
patients with purified .alpha.-glucocerebrosidase (3). Dr. Brady
elected to use human placental tissue as the source of enzyme in
order to minimize sensitizing patients to the exogenous protein.
Initial studies with small amounts of glucocerebrosidase injected
intravenously into patients with Gaucher disease revealed that the
exogenous enzyme reduced the quantity of accumulated
glucocerebroside in the liver and in the blood (4). A large-scale
enzyme purification procedure was developed in order to obtain
sufficient quantities for clinical efficacy trials (5). It was then
learned that modifications of the terminal sugars on
oligosaccharide chains of the enzyme were necessary in order to
target intravenously administered enzyme to macrophages where most
of the glucocerebroside is stored. Targeting to macrophages was
accomplished by sequential enzymatic removal of monosaccharide
residues from glucocerebrosidase resulting in mannose-terminal
glucocerebrosidase (6). Administration of this glycoform of
glucocerebrosidase to patients has brought about immense
improvement in their condition (7-10). The modified enzyme
(alglucerase) is now produced commercially by Genzyme Corporation
in Cambridge, Mass., under the trade name Ceredase.TM.. The
beneficial effects of this treatment have been universally
confirmed (11-13). Production of recombinant glucocerebrosidase
(imiglucerase) is underway in Chinese hamster ovary (CHO) cells,
and the product (Cerezyme.TM.) is as effective as placental
glucocerebrosidase (14). The experience with Gaucher treatment
validates enzyme replacement therapy with a product that requires
post-translational modifications.
[0006] Fabry disease is caused by deficiencies in the catalytic
activity of the lysosomal enzyme .alpha. galactosidase A (Gal-A).
Human Gal-A is a glycoprotein homodimer with a molecular weight of
approximately 101 kDa containing 5-15% Asn-linked carbohydrate. The
enzyme contains approximately equal portions of high mannose and
complex type glycans. Upon isoelectric focusing, many forms of the
enzyme are observed due to differences in sialylation depending on
the source of the protein (tissue or plasma forms). The disease is
inherited as an X-linked recessive trait. A number of specific
mutations in the gene have been characterized, including partial
rearrangements, splice-junction defects and point mutations. Most
of these mutations are private and therefore, the gene appears to
be highly mutable relative to genes encoding other housekeeping
enzymes. Defects result in the accumulation of glycosphingolipid
substrates, globotriaosylceramide and related glycolipids with
terminal .alpha.-galactosidic linkages. Uncatabolized substrate
accumulates in the plasma, vascular endothelium and various organs
leading to an early demise from vascular disease of the heart,
brain, and kidney, particularly in the classically affected
hemizygous males. In addition to systemic disease, affected
individuals often suffer from peripheral neuropathies and have
characteristic angiokeratoma of the skin. Heterozygous female
carriers may have a more attenuated range of disease phenotypes
(1,2).
[0007] Exploratory trials of enzyme replacement therapy for Fabry
disease have demonstrated the biochemical effectiveness of this
approach (15-18). Repeated injections of purified splenic and
plasma Gal-A reduced the level of plasma substrate and may have
mobilized stored tissue substrate into circulation. No
immunological complications were apparent in repeated infusions of
enzyme into hemizygous males. Further investigations have not been
attempted because of the great difficulty in obtaining sufficient
quantities of enzyme for a meaningful replacement trial. The
availability of large quantities of enzyme would enable
optimization of glycoforms for therapeutic efficacy by improving
cell targeting and prolonging the half-life in circulation and
target organs.
.alpha. Galactosidase
[0008] In the early 1970's, several investigators demonstrated the
existence of two ..alpha..-Galactosidase isozymes designated A and
B, which hydrolyzed the .alpha.-galactosidic linkages in
4-MU-and/or rho-NP-.alpha.-D-galactopyranosides (62, 63, 64, 65,
66, 67, 68, 69) In tissues, about 80%-90% of total
.alpha.-Galactosidase (.alpha.-Gal) activity was due to a
thermolabile, myoinositol-inhibitable .alpha.-Gal A isozyme, while
a relatively thermostable, .alpha.-Gal B, accounted for the
remainder. The two "isozymes" were separable by electrophoresis,
isoelectric focusing, and ion exchange chromatography. After
neuraminidase treatment, the electrophoretic migrations and pI
value of .alpha.-Gal A and B were similar (70), initially
suggesting that the two enzymes were the differentially
glycosylated products of the same gene. The finding that the
purified glycoprotein enzymes had similar physical properties
including subunit molecular weight (about 46 kDa), homodimeric
structures, and amino acid compositions also indicated their
structural relatedness (70. 71. 72. 73. 74. 75. 76. 77). However,
the subsequent demonstration that polyclonal antibodies against
.alpha.-Gal A or B did not cross-react with the other enzyme (78,
79) that only .alpha.-Gal A activity was deficient in hemizygotes
with Fabry disease (80, 81, 82, 83, 84, 85, 86) and that the genes
for .alpha.-Gal A and B mapped to different chromosomes (Desnick,
et al., 1989, in The Metabolic Basis of Inherited Disease, Scriver,
C. R., Beaudet, A. L. Sly, W. S. and Valle, D., eds, pp. 1751-1796,
McGraw Hill, N.Y.; deGroot, et al., 1978, Hum. Genet. 44:305-312),
clearly demonstrated that these enzymes were genetically
distinct.
.alpha.-GAL A AND FABRY DISEASE
[0009] In Fabry disease, a lysosomal storage disease resulting from
the deficient activity of .alpha.-Gal A, identification of the
enzymatic defect in 1967 (Brady, et al., 1967, N. Eng. J. Med.
276:1163) led to the first in vitro (Dawson, et al., 1973, Pediat.
Res. 7: 694-690m) and in vivo (Mapes, et al., 1970, Science
169:987) therapeutic trials of .alpha.-Gal A replacement in 1969
and 1970, respectively. These and subsequent trials (Mapes, et al.,
1970, Science 169:987; Desnick, et al., 1979, Proc. Natl. Acad.
Sci. USA 76: 5326; and, Brady, et al., 1973, N. Engl. J. Med. 289:
9) demonstrated the biochemical effectiveness of direct enzyme
replacement for this disease. Repeated injections of purified
splenic and plasma .alpha.-Gal A (100,000 U/injection) were
administered to affected hemizygotes over a four month period
(Desnick, et al., 1979, Proc. Natl. Acad. Sci. USA 76:5326). The
results of these studies demonstrated that (a) the plasma clearance
of the splenic form was 7 times faster than that of the plasma form
(10 min vs 70 min); (b) compared to the splenic form of the enzyme,
the plasma form effected a 25-fold greater depletion of plasma
substrate over a markedly longer period (48 hours vs 1 hour); (c)
there was no evidence of an immunologic response to six doses of
either form, administered intravenously over a four month period to
two affected hemizygotes; and (d) suggestive evidence was obtained
indicating that stored tissue substrate was mobilized into the
circulation following depletion by the plasma form, but not by the
splenic form of the enzyme. Thus, the administered enzyme not only
depleted the substrate from the circulation (a major site of
accumulation), but also possibly mobilized the previously stored
substrate from other depots into the circulation for subsequent
clearance. These studies indicated the potential for eliminating,
or significantly reducing, the pathological glycolipid storage by
repeated enzyme replacement. However, the biochemical and clinical
effectiveness of enzyme replacement in Fabry disease has not been
commercially available due to the lack of sufficient human enzyme
for adequate doses and longterm evaluation.
THE .alpha.-Gal A ENZYME
[0010] The .alpha.-Gal A human enzyme has a molecular weight of
approximately 101,000 Da. On SDS gel electrophoresis it migrates as
a single band of approximately 49,000 Da indicating the enzyme is a
homodimer (Bishop & Desnick, 1981, J. Biol. Chem. 256: 1307).
.alpha.-Gal A is synthesized as a 50,500 Da precursor containing
phosphorylated endoglycosidase H sensitive oligosaccharides. This
precursor is processed to a mature form of about 46,000 Da within
3-7 days after its synthesis. The intermediates of this processing
have not been defined (Lemansky, et al., 1987, J. Biol. Chem.
262:2062). As with many lysosomal enzymes, ..alpha..-Gal A is
targeted to the lysosome via the mannose-6-phosphate receptor. This
is evidenced by the high secretion rate of this enzyme in
mucolipidosis II cells and in fibroblasts treated with NH.sub.4
Cl.
[0011] The enzyme has been shown to contain 5-15% Asn linked
carbohydrate (Ledonne, et al., 1983, Arch. Biochem. Biophys.
224:186). The tissue form of this enzyme was shown to have about
52% high mannose and 48% complex type oligosaccharides. The high
mannose type coeluted, on Bio-gel chromatography, with Man.sub.8-9
GlcNAc while the complex type oligosaccharides were of two
categories containing 14 and 19-39 glucose units. Upon isoelectric
focusing many forms of this enzyme are observed depending on the
sources of the purified enzyme (tissue vs plasma form). However,
upon treatment with neuraminidase, a single band is observed
(pI-5.1) indicating that this heterogeneity is due to different
degrees of sialylation (Bishop & Desnick, 1981, J. Biol. Chem.
256:1307). Initial efforts to express the full-length cDNA encoding
.alpha.-Gal A involved using various prokaryotic expression vectors
(Hantzopoulos and Calhoun, 1987, Gene 57:159; Ioannou, 1990, Ph.D.
Thesis, City University of New York). Although microbial expression
was achieved, as evidenced by enzyme assays of intact E. coli cells
and growth on melibiose as the carbon source, the human protein was
expressed at low levels and could not be purified from the
bacteria. These results indicate that the recombinant enzyme was
unstable due to the lack of normal glycosylation and/or the
presence of endogenous cytoplasmic or periplasmic proteases.
Gaucher Disease and Treatment
[0012] Gaucher disease is the most common lysosomal storage disease
in humans, with the highest frequency encountered in the Ashkenazi
Jewish population. About 5,000 to 10,000 people in the United
States are afflicted with this disease (Grabowski, 1993, Adv. Hum.
Genet. 21:377-441). Gaucher disease results from a deficiency in
glucocerebrosidase (hGCB); glucosylceramidase; acid
.beta.-glucosidase; EC 3.2.1.45). This deficiency leads to an
accumulation of the enzyme's substrate, glucocerebroside, in
reticuloendothelial cells of the bone marrow, spleen and liver,
resulting in significant skeletal complications such as bone marrow
expansion and bone deterioration, and also hypersplenism,
hepatomegaly, thrombocytopenia, anemia and lung complications
(Grabowski, 1993, supra; Lee, 1982, Prog. Clin. Biol. Res.
95:177-217; Brady et al., 1965, Biochem. Biophys. Res. Comm.
18:221-225). hGCB replacement therapy has revolutionized the
medical care and management of Gaucher disease, leading to
significant improvement in the quality of life of many Gaucher
patients (Pastores et al., 1993, Blood 82:408-416; Fallet et al.,
1992, Pediatr. Res. 31:496-502). Studies have shown that regular,
intravenous administration of specifically modified hGCB
(Ceredase..TM.., Genzyme Corp.) can result in dramatic improvements
and even reversals in the hepatic, splenic and hematologic
manifestations of the disease (Pastores et al., 1993, supra;
Fallet: et al., 1992, supra; Figueroa et al., 1992, N. Eng. J. Med
327:1632-1636; Barton et al., 1991, N. Eng. J. Med. 324:1464-1470;
Beutler et al., 1991, Blood 78:1183-1189). Improvements in
associated skeletal and lung complications are possible, but
require larger doses of enzyme over longer periods of time.
[0013] Despite the benefits of hGCB replacement therapy, the source
and high cost of the enzyme seriously restricts its availability.
Until recently, the only commercial source of purified hGCB has
been from pooled human placentae, where ten to twenty kilograms
(kg) of placentae yield only 1 milligram (mg) of enzyme. From five
hundred to two thousand kilograms of placenta (equivalent to
2,000-8,000 placentae) are required to treat each patient every two
weeks. Current costs for hGCB replacement therapy range from $55 to
$220/kg patient body weight every two weeks, or from $70,000 to
$300,000/year for a 50 kg patient. Since the need for therapy
essentially lasts for the duration of a patient's life, costs for
the enzyme alone may exceed $15,000,000 during 30 to 70 years of
therapy.
[0014] A second major problem associated with treating Gaucher
patients with glucocerebrosidase isolated from human tissue (and
perhaps even from other animal tissues) is the risk of exposing
patients to infectious agents which may be present in the pooled
placentae, e.g., human immuno-deficiency virus (HIV), hepatitis
viruses, and others.
[0015] Accordingly, a new source of hGCB is needed to effectively
reduce the cost of treatment and to eliminate the risk of exposing
Gaucher patients to infectious agents.
Hurler Syndrome and Treatment
[0016] Hurler syndrome is the most common of the group of human
lysosomal storage disorders known as the mucopolysaccharidosis
(MPS) involving an inability to degrade dermatan sulfate and
heparan sulfate. Hurler patients are deficient in the lysosomal
enzyme, .alpha.-L-iduronidase (IDUA), and the resulting
accumulation of glucosaminoglycans in the lysosomes of affected
cells leads to a variety of clinical manifestations (Neufeld &
Ash well, 1980, The Biochemistry of Glycoproteins and
Proteoglycans, ed. W. J. Lennarz, Plenum Press, N.Y.; pp. 241-266)
including developmental delay, enlargement of the liver and spleen,
skeletal abnormalities, mental retardation, coarsened facial
features, corneal clouding, and respiratory and cardiovascular
involvement. Hurler/Scheie syndrome (MPS I H/S) and Scheie syndrome
(MPS IS) represent less severe forms of the disorder but also
involve deficiencies in IDUA. Molecular studies on the genes and
cDNAs of MPS I patients has led to an emerging understanding of
genotype and clinical phenotype (Scott et al., 1990, Am. J. Hum.
Genet. 47:802-807). In addition, both a canine and feline form of
MPS I have been characterized (Haskins et al., 1979, Pediat. Res.
13:1294-1297; Haskins and Kakkis, 1995, Am. J. Hum. Genet. 57:A39
Abstr. 194; Shull et al., 1994, Proc. Natl. Acad. Sci. USA,
91:12937-12941) providing an effective in vivo model for testing
therapeutic approaches.
[0017] The efficacy of enzyme replacement in the canine model of
Hurler syndrome using human IDUA generated in CHO cells was
recently reported (Kakkis et al., 1995, Am. J. Hum. Genet. 57:A39
(Abstr.); Shull et al., 1994, supra). Weekly doses of approximately
1 mg administered over a period of 3 months resulted in normal
levels of the enzyme in liver and spleen, lower but significant
levels in kidney and Lungs and very low levels in brain, heart,
cartilage and cornea (Shull et al., 1994, supra. Tissue
examinations showed normalization of lysosomal storage in the
liver, spleen and kidney, but no improvement in heart, brain and
corneal tissues. One dog was maintained on treatment for 13 months
and was clearly more active with improvement in skeletal
deformities, joint stiffness, corneal clouding and weight gain
(Kakkis et al., 1995, supra. A single higher-dose experiment was
quite promising and showed detectable IDUA activity in the brain
and cartilage in addition to tissues which previously showed
activity at the lower does. Additional higher-dose experiments and
trials involving longer administration are currently limited by
availability of recombinant enzyme. These experiments underscore
the potential of replacement therapy for Hurler patients and the
severe constraints on both canine and human trials due to
limitations in recombinant enzyme production using current
technologies.
LYSOSOMAL ENZYMES: BIOSYNTHESIS AND TARGETING
[0018] Lysosomal enzymes are synthesized on membrane-bound
polysomes in the rough endoplasmic reticulum. Each protein is
synthesized as a larger precursor containing a hydrophobic amino
terminal signal peptide. This peptide interacts with a signal
recognition particle, an 11S ribonucleoprotein, and thereby
initiates the vectoral transport of the nascent protein across the
endoplasmic reticulum membrane into the lumen (Erickson, et al.,
1981, J. Biol. Chem. 256:11224; Erickson, et al., 1983, Biochem.
Biophys. Res. Commun. 115:275; Rosenfeld, et al., 1982, J. Cell
Biol. 93:135). Lysosomal enzymes are cotranslationally glycosylated
by the en bloc transfer of a large preformed oligosaccharide,
glucose-3, mannose-9, N-acetylglucosamine-2, from a lipid-linked
intermediate to the Asn residue of a consensus sequence
Asn-X-Ser/Thr in the nascent polypeptide (Komfeld, R. &
Komfeld, S., 1985, Annu. Rev. Biochem. 54:631). In the endoplasmic
reticulum, the signal peptide is cleaved, and the processing of the
Asn-linked oligosaccharide begins by the excision of three glucose
residues and one mannose from the oligosaccharide chain.
[0019] The proteins move via vesicular transport, to the Golgi
stack where they undergo a variety of posttranslational
modifications, and are sorted for proper targeting to specific
destinations: lysosomes, secretion, plasma membrane. During
movement through the Golgi, the oligosaccharide chain on secretory
and membrane glycoproteins is processed to the sialic
acid-containing complex-type. While some of the oligosaccharide
chains on lysosomal enzymes undergo similar processing, most
undergo a different series of modifications. The most important
modification is the acquisition of phosphomannosyl residues which
serve as an essential component in the process of targeting these
enzymes to the lysosome (Kaplan, et al., 1977, Proc. Natl. Acad.
Sci. USA 74:2026). This recognition marker is generated by the
sequential action of two Golgi enzymes. First,
N-acetylglucosaminyl-phosphotransferase transfers
N-acetylglucosamine-1-phosphate from the nucleotide sugar uridine
diphosphate-N-acetylglucosamine to selected mannose residues on
lysosomal enzymes to give rise to a phosphodiester intermediate
(Reitman & Komfeld, 1981, J. Biol. Chem. 256:4275; Waheed, et
al., 1982, J. Biol. Chem. 257:12322). Then,
N-acetylglucosamine-1-phosphodiester
.alpha.-N-acetylglucosaminidase removes N-acetylglucosamine residue
to expose the recognition signal, mannose-6-phosphate (Varki &
Kornfeld, 1981, J. Biol. Chem. 256: 9937; Waheed, et al., 1981, J.
Biol. Chem. 256:5717).
[0020] Following the generation of the phosphomannosyl residues,
the lysosomal enzymes bind to mannose-6-phosphate (M-6-P) receptors
in the Golgi. In this way the lysosomal enzymes remain
intracellular and segregate from the proteins which are destined
for secretion. The ligand-receptor complex then exits the Golgi via
a coated vesicle and is delivered to a prelysosomal staging area
where dissociation of the ligand occurs by acidification of the
compartment (Gonzalez-Noriega, et al., 1980, J. Cell Biol. 85:
839). The receptor recycles back to the Golgi while the lysosomal
enzymes are packaged into vesicles to form primary lysosomes.
Approximately, 5-20% of the lysosomal enzymes do not traffic to the
lysosomes and are secreted presumably, by default. A portion of
these secreted enzymes may be recaptured by the M-6-P receptor
found on the cell surface and be internalized and delivered to the
lysosomes (Willingham, et al., 1981, Proc. Natl. Acad. Sci. USA
78:6967).
[0021] Two mannose-6-phosphate receptors have been identified. A
215 kDa glycoprotein has been purified from a variety of tissues
(Sahagian, et al., 1981, Proc. Natl. Acad. Sci. USA, 78:4289;
Steiner & Rome, 1982, Arch. Biochem. Biophys. 214:681). The
binding of this receptor is divalent cation independent. A second
M-6-P receptor also has been isolated which differs from the 215
kDa receptor in that it has a requirement for divalent cations.
Therefore, this receptor is called the cation-dependent
(M-6-P.sup.CD) while the 215 kDa one is called cation-independent
(M-6-P.sup.CI). The M-6-P.sup.CD receptor appears to be an oligomer
with three subunits with a subunit molecular weight of 46 kDa.
Biosynthesis of Lysosomal Enzymes
[0022] Although many lysosomal enzymes are soluble and are
transported to lysosomes by M-6-P receptors (MPR), integral
membrane and membrane-associated proteins such as human
glucocerebrosidase (hGCB) are targeted and transported to lysosomes
independent of the M-6-P/MPR system (Kornfeld & Mellman, 1989,
Erickson et al., 1985). hGCB does not become soluble after
translation, but instead becomes associated with the lysosomal
membrane by means which have not been elucidated (von Figura &
Hasilik, 1986, Annu. Rev. Biochem. 55:167-193; Kornfeld and
Mellman, 1989, Annu. Rev. Cell Biol. 5:483-525). hGCB is
synthesized as a single polypeptide (58 kDa) with a signal sequence
(2 kDa) at the amino terminus. The signal sequence is
co-translationally cleaved and the enzyme is glycosylated with a
heterogeneous group of both complex and high-mannose
oligosaccharides to form a precursor. The glycans are predominately
involved in protein conformation. The "high mannose" precursor,
which has a molecular weight of 63 KDa, is post-translationally
processed in the Golgi to a 66 KDa intermediate, which is then
further modified in the lysosome to the mature enzyme having a
molecular weight of 59 KDa (Jonsson et al., 1987, Eur. J. Biochem.
164:171; Erickson et al., 1985, J. Biol. Chem., 260:14319).
[0023] The mature hGCB polypeptide is composed of 497 amino acids
and contains five N-glycosylation amino acid consensus sequences
(Asn-X-Ser/Thr). Four of these sites are normally glycosylated.
Glycosylation of the first site is essential for the production of
active protein. Both high-mannose and complex oligosaccharide
chains have been identified (Berg-Fussman et al., 1993, J. Biol.
Chem. 268:14861-14866). hGCB from placenta contains 7%
carbohydrate, 20% of which is of the high-mannose type (Grace &
Grabowski, 1990, Biochem. Biophys. Res. Comm. 168:771-777).
Treatment of placental hGCB with neuraminidase (yielding an asialo
enzyme) results in increased clearance and uptake rates by rat
liver cells with a concomitant increase in hepatic enzymatic
activity (Furbish et al., 1981, Biochim. Biophys. Acta
673:425-434). This glycan-modified placental hGCB is currently used
as a therapeutic agent in the treatment of Gaucher's disease.
Biochemical and site-directed mutagenesis studies have provided an
initial map of regions and residues important to folding, activator
interaction, and active site location (Grace et al., 1994, J. Biol.
Chem. 269:2283-2291).
[0024] The complete complementary DNA (cDNA) sequence for hGCB has
been published (Tsuji et al., 1986, J. Biol. Chem. 261:50-53; Sorge
et al., 1985, Proc. Natl. Acad. Sci. USA 82:7289-7293), and E. coli
containing the hGCB cDNA sequence cloned from fibroblast cells, as
described (Sorge et al., 1985, supra), is available from the
American Type Culture Collection (ATCC) (Accession No. 65696).
[0025] Recombinant methodologies have the potential to provide a
safer and less expensive source of lysosomal enzymes for
replacement therapy. However, production of active enzymes, e.g.,
hGCB, in a heterologous system requires correct targeting to the
ER, and appropriate N-linked glycosylation at levels or
efficiencies that avoid ER-based degradation or aggregation. Since
mature lysosomal enzymes must be glycosylated to be active,
bacterial systems cannot be used. For example, hGCB expressed in E.
coli is enzymatically inactive (Grace & Grabowski, 1990,
supra).
[0026] Active monomers of hGCB have been purified from insect cells
(Sf9 cells) and Chinese hamster ovary (CHO) cells infected or
transfected, respectively, with hGCB cDNA (Grace & Grabowski,
1990, supra; Grabowski et al., 1989, Enzyme 41:131-142). A method
for producing recombinant hGCB in CHO cell cultures and in insect
cell cultures was recently disclosed in U.S. Pat. No. 5,236,838.
Recombinant hGCB produced in these heterologous systems had an
apparent molecular weight ranging from 64 to 73 kDa and contained
from 5 to 15% carbohydrate (Grace & Grabowski, 1990, supra;
Grace et al., 1990, J. Biol. Chem. 265:6827-6835). These
recombinant hGCBs had kinetic properties identical to the natural
enzyme isolated from human placentae, as based on analyses using a
series of substrate and transition state analogues,
negatively-charged lipid activators, protein activators (saposin
C), and mechanism-based covalent inhibitors (Grace et al., 1994,
supra; Berg-Fussman et al., 1993, supra; Grace et al., 1990, J.
Biol. Chem. 265:6827-6835; Grabowski et al., 1989, supra). However,
both insect cells and CHO cells retained most of the enzyme rather
than secreting it into the medium, significantly increasing the
difficulty and cost of harvesting the pure enzyme (Grabowski et
al., 1989, supra). Accordingly, a recombinant system is needed that
can produce human or animal lysosomal enzymes in an active form at
lower cost, and that will be appropriately targeted for ease of
recovery.
Enormous Costs of Pharmaceutical Enzyme Production
[0027] While the clinical treatment of Gaucher patients provides a
dramatically successful example of an effective therapy, the
expense underscores an equally inadequate production technology.
For example, the present cost for the first year of treatment for a
severely affected 70 kg patient with Gaucher disease can reach
$382,000. If the patient's clinical parameters are not restored to
normal in that time, treatment at this level of expense will be
prolonged before dose reduction can be initiated. Even with dose
reduction, it is likely that the maintenance cost for such an
individual will be in the range of $135,000 per year (at $3.70/IU).
Many patients are unable to pay this large cost, and health
carriers are extremely reluctant to underwrite this treatment for
the life of these patients. Cerezyme.TM. is as expensive as
Ceredase.TM. and at this time is available only in limited
quantities. The number of patients with Gaucher disease in the US
currently receiving therapy is estimated to be only 10-15% of the
total. According an article in Nature Medicine, since the
introduction of this therapy six years ago the cost of treating
Gaucher patients worldwide will soon approach one billion dollars
(19). Although the total number of patients worldwide who would
benefit from therapy is not known with any certainty, it is safe to
assume that at least 80% of the world Gaucher population remain
untreated. To quote from the NIH Technology Assessment Conference
Summary Statement, Feb. 27-Mar. 1, 1995. "As a prototype for all
rare diseases, the plight of patients with Gaucher disease raises
difficult financial and ethical issues, which we as a society must
address (20)." Fabry disease is estimated to occur at a frequency
of 1 in 40,000. Over 400 hemizygous male patients have been
clinically described. It is imperative that fundamentally new
methods of enzyme production be developed to reduce these costs so
that all who suffer from these rare disorders can be treated.
Mammalian Lysosomes Versus Plant Vacuoles
[0028] Because plants are eukaryotes, plant expression systems have
advantages over prokaryotic expression systems, particularly with
respect to correct processing of eukaryotic gene products. However,
unlike animal cells, plant cells do not possess lysosomes. Although
the plant vacuole appears finctionally analogous to the lysosome,
plants do not contain MPRs (Chrispeels, 1991, Ann. Rev. Pl. Phys.
Pl. Mol. Biol. 42:21-53; Chrispeels and Tague, 1991, Intl. Rev.
Cytol. 125:1-45), and the mechanisms of vacuolar targeting can
differ significantly from those of lysosomal targeting. For
example, the predominant mechanism of vacuolar targeting in plants
does not appear to be glycan-dependent, but appears to be based
instead on C- or N-terminal peptide sequences (Gomez &
Chrispeels, 1993, Plant Cell 5:1113-1124; Chrispeels & Raikhal,
1992, Cell 68:613-618; Holwerda et al., 1992, Plant Cell 4:307-318;
Neuhaus et al., 1991, Proc. Natl. Acad. Sci. USA 88:10362-10366;
Chrispeels, 1991, supra; Chrispeels & Tague, 1991, supra;
Holwerda et al., 1990, Plant Cell 2:1091-1106; Voelker et al.,
1989, Plant Cell 1:95-104). As a result, plants have not been
viewed as appropriate expression systems for lysosomal enzymes
which must be appropriately processed to produce an active
product.
[0029] An object of this invention is to provide the existing
patient population with enough active enzyme to develop a lower
cost treatment. The enzymatic, structural, and glycan compositional
analyses show rGal to be active. There are recent advances in
glycoprotein modification and drug delivery that allow, as
examples, the chemical conjugation of peptides to carbohydrate, the
covalent addition of polyethylene glycol to enzymes and the
liposomal encapsulation of protein. Many additional new concepts
can be tested to increase the half-life of enzymes in circulation
and optimize cellular and subcellular targeting. Ideally, these
modifications will require a facile and rapid genetic system to
produce large quantities of highly pure enzyme and an effective
animal disease model for drug development. Our lab-scale process
appears highly scalable and is capable of producing grams of enzyme
per month in existing indoor greenhouse growth areas.
[0030] Using a viral transfection system and transgenic plants, we
have expressed enzymes in plants that have potential as therapeutic
agents for humans with the metabolic storage disorders known as
Fabry disease and Gaucher disease. High specific activity
recombinant enzymes were secreted by tobacco leaf cells via a
default pathway of protein sorting into the apoplastic compartment,
a network of extracellular space, cell wall matrix materials and
intercellular fluid (IF). We further developed a novel
bioprocessing method to purify these enzymes from the IF
fraction.
[0031] Another object of this invention is to provide an optimized
preproenzyme amino acid (AA) sequence for secretion of highly
active lysosomal enzymes. Another object of this invention is to
provide an optimized purification of lysosomal enzymes from either
the IF fraction or from whole plant homogenates. Another object of
this invention is to provide a molecular characterization of the
enzymes purified by this process, including determination of enzyme
specific activity.
SUMMARY OF THE INVENTION
[0032] The present invention provides for a polypeptide comprising
(a) the complete, or a fragment of, the amino acid sequence of
.alpha.-galactosidase with or without (b) an ER-retention signal,
such as the amino acid sequence SEKDEL (SEQ ID NO:37), wherein the
ER-retention signal is at the carboxy end of the complete, or a
fragment of, the amino acid sequence of .alpha.-galactosidase,
wherein said fragment of the amino acid sequence of
.alpha.-galactosidase comprises a deletion of at the carboxy end of
.alpha.-galactosidase, wherein said deletion is one to twenty-five
amino acids. The present invention also provides for a
polynucleotide encoding the aforementioned polypeptide.
[0033] The present invention also relates to the production of
these human or animal lysosomal enzymes, including the
aforementioned polypeptides, in transformed or transfected plants,
plant cells or plant tissues, and involves constructing and
expressing recombinant expression constructs comprising lysosomal
enzyme coding sequences in a plant expression system. The plant
expression system provides appropriate co-translational and
post-translational modifications of the nascent peptide required
for processing, e.g., signal sequence cleavage, glycosylation, and
sorting of the expression product so that an enzymatically active
protein is produced. Using the methods described herein,
recombinant lysosomal enzymes are produced in plant expression
systems from which the recombinant lysosomal enzymes can be
isolated and used for a variety of purposes.
[0034] The present invention is exemplified by virally transfected
and transgenic tobacco plants with lysosomal enzyme expression
constructs. One construct comprises a nucleotide sequence encoding
a modified human glucocerebrosidase (hGCB). Another construct
comprises nucleotide sequence encoding a human .alpha.
galactosidase (.alpha. gal or .alpha. gal A). Virally transfected
and transgenic tobacco plants having the expression constructs
produce lysosomal enzymes that are enzymatically active and have
high specific activity.
[0035] The plant expression systems and the recombinant lysosomal
enzymes produced therewith have a variety of uses, including but
not limited to: (1) the production of enzymatically active
lysosomal enzymes for the treatment of lysosomal storage diseases;
(2) the production of altered or mutated proteins, enzymatically
active or otherwise, to serve as precursors or substrates for
further in vivo or in vitro processing to a specialized industrial
form for research or therapeutic uses, such as to produce a more
effective therapeutic enzyme; (3) the production of antibodies
against lysosomal enzymes for medical diagnostic use; and (4) use
in any commercial process that involves substrate hydrolysis.
BRIEF DESCRIPTION OF FIGURES
[0036] FIG. 1 shows a Tobamovirus expression vectors.
[0037] FIG. 2 shows a Tobamovirus expression vector containing the
human .alpha. galactosidase gene or a variant of the gene. The
amino acid sequence of .alpha.ASP and Native SP depicted in FIG. 2
are depicted in SEQ ID. NO: 1 and 2, respectively. The entire amino
acid sequence of WT rGAL-A is depicted in SEQ ID NO: 4.
[0038] FIG. 3A shows accumulation by Western Analysis of total
plant soluble extract anti human GAL-A sera.
[0039] FIG. 3B shows activity of WT rGAL-A at 8 and 14+ days post
inoculation of the plant host with a viral vector.
[0040] FIG. 4A shows Western blot analysis of total plant soluble
extract anti human GAL-A sera
[0041] FIG. 4B shows activity of WT rGAL-wt and rGAL-wtR at 8 and
14+ days post inoculation of the plant host with a viral
vector.
[0042] FIG. 5 shows carboxy terminal modifications to .alpha.
galactosidase. The asterisk indicates a potential CTPP cleavage
site according to Gene 58: 177, 1987. The entire nucleic acid and
amino acid sequences of WT rGAL-A, WT-rGAL-AR, rGAL-4, rGAL-4R,
rGAL-8, rGAL-8R, rGAL-12, rGAL-12R, rGAL-25, and rGAL-25R are
depicted in SEQ ID NO: 3-22, respectively.
[0043] FIG. 6 shows western blot analysis of the accumulation of 10
carboxy-modified rGAL-A variants from interstitial fluid and from
total plant homogenate.
[0044] FIG. 7 shows a comparison of enzymatic activity of the 10
carboxy-modified rGAL-A variants.
[0045] FIG. 8 shows a Coomassie blue stained electrophoresis gel
separation of carboxy-modified rGAL-A variants and controls.
[0046] FIG. 9 shows a Coomassie blue stained electrophoresis gel
separation of carboxy-modified rGAL-A variants and controls.
[0047] FIG. 10 shows a schematic representation of rGAL-A secretion
from the endoplasmic reticulum to the apoplast.
[0048] FIG. 11 shows different glycosylation structures of .alpha.
galactosidase.
[0049] FIG. 12 shows TTODA (rGAL-12R) TMV RNA begins at base 1;
126/183 reading frame begins at 69, 3417 is suppressible stop
codon, and ends at 4919.30K ORF begins at 4903 and ends at 5709.
Human .alpha. galactosidase A RNA begins at 5703, .alpha. amylase
signal peptide is from 5762-5857; mature human .alpha.
galactosidase A coding region is 5858-7036, ToMV virus coat protein
and 3 UTR follows. (SEQ ID NO: 33).
[0050] FIG. 13 shows SBS5-rGAL-12R TMV RNA begins at base 1;
126/183 reading frame begins at 69, 3417 is suppressible stop
codon, and ends at 4919.30K ORF begins at 4903 and ends at 5709.
Human .alpha. galactosidase A RNA begins at 5703, complete (signal
peptide and mature protein coding region) human .alpha.
galactosidase A gene 5766-7037, TMV U5 virus coat protein and 3 UTR
follows (SEQ ID. NO: 34).
[0051] FIG. 14 shows the construct within pBSG638: a dual
Cauliflower Mosiac Virus 35S promoter linked to a translational
enhancer from Tobacco Etch Virus linked 5' to, and a
polyadenylation region from the nopline synthase gene of
Agrobacterium tumefaciens linked 3' to, the native human GCB
cDNA.
[0052] FIG. 15 shows the construct within pBSG641: a dual
Cauliflower Mosiac Virus 35S promoter linked 5' to, and a
polyadenylation region from the nopline synthase gene of
Agrobacterium tumefaciens linked 3' to, the entire genome of
Tobacco Mosaic Virus except the coat protein region is replaced
with the GCB gene.
DETAILED DESCRIPTION OF THE INVENTION
[0053] The present invention provides a polynucleotide comprising
the nucleotide sequence depicted in SEQ ID NO: 3, 5, 7, 9, 11, 13,
15, 17, 19, 31, or 32. The present invention also provides a
polypeptide comprising the amino acid sequence depicted in SEQ ID
NO: 4, 6, 8, 10, 12, 14, 16, 18, or 20.
[0054] The present invention further provides for a polypeptide
comprising (a) the complete, or a fragment of, the amino acid
sequence of .alpha.-galactosidase and (b) the amino acid SEKEL (SEQ
ID NO:37), wherein SEKEL is at the carboxy end of the complete, or
a fragment of, the amino acid sequence of .alpha.-galactosidase,
wherein said fragment of the amino acid sequence of
.alpha.-galactosidase comprises a deletion of at the carbozy end of
.alpha.-galactosidase, wherein said deletion is one to twenty-five
amino acids. Preferably, the deletion is one to twelve amino acids.
More preferably, the deletion is four to twelve amino acids. The
present invention further provides for a polynucleotide comprising
a nucleotide sequence encoding the aforementioned
polypeptide(s).
[0055] The present invention further provides for a polynucleotide
encoding the aforementioned polypeptide(s).
[0056] The present invention also provides for a viral vector or
expression vector comprising the aforementioned polynucleotide(s)
or encoding the aforementioned polypeptide(s). The viral vector or
expression vector is capable of expression and systemic expression
of the polypeptide(s) encoded by the polynucleotide in a plant cell
or a plant. Preferably, the viral vector or expression vector is
derived from or based on or obtained from an RNA virus or an RNA
viral vector. More preferably, the RNA virus is an RNA plant virus.
Even more preferably, the RNA plant virus is a single-stranded
plus-sense RNA plant virus. The RNA plant virus is multi-partite,
monopartite, bipartite, tripartite, or the like. Even much more
preferably, the single-stranded plus-sense RNA plant virus is a
tobamovrius, such as a tobacco mosaic virus.
[0057] The present invention further provides for a plant cell or a
plant expressing the aforementioned polypeptide(s).
[0058] The present invention provides for a method for producing a
protein of choice comprising a lysosomal enzyme which is
enzymatically active, comprising: recovering the lysosomal enzyme
from (i) a transgenic plant cell or (ii) a cell, tissue or organ of
a transgenic plant, which transgenic plant cell or plant is
transformed or transfected with a recombinant expression construct
comprising a nucleotide sequence encoding the lysosomal enzyme and
a promoter that regulates expression of the nucleotide sequence so
that the lysosomal enzyme is expressed by the transgenic plant cell
or plant.
[0059] The promoter can be an inducible promoter. The inducible
promoter can be induced by mechanical gene activation. The method
can be carried out with the transgenic plant and additionally
comprises a step of inducing the inducible promoter before or after
the transgenic plant is harvested, which inducing step is carried
out before recovering the lysosomal enzyme from the cell, tissue or
organ of the transgenic plant.
[0060] The lysosomal enzyme can be a modified lysosomal enzyme
which is enzymatically active and comprises: (a) an
enzymatically-active fragment of a human or animal lysosomal
enzyme; (b) the human or animal lysosomal enzyme or (a) having one
or more amino acid residues added to the amino or carboxyl terminus
of the human or animal lysosomal enzyme or (a); or (c) the human or
animal lysosomal enzyme or (a) having one or more
naturally-occurring amino acid additions, deletions or
substitutions. The modified lysosomal enzyme can comprise a signal
peptide or detectable marker peptide at the amino or carboxyl
terminal of the modified lysosomal enzyme. The modified lysosomal
enzyme can be recovered from (i) the transgenic plant cell or (ii)
the cell, tissue or organ of the transgenic plant by reacting with
an antibody that binds the detectable marker peptide. The antibody
can be a monoclonal antibody.
[0061] The modified lysosomal enzyme can comprise: (a) an
enzymatically-active fragment of an a-N-acetylgalactosaminidise,
acid lipase, a-galactosidase, glucocerebrosidase, a-L-iduronidase,
iduronak sulfatase, a-mannosidase or sialidase; (b) the
a-N-a-cetylgalactosaminida- se, acid lipase, a-galactosidase,
glucocerebrosidase, a-L-iduronidase, iduronate sulfatase,
a-mannosidase, sialidase or (a) having one or more amino acid
residues added to the amino or carboxyl terminus of the
a-N-acetylgalactosaminidase, acid lipase, a-galactosidase,
glucocerebrosidase, a-L-iduronidase, iduronate sulfatase,
a-mannosidase, sialidase or (a); or (c) the
a-N-acetylgalactosaminidase, acid lipase, a-galactosidase,
glucocerebrosidase, a-L-iduronidase, iduronate sulfatase,
a-mannosidase, sialidasc or (a) having one or more
naturally-occurring amino acid additions, deletions or
substitutions.
[0062] The modified lysosomal enzyme can comprise: (a) an
enzymatically-active fragment of a human glucocerebrosidase or
human .alpha.-L-iduronidase enzyme; (b) the human
glucocerebrosidase, human .alpha.-L-iduronidase or (a) having one
or more amino acid residues added to the amino or carboxyl terminus
of the human glucocerebrosidase, human .alpha.-L-iduronidase or
(a); or (c) the human glucocerebrosidase, human
.alpha.-Liduronidase or (a) having one or more naturally-occurring
amino acid additions, deletions or substitutions.
[0063] The modified lysosomal enzyme can be a fusion protein
comprising: (I) (a) the enzymatically-active fragment of the human
or animal lysosomal enzyme, (b) the human or animal lysosomal
enzyme, or (c) the human or animal lysosomal enzyme or (a) having
one or more naturally-occurring amino acid additions, deletions or
substitutions, and (II) a cleavable linker fused to the amino or
carboxyl terminus of (I); and the method comprises: (a) recovering
the fusion protein from the transgenic plant cell, or the cell,
tissue or organ of the transgenic plant; (b) treating the fusion
protein with a substance that cleaves the cleavable linker so that
(1) is separated from the cleavable linker and any sequence
attached thereto; and (c) recovering the separated (I).
[0064] The transgenic plant can be a transgenic tobacco plant. The
lysosomal enzyme can be a human or animal lysosomal enzyme. The
lysosomal enzyme can be an .alpha.-N-cetylgalactosaminidase, acid
lipase, .alpha.-galactosidase, glucocerebrosidase,
.alpha.-L-iduronidase, iduronate sulfatase, .alpha.-mannosidase or
sialidese. The lysosomal enzyme can be a human glucocerebrosidase
or human .alpha.-L-iduronidase. The organ can be a leaf, stem,
root, flower, fruit or seed.
[0065] The present invention provides for a recombinant expression
construct comprising a nucleotide sequence encoding a protein of
choice comprising a lysosomal enzyme and a promoter that regulates
the expression of the nucleotide sequence in a plant cell.
[0066] The promoter can be an inducible promoter. The inducible
promoter can be induced by mechanical gene activation. The
lysosomal enzyme can be a modified lysosomal enzyme which is
enzymatically active and comprises: (a) an enzymatically active
fragment of a human or animal lysosomal enzyme; (b) the human or
animal lysosomal enzyme or (a) having one or more amino acid
residues added to the amino or carboxyl terminus of the human or
animal lysosomal enzyme or (a); or (c) the human or animal
lysosomal enzyme or (a) having one or more naturally-occurring
amino acid additions, deletions or substitutions. The modified
lysosomal enzyme can comprise a signal peptide or detectable marker
peptide at the amino or carboxyl terminal of the modified lysosomal
enzyme.
[0067] The modified lysosomal enzyme can comprise (a) an
enzymatically-active fragment of an
.alpha.-N-acetylgalactosaminidase, acid lipase,
.alpha.-galactosidase, glucocerebrosidase, .alpha.-L-iduronidase,
iduronate sulfatase, .alpha.-mannosidase or sialidase; (b) the
.alpha.-N-acetylgalactosaminidase, acid lipase,
.alpha.-galactosidase, glucocerebrosidase, .alpha.-L-iduronidase,
iduronate sulfatase, .alpha.-mannosidase, sialidase or (a) having
one or more amino acid residues added to the amino or carboxyl
terminus of the .alpha.-N-acetylgalactosaminidase, acid lipase,
.alpha.-galactosidase, glucocerebrosidase, cr-Liduronidase,
iduronate sulfatase, cr-mannosidase, sialidase or (a); or (c) the
.alpha.-N-acetylgalactosaminidase, acid lipase,
.alpha.-galactosidase, glucocerebrosidase, .alpha.-L-iduronidase,
iduronate sulfatase, .alpha.-mannosidase, sialidase or (a) having
one or more naturally-occurring amino acid additions, deletions or
substitutions.
[0068] The modified lysosomal enzyme can comprise (a) an
enzymatically-active fragment of a human glucocerebrosidase or
human .alpha.-L-iduronidase enzyme; (b) the human
glucocerebrosidase or human .alpha.-L-iduronidase or (a) having one
or more amino acid residues added to the amino or carboxyl terminus
of the human glucocerebrosidase, human .alpha.-L-iduronidase or
(a); or (c) the human glucocerebrosidase, human
(.alpha.-L-iduronidase or (a) having one or more
naturally-occurring amino acid additions, deletions or
substitutions.
[0069] The modified lysosomal enzyme can be a fusion protein
comprising: (I) (a) the enzymatically-active fragment of the human
or animal lysosomal enzyme, (b) the human or animal lysosomal
enzyme, or (c) the human or animal lysosomal enzyme or (a) having
one or more naturally-occurring amino acid additions, deletions or
substitutions, and (II) a cleavable linker fused to the amino or
carboxyl terminus of (I). The lysosomal enzyme can be a human or
animal lysosomal enzyme. The lysosomal enzyme can be an
.alpha.-N-acetylgalactosaminidase, acid lipase,
.alpha.-galactosidase, glucocerebrosidase, .alpha.-L-iduronidase,
iduronate sulfatase, .alpha.-mannosidase or sialidase. The
lysosomal enzyme can be a human glucocerebrosidase or human
.alpha.-L-iduronidase.
[0070] The present invention provides for a plant transformation or
transfection vector comprising any of the recombinant expression
construct recited above.
[0071] The present invention provides for a plant which is
transformed or transfected with any of the recombinant expression
construct recited above.
[0072] The present invention provides for a plant cell, tissue or
organ which is transformed or transfected with any of the
recombinant expression construct recited above.
[0073] The present invention provides for a plasmid comprising any
of the recombinant expression construct recited above.
[0074] The present invention provides for a transgenic plant or
plant cell capable of producing a lysosomal enzyme which is
enzymatically active, which transgenic plant or plant cell is
transformed or transfected with a recombinant expression construct
comprising a nucleotide sequence encoding a lysosomal enzyme and a
promoter that regulates expression of the nucleotide sequence in
the transgenic plant or plant cell. The promoter is an inducible
promoter. The inducible promoter is induced by mechanical gene
activation. The lysosomal enzyme which is a modified lysosomal
enzyme which is enzymatically active and which comprises: (a) an
enzymatically-active fragment of a human or animal lysosomal
enzyme; (b) the human or animal lysosomal enzyme or (a) having one
or more amino acid residues added to the amino or carboxyl terminus
of the human or animal lysosomal enzyme or (a); or (c) the human or
animal lysosomal enzyme or (a) having one or more
naturally-occurring amino acid additions, deletions or
substitutions. The modified lysosomal enzyme comprises a signal
peptide or detectable marker peptide at the amino or carboxyl
terminal of the modified lysosomal enzyme.
[0075] The modified lysosomal enzyme comprises: (a) an
enzymatically-active fragment of an
.alpha.-N-acetylgalactosaminidase, acid lipase,
.alpha.-galactosidase, glucocerebrosidase, .alpha.-L-iduronidase,
iduronate sulfatase, .alpha.-mannosidase or sialidase; (b) the
.alpha.-N-acetylgalactosaminidase, acid lipase,
.alpha.-galactosidase, glucocerebrosidase, .alpha.-L-iduronidase,
iduronate sulfatase, .alpha.-mannosidase, sialidase or (a) having
one or more amino acid residues added to the amino or carboxyl
terminus of the .alpha.-N-acetylgalactosaminidase, acid lipase,
.alpha.-galactosidase, glucocerebrosidase, .alpha.-L-iduronidase,
iduronate sulfatase, amannosidase, sialidase or (a); or (c) the
.alpha.-N-acetylgalactosaminid- ase, acid lipase,
.alpha.-galactosidase, glucocerebrosidase, .alpha.-L-iduronidase,
iduronate sulfatase, .alpha.-mannosidase, sialidase or (a) having
one or more naturally-occurring amino acid additions, deletions or
substitutions.
[0076] The modified lysosomal enzyme can comprise: (a) an
enzymatically-active fragment of a human glucocerebrosidase or
human .alpha.-L-iduronidase enzyme; (b) the human
glucocerebrosidase, human .alpha.-L-iduronidase or (a) having one
or more amino acid residues added to the amino or carboxyl terminus
of the human glucocerebrosidase, human .alpha.-L-iduronidase or
(a); or (c) the human glucocerebrosidase, human a-L-iduronidase or
(a) having one or more naturally-occurring amino acid additions,
deletions or substitutions.
[0077] The modified lysosomal enzyme is a fusion protein
comprising: (I) (a) the enzymatically-active fragment of the human
or animal lysosomal enzyme, (b) the human or animal lysosomal
enzyme, or (c) the human or animal lysosomal enzyme or (a) having
one or more naturally-occurring amino acid additions, deletions or
substitutions, and (II) a cleavable linker fused to the amino or
carboxyl terminus of (I). The transgenic plant or plant cell is a
transgenic tobacco plant or tobacco cell. The lysosomal enzyme is a
human or animal lysosomal enzyme. The lysosomal enzyme is an
a-N-acetylgalactosaminidase, acid lipase, a-galactosidase,
glucocerebrosidase, a-L-iduronidase, iduronate sulfatase,
a-mannosidase or sialidase. The lysosomal enzyme is a human
glucocerebrosidase or human a-L-iduronidase.
[0078] The present invention provides for a leaf, stem, root,
flower or seed of any of the transgenic plant recited above.
[0079] The present invention provides for a seed of plant line
Nicotiana sp., which seed has the ATCC Accession No. PTA-2258,
deposited Jul. 25, 2000.
[0080] The present invention provides for a plant grown from the
seed recited above.
[0081] The present invention provides for a lysosomal enzyme which
is enzymatically active and is produced according to a process
comprising: recovering the lysosomal enzyme from (i) a transgenic
plant cell or (ii) a cell, tissue or organ of a transgenic plant
which transgenic plant cell or plant is transformed or transfected
with a recombinant expression construct comprising a nucleotide
sequence encoding the lysosomal enzyme and a promoter that
regulates expression of the nucleotide sequence so that the
lysosomal enzyme is expressed by the transgenic plant cell or
plant. The promoter can be an inducible promoter. The process is
carried out with the transgenic plant and additionally can comprise
a step of inducing the inducible promoter before or after the
transgenic plant is harvested, which inducing step is carried out
before recovering the lysosomal enzyme from the cell, tissue or
organ of the transgenic plant.
[0082] The modified lysosomal enzyme which can be enzymatically
active and can comprise: (a) an enzymatically-active fragment of a
human or animal lysosomal enzyme; (b) the human or animal lysosomal
enzyme or (a) having one or more amino acid residues added to the
amino or carboxyl terminus of the human or animal lysosomal enzyme
or (a); or (c) the human or animal lysosomal enzyme or (a) having
one or more naturally-occurring amino acid, additions, deletions or
substitutions. The modified lysosomal enzyme can comprise a signal
peptide or detectable marker peptide at the amino or carboxyl
terminal of the modified lysosomal enzyme.
[0083] The modified lysosomal enzyme can comprise: (a) an
enzymatically-active fragment of an
.alpha.-N-acetylgalactosaminidase, acid lipase,
.alpha.-galactosidase, glucocerebrosidase, .alpha.-L-iduronidase,
iduronate sulfatase, .alpha.-mannosidase or sialidase; (b) the
.alpha.-N-acetylgalactosaminidase, acid lipase,
.alpha.-galactosidase, glucocerebrosidase, .alpha.-Liduronidase,
iduronate sulfatase, .alpha.-mannosidase, sialidase or (a) having
one or more amino acid residues added to the amino or carboxyl
terminus of the .alpha.-N-acetylgalactosaminidase, acid lipase,
.alpha.-galactosidase, glucocerebrosidase, .alpha.-L-iduronidase,
iduronate sulfatase, amannosidase, sialidase or (a); or (c) the
.alpha.-N-acetylgalactosaminid- asd, acid lipase,
.alpha.-galactosidase, glucocerebrosidase, .alpha.-L-iduronidase,
iduronate sulfazase, .alpha.-mannosidase, sialidase or (a) having
one or more naturally-occurring amino acid additions, deletions or
substitutions.
[0084] The modified lysosomal enzyme comprises: (a) an
enzymatically-active fragment of a human glucocerebrosidase or
human .alpha.-L-iduronidase enzyme; (b) the human
glucocerebrosidase, human .alpha.-L-iduronidase or (a) having one
or more amino acid residues added to the amino or carboxyl terminus
of the human glucocerebrosidase, human .alpha.-L-iduronidase or
(a); or (c) the human glucocerebrosidase, human
.alpha.-L-iduronidase or (a) having one or more naturally-occurring
amino acid additions, deletions or substitutions. The modified
lysosomal enzyme can be a fusion protein comprising: (I) (a) the
enzymatically-active fragment of the human or animal lysosomal
enzyme, (b) the human or animal lysosomal enzyme, or (c) the human
or animal lysosomal enzyme or (a) having one or more
naturally-occurring amino acid additions, deletions or
substitutions, and (II) a cleavable linker fused to the amino or
carboxyl terminus of (I).
[0085] The transgenic plant can be a transgenic tobacco plant. The
lysosomal enzyme can be a human or animal lysosomal enzyme. The
lysosomal enzyme can be an .alpha.-N-acetylgalactosaminidase, acid
lipase, .alpha.-galactosidase, glucocerebrosidase,
.alpha.-L-iduronidase, iduronate sulfatase, .alpha.-mannosidase or
sialidase. The lysosomal enzyme can be a human glucocerebrosidase
or human .alpha.-L-iduronidase. The organ can be a leaf, stem,
root, flower, fruit or seed.
[0086] Gal-A is one of many proteins that require glycan site
occupancy at N-linked sites to achieve proper folding and
stability. The ability to successfully target the enzyme in Fabry
patients is also likely to be glycosylation-dependent. This
requirement presently limits the expression possibilities to
eukaryotic cell types. Recombinant proteins synthesized in
baculovirus and yeast expression systems are often
hyperglycosylated and highly heterogeneous complicating the
preparation of therapeutically effective glycoforms from these
sources. The rGal-A synthesized in plants is a relatively
homogeneous glycoform as analyzed by its SDS-PAGE electrophoretic
mobility and comigrates with rGal-A produced purified from placenta
(FIG. 3). The expression results (yield and purity) we have already
presented are unprecedented in any eukaryote system for a
glycosylated enzyme and are not likely to be achieved in the
foreseeable future with transgenic plants or animals. "Crude"
rGal-A from the leaf IF has a specific activity of over 1,000,000
U/mg of protein, whereas CHO, COS-1 and insect cell extracts and
supernatants are maximally only 10-20,000 U/mg; (36,41,42).
[0087] Protein pharmaceuticals may vary over five orders of
magnitude in unit value and be required in kg/year quantities. The
example of Gaucher disease emphasizes the need progress in
production phase research. Many additional heritable metabolic
disorders, particularly those caused by dysfunctional lysosomal
enzymes, might be treated by supplementation with exogenously
produced enzymes. Enzyme replacement using macrophage-targeted
human glucocerebrosidase has been shown to be extraordinarily
beneficial for Gaucher patients. However, the cost of this
treatment is very great. If the significant advances in clinical
research are to be applied on a practical scale, new production
technologies will be required to deliver bioproducts such as these
to those in need at an affordable cost (43). No savings in Gaucher
treatment costs were realized upon introduction of the recombinant
CHO-cell product Cerezyme.TM. to replace the placental-derived
Ceredase.TM.. A significant reduction in cost requires fundamental
changes in both the source of enzyme and process of
purification.
[0088] While the existing treatment for Gaucher disease is safe and
effective, there are potential contaminants derived from the source
material that may pose serious risks. For the existing
pharmaceutical products, these risks primarily include
possibilities of contamination with human pathogenic viruses or
peptides with potent hormonal activities such as human chorionic
gonadotropin (44). These potential contaminants are not present in
plant source material.
[0089] The main goal in selecting plants for expression of this
protein is the potential for a radical reduction in costs. For the
RNA-viral mediated synthesis of rGal-A and rGCB in plants, this is
very likely to be achieved through the synergistic combination of
three factors:
[0090] Complex crude extracts from various eukaryote cell
production systems may be replaced with a plant leaf homogenate or
IF fractions highly enriched in recombinant product.
[0091] Large-scale, sterile, cell fermentation systems and
associated media, capitalization, and waste costs may be replaced
with plant biomass. Production is then inexpensively scaled to the
quantities desired.
[0092] The labor and time required to generate transgenic higher
plants or animals may be replaced with a very rapid and simple
plant transformation or plant viral transfection system.
[0093] Modem agriculture can supply a new generation of medicinal
plants as a source of pharmaceuticals--a source that should be as
inexpensive and readily available as our food, fiber, flavors and
chemical feedstocks.
EXPERIMENTAL DESIGN AND METHODS
[0094] Post-Translational Processing and Secretion. Protein
secretion to the plant apoplast is through a default pathway. In
our experience, addition of the rice .alpha.-amylase signal peptide
(.alpha.-ASP) sequence at the N-terminus of several recombinant
proteins is sufficient to direct the protein to the lumen of the ER
in tobacco leaves. However, this is not likely to be a
rate-limiting step in protein accumulation and many native signal
peptides may function equally well in plants. It would be most
desirable to include few if any additional AA residues at the N
terminus after processing. For this reason, we compared expression
from the native signal peptide encoded in human Gal-A cDNA to that
from the foreign .alpha.-ASP sequence.
[0095] Mutations in the carboxy-terminal domain of the Gal-A
homodimer have profound effects on enzymatic activity. Several
mutations occurring in individuals affected with Fabry disease map
to this region. Some of these mutations have a dominant negative
phenotype. When a peptide map was published on Gal-A purified from
human lung, the authors noted the absence of the most
carboxy-terminal predicted fragment and hypothesized the
proteolytic removal of 26 or 28 AA from this region (39,40). Very
recently Miyamura et al. published a study of the effects of
carboxy-terminal truncations on enzymatic activity in transfected
COS-1 cells (42). Between 2 and 17 AA residues were removed by
introducing stop codons into a series of cDNA constructs. Relative
enzyme activity, measured using 4-MUG as a substrate, first
increased and then decreased as AA were removed. 12 and 17 AA
constructs had no activity, while 11 was the same as wild type. A 4
AA construct yielded the highest activity at approximately
6.2.times. the full-length sequence. Because the precise AA
sequence of the carboxy-terminus of the native human enzyme was
never determined, there is insufficient information to interpret
these results. The carboxy-terminal domain may affect the
conformation of the active site either directly or indirectly
through a proteolytic maturation step and/or assembly and
subcellular localization of the active form. Furthermore, it is
important to stress that it is the enzyme activity on
galactose-terminal glycosphingolipids that is relevant to
development of a therapeutic enzyme.
[0096] Plant proteins do not require N-linked oligosaccharides for
correct sorting into vacuoles (35,37,38). Some vacuolar proteins
(osmotin, thaumatin, chitinase-I, glucanase-I and a barley lectin),
contain sorting information in a CTPP of 7 to 22 AA in length. For
several of these proteins secreted isoforms are synthesized without
a CTPP domain. In other cases, experimental deletion of the CTPP
results in secretion of the recombinant protein to the IF (45-48).
Sorting of Gal-A to the lysosome is likely to occur by the
well-characterized mannose-6-phosphate receptor pathway in
mammalian cells. We hypothesize that a redundant sorting signal may
exist in this carboxy-domain that also serves to reduce enzymatic
activity in the ER lumen, golgi and trans-golgi network. This
signal appears to function in plant cells, presumably for vacuolar
localization.
[0097] Scale-up Purification and Analysis. In order to evaluate the
performance of larger scale process equipment, we designed and had
built a custom basket centrifuge fixture for a laboratory low-speed
centrifuge that has a capacity of approximately 1 kilogram leaf
material. The sensitivity of the fluorescent 4-MUG enzyme assay
allowed us to begin to evaluate enzyme purification from the leaf
IF fraction using the construct rGal-A-SEKDEL. (This vector only
yields approximately {fraction (1/50)}th the activity of
rGal-A12-SEKDEL). Leaf tissue was transfected, harvested and
infiltrated as described in Section B4 (Experimental Results).
Galactosidase activity was stable in crude IF extracts and was
bound to the hydrophobic interaction resin octyl sepharose, and
eluted in a descending ammonium sulfate gradient. The lectin resin
concanavalin-A sepharose was also effective, indicating the
presence of at least one high mannose chain. The enzyme did not
bind to a commercially available melibiose column (Sigma).
[0098] We have measured the enrichment provided by the affinity
resin .alpha.-galactosylamine Sepharose with a C12 arm (49). Some
or all of the three effective chromatography steps were combined as
necessary with a size exclusion fractionation to yield highly
purified enzyme(s). Some or all of the three effective
chromatography steps were comined as necessary with a size
exclusion fractionation to yield highly purified enzyme(s). Because
our current source of enzyme is so enriched (FIG. 3), and several
of the published purification steps we have shown to be compatible
with the plant IF extracts, we anticipate no problems in enzyme
purification. Pure enzyme preparations were shipped to the
laboratory of Drs. Roscoe Brady and Gary Murray for evaluation of
enzyme activity with .sup.14C-galactose-labeled ceramide
trihexoside. These colleagues were responsible for the development
of the therapeutically effective glycoform of glucocerebrosidase
used to treat Gaucher disease.
[0099] We scaled up the purification of up to four candidate
therapeutic enzymes as necessary in our indoor greenhouses. In our
initial experiment, 38 and 48 percent of the total rGal-A activity
was recovered upon the first infiltration and centrifugation
treatment (Construct rGal-A12-SEKDEL) for a yield of >50 mg of
enzyme per kilogram of leaf material. Experience with the
extraction of glucocerebrosidase from the IF indicates that
additional enzyme is recovered in a second treatment. In these
experiments one leaf was collected for each sample from each of two
plants. There was considerable plant to plant variation in the
level of enzyme activity (Table 1). We analyzed more carefully the
accumulation of enzyme activity over time post-inoculation to
optimize yields. Our facilities are more than sufficient to provide
the 1 kilogram quantities of biomass necessary to purify nanomoles
of enzyme for the following sequence and structural work. Sequence
analysis and MALDI-TOF molecular weight determination was performed
as a commercial service by Commonwealth Biotechnologies, Inc.
N-terminal sequence is by the automated Edman degradation.
C-terminal sequence is by carboxypeptidase digestion followed with
amino acid analysis.
Full-Scale Bioprocess Pilot Plant
[0100] Macroextraction. Large-scale maceration of tissue was
accomplished by a 65 hp Rietz disintegrator mill. The macerated
tissue was then separated into a "green juice" fraction and a fiber
fraction in a Rietz screw press. The fiber fraction was dried in a
Cardwell drier. The "green juice" was then pH adjusted and heated
in a dual plate-and-frame heat exchanger system with adjustable
holding tube. The process of pH adjustment and heating causes the
precipitation of the F1 protein complex. The protein was then
clarified in a 40 hp. Westphalia SA-40 disk stack centrifuge
capable of clarification of "green juice" at greater than 20
gallons per minute (GPM).
[0101] Downstream Processing. The concentrate was then pumped to
Clean Room 1 that houses the primary ultrafiltration (UF)
equipment. This equipment was fitted with over 1000 sq. ft. of
spiral wound membranes. Typically, the UF was equipped with 100,000
kDa cut-off membranes. Virus particles are recovered in the
retentate. Lower molecular weight proteins are recovered in the
permeate. The permeate was fractionated by a second UF system
fitted with appropriate molecular weight cut-off membranes. The
retentate was processed in Clean Room 2. Virus was recovered by
polyethylene glycol (PEG) precipitation and centrifugation in two
Sharples vertical bowl centrifuges. Final purification of soluble
proteins and peptides was accomplished on a series of
chromatography systems.
[0102] Additional Facilities. The facility has other major unit
processes available for the recovery and purification of plant
fractions. There are two Alar diatomaceous earth, rotary vacuum
filters. One of the filters was in an explosion proof area of the
pilot plant that can be used for solvent extraction. The solvent
extraction facility also has a biphasic solvent extractor and high
efficiency distillation column. Extensive tankage was available
both indoors and outdoors. Pumps, filters and other process
equipment are available at the facility, allowing a large margin of
flexibility while developing new processes.
[0103] Full-Scale Pilot Plant Implementation. The Bioprocess
Facility has excellent supporting infrastructure. The 900 square
foot laboratory was equipped with all the basic tools for
biochemical and protein analyses including: electrophoresis, gel
filtration, HPLC, spectrophotometry, basic chromatography, chemical
analysis, and sample preparation and preservation. The full scale
pilot plant has approximately 15,000 square feet of additional
floor space for expansion including a high bay tower. External
solvent tanks are placed in diked enclosures. Two rapid recovery,
high pressure (up to 600 psi) steam generators and a large twin
screw, oilless compressor are on site. A complete shop and
maintenance facility was present along with walk-in cold room and
walk-in freezer. Additional equipment includes a ceramic
microfiltration system, a spray dryer and an array of tanks, pumps,
filters, heat exchangers, and agitators.
[0104] Process equipment was fabricated and modified by a group of
skilled vendors and craftsmen capable of fabricating specialized
equipment designed by the company, and has excellent field
experience working in large scale operations.
[0105] Infiltration System. Vacuum infiltration can be accomplished
in the field or at the processing facility. Development experiments
determine the necessity to infiltrate the material in the field. A
vacuum tank was used as the receiver for the plant tissue after
harvest by the tobacco cutter. The tissue was conveyed into a
trailer-mounted tank capable of full vacuum and slurried into an
infiltration buffer. The Owensboro facility has a trailer capable
of carrying approximately 18,000 lb. This will translated into
approximately 1,000 gallons per trip to the field. The trailer was
fitted with a 2,000 gallon tank capable of full volume and
evacuated by a gasoline driven vacuum pump. In harvests from
1991-1994, it was the goal of the team to have harvested biomass at
the processing facility in less than 1 hour after cutting. If the
tissue can be held for approximately one hour without significant
loss of enzyme activity, the biomass can be brought from the field
in the conventional wagon and infiltrated at the processing
facility. Several large, full vacuum tanks can be employed at the
facility to increase the total throughput of the plant. Two
large-scale vacuum pump systems in the plant that are currently
associated with the Alar rotary vacuum filters can be used for the
vacuum infiltration process step.
[0106] Basket Centrifugation. The full-scale basket-type centrifuge
was a discontinuous batch-type system. Leaf tissue can be slurried
in, dewatered as a batch, then a scraper system discharges the
solids to a bottom dump. Large leaves and pieces of tissue can be
handled in this manner. The potential of placing a vacuum system on
the discharge side of the centrifuge was also be investigated. The
centrifuge was a hydraulically driven conventional basket
centrifuge with a bottom discharge and bowl dimension of 48 inches
in diameter and a depth of 30 inches. Optimum loadings of the
centrifuge in full-scale was determined the throughput and cycle
times of this process step.
[0107] Vacuum Extraction. Vacuum extraction can be accomplished in
large-scale by a web or belt-type vacuum filter system common in
the food ingredient business. The "in-plant" vacuum systems could
also be adapted to operate this type of filter. The plant tissue
can be placed on this type of filter before or after the
centrifugation step. Some damage of the biomass was anticipated
during the scraper mediated discharge of the basket centrifuge. The
discharged material was analyzed for the presence of intracellular
components and their effect on enzyme activity, recovery and
separation. These data determined the position of the vacuum
filtration step in the process flow.
[0108] Downstream Processing. The initial UF separation was
accomplished by an Alfa-Laval custom UF system consisting of six
modular housings each containing either three 12 inch spiral wound
membranes (Amicon type) or one standard 38 inch module. This yields
a UF system with between 740 and 1140 square feet of membrane area
of typical spiral wound configuration. The ability to interchange
housings and replace housings by spool pieces gives the system
great flexibility in large-scale process development. This system
was housed in Clean Room #1. This room is 14.times.18 ft, and is
under positive pressure, HEPA-filtered air. A second UF system was
available in Clean Room #1. This smaller system, built by
Separations Equipment Technology (SETEC), has the capacity for 320
square feet of spiral wound membrane. This system was employed for
the second separation and diafiltration. It was designed for
automatic diafiltration. Clean Room #2 is equipped with a Pharmacia
Streamline fluid bed gel filtration system equipped with UV and
refractive index monitoring equipment. This unit was available for
chromatography steps.
[0109] An antiserum specific for these xylose- and
fucose-containing complex glycans was especially useful in
developing an ELISA assay to follow enzymatic deglycosylation.
Large quantities of purified enzyme facilitate definitive
determination of glycosylation structure and if necessary provide
adequate rGal-A to use as substrate for enzymatic deglycosylation
reactions. Using Gal-A knockout mice in the laboratory of Dr. Brady
at NIH was an important genetic tool in developing a
therapeutically effective glycoform. We use our transfected plants
as a convenient source of recombinant enzyme for glycan analysis.
Glycoforms are shown in FIG. 11.
[0110] Plants as a Source of Recombinant Pharmaceutical Proteins. A
number of genetic tools have been developed during the last decade
for the expression of foreign genes in plants. In addition to
various antibody molecules (21-23), the accumulation of serum
proteins (24) and candidate vaccine products (25-28) has been
described in the leaves and other tissues of whole plants. We
increased the attainable expression levels through the use of
chimeric RNA viruses. For production of specific proteins,
transient expression of foreign genes in plants using virus-based
vectors has several advantages. These chimeric viruses move quickly
from an initial infection site and deliver the recombinant gene to
essentially all somatic cells of the plant. The gene vectors are
premier analytical tools because they allow both high level
expression and brief cycles of protein modification and testing. A
permissive host provides high levels of expression and may be used
for rapid, large-scale recombinant protein production in whole
plants.
[0111] We validated the performance of plant-based expression
systems for the production of recombinant proteins and peptides of
pharmaceutical significance. In two weeks post-inoculation, the
ribosome inactivating enzyme .alpha.-trichosanthin was
over-produced in plants to 2% of the total soluble protein and had
the same specific activity as the enzyme from the native source
(29). Because these products can be obtained from a non-sterile,
low input, renewable and easily scalable source, the costs of
synthesis in plants are negligible. We confirmed the performance
and containment of the vectors in four field trials (1991, 1994,
1995, 1996).
[0112] The vectors of the invention are based on chimeras between
the 6.4 kb single-stranded RNA genome of tobacco mosaic virus (TMV)
and other members of the tobamovirus group. Most of the TMV genome
encodes overlapping reading frames required for replication and
transcription (FIG. 1A). These are located at the 5' end of the
virus and translated from genomic RNA yielding proteins of 126 and
183 kDa. Expression of the internal genes was controlled by
different promoters on the minus-sense RNA that direct synthesis of
3'-coterminal subgenomic mRNAs produced during replication. The 30
kDa protein, which was required for the virus to move from cell to
cell, was produced early and in relatively low amounts, whereas the
17.5 kDa coat protein was produced late and usually as the most
abundant protein in infected cells. Largely because of the strength
of the coat protein subgenomic promoter, during peak protein
synthesis the coat protein can be produced at up to 70% of the
total rate of cellular protein synthesis without appreciably
reducing host protein synthesis (30).
[0113] The entire cDNA of the TMV genome was cloned behind a
bacterial phage promoter in an E. coli plasmid. Precise replicas of
the virion RNA can be produced in vitro with RNA polymerase and
dinucleotide cap, m.sup.7GpppG. This not only allows manipulation
of the viral genome for reverse genetics, but it also allows
manipulation of the virus into a gene transfer vector. Subgenomic
promoters from divergent viral strains can be added to the genome
to direct the expression of foreign genes. Enormous quantities of
mRNA are synthesized and delivered directly from the cytoplasm to
the ribosome. TMV-based transient vectors offer significant
advantages over integration of genes into plant chromosomes. By
altering the molecular exclusion limits of the cellular junctions
between adjacent plant cells, the vector invades virtually every
cell of the plant during a period of 2 weeks post-inoculation. For
many gene products, the recombinant protein accumulates to several
percent of the total protein during this brief period of time. In
contrast, it was very time consuming and labor intensive to
generate, select, and breed transgenic plants for recombinant
protein production. Many of these selections were culled because of
poor expression due to position effects or gene silencing
phenomena. In many more lines, the levels of product accumulation
was too low for development of a viable commercial process.
EXAMPLE 1
[0114] We have established that a recombinant human lysosomal
enzyme (rGCB) synthesized in transgenic tobacco has comparable
activity to the same enzyme isolated from other native and
recombinant sources. We also investigated the feasibility and
economic advantages of purifying large quantities of active rGCB
from plants. We designed and fabricated laboratory equipment that
enabled us to optimize the key initial steps of a purification
process in the laboratory using kilogram quantities of biomass from
our greenhouses. We standardized a series of assays for secretory
and intracellular marker enzymes in addition to rGCB assays that
allowed us to monitor both lab and field expression as well as the
purification process. Leaf tissue was infiltrated with a suitable
extraction buffer while submerged in a large vacuum chamber,
allowing the solution to reach the leaf intercellular fluid
containing rGCB. The IF fraction was recovered by centrifugation in
a custom collection chamber and "basket" centrifuge rotor
compatible with a conventional Beckman J2-21 spindle. rGCB was
trapped from the dilute IF solution by expanded bed adsorption
chromatography using a hydrophobic resin and eluted with
polyethylene glycol. A second ion exchange chromatography step was
implemented for an overall yield of 1.7 mg/kg at 41% purity to this
stage. These procedures were then scaled-up to 100 kg during
several pilot-process experiments in a field trial using analogous
industrial bioprocess equipment. These results are summarized in
the table below. Three lots of rGCB were further purified by
RP-HPLC and used for carbohydrate profiling and composition
analysis. In NMR experiments we confirmed that the GCB from the
plant IF contains an N-linked glycan previously reported to occur
in glycoproteins isolated from plant seeds and tissue cultures.
This type of chain contains the plant-specific carbohydrate
linkages of .alpha. 1-2 xylose and .beta. 1-3 fucose on the
trimannosyl core.
Making Transgenic Tobacco Plants to Produce Glucocerebrosidase
[0115] Several founder plant lines for genetically stable
expression of rGCB were generated and characterized. Under
greenhouse conditions individual plants accumulate rGCB to at least
1.3% of the total protein in the leaf intercellular fluid as
estimated from enzymatic assays. This represents a 50-fold
enrichment relative to the crude lysosomal fraction of placental
extracts used as the starting material for the product
Ceredase.TM..
[0116] Transgenic Tobacco Leaves Express Moderate Levels of rGCB.
We combined a dual promoter from Cauliflower Mosaic Virus (35S), a
translational enhancer from Tobacco Etch Virus and a
polyadenylation region from the nopaline synthetase gene of
Agrobacterium tumefaciens with the native human GCB cDNA to create
plasmid pBSG638 (33; FIG. 14). These expression elements are widely
used to provide the highest possible constitutive expression of
nuclear encoded genes. Depending on the nature of individual
proteins, these vectors can be used to accumulate moderate levels
of recombinant proteins in most tissues of many plant species.
[0117] Using a standard Agrobacterium-mediated transformation
method, we regenerated 93 independent kanamycin-resistant
transformants from leaf discs of four different tobacco cultivars
(the T0 generation). In Western blots of total protein extracts,
cross-reacting antigen was detected in 46 of these T0 individuals
with antibody raised against human glucocerebrosidase. Specificity
of the plant-expressed recombinant enzyme was confirmed by
hydrolysis of .sup.14C-radiolabeled glucosylceramide.
Leaf Disc Transformation With Agrobacterium Tumefaciens (59, 60,
61) Method
[0118] 1) Transform the T-DNA plasmid into A.t. LBA4404 selecting
for the bacterial Ab.sup.R gene (generally Km at 100 ug/ml).
[0119] 2) Pick a single colony into YEB medium plus antibiotic and
grow at 28.degree. C. overnight (to saturation; often takes a
little longer than overnight).
[0120] 3) Take aseptic or surface-sterilized Nicotiana tabacum
(MD609, Xanthi, SR1, Samsun) leaves, remove midrib and cut into
leaf "chunks".about.1 cm.sup.2.
[0121] 4) With sterile forceps, dip (submerge) the leaf disc into
the Agrobacterium suspension.
[0122] Placing the bacterial culture into a small petri dish is
convenient.
[0123] 5) Remove the leaf disc from the Agrobacterium and place the
disc on regeneration medium. Place the discs so that the underside
of the leaf is up. (They seem to do better this way, perhaps
because of better gas transfer.)
[0124] Use needle-nose forceps to handle the discs, thus
introducing small puncture wounds into which Agrobacterium can
infect; small wounds are good, major damage (e.g., crushing) to the
disc is bad.
[0125] 6) Seal plate containing discs with Parafilm.RTM. and
incubate at 25-28.degree. C., preferably in light with a yellow
filter to inhibit UV degradation of the medium.
[0126] 7) After 2 days co-incubation, transfer the leaf discs to
selective plates (regeneration medium plus 500 ug/ml
Cefotaxime).
[0127] 8) After 2 more days, transfer discs to regeneration medium
plus 500 ug/ml cefotaxime and 100 ug/ml kanamycin
[0128] 9) When normal-looking shoots appear, excise them, taking
care not to excise any callus, and place in rooting medium.
[0129] Callus on the end of the stem generally prevents rooting,
and could lead to a chimeric set of shoots.
[0130] The lower % agar makes it easier to wash the agar off the
roots when transferring to soil.
[0131] If there is time, it is a good practice (when the plants are
rooted and growing) to cut the shoots off and re-root them. Escapes
will generally not root on Km medium.
[0132] 10) When roots first appear, remove plantlets, wash agar
from the roots and plant in soil medium in small pots. Cover pots
with a plastic bag for the first 5 days or so to retain humidity
and reduce transplantation shock.
[0133] 1 Liter of Regeneration Medium contains:
[0134] MS Salts
[0135] 30 g sucrose
[0136] 1 ml of 0.5 mg/ml nicotinic acid
[0137] 1 ml of 0.5 mg/ml pyridoxine HCl
[0138] 2 ml of 0.5 mg/ml thiamine HCl
[0139] 2 ml of 50 mg/ml inositol
[0140] 1.5 ml of 0.1 mg/ml IAA
[0141] 5.0 ml of 1.0 mg/ml 2-IP-2-iminopurine
[0142] 8 g of agar, pH 6.0
[0143] 1 Liter of Rooting Medium contains:
[0144] 1/2.times.MS Salts
[0145] 10 g sucrose
[0146] 2 ml of 0.1 mg/ml IAA
[0147] 8 g agar, pH 5.7
[0148] A deposit at ATCC under the Budapest treaty was made on Jul.
25, 2000 of seed from Nicotiana benthamiana MD609, Accession No.
PTA-2258.
[0149] According to these expression results the rGCB positive
transformants were ranked into moderate (A), low (B) and negligible
(C) activity groups (Table 1).
1TABLE 1 EXPRESSION OF rGCB IN THE T0 GENERATION Number of Specific
Activity Group Individuals Units/mg A 13 130-390 B 20 70-130 C 13
24-68 Controls 8 0-10 Specific Activity is based on hydrolysis of
[14C]-glucosylceramide (Units = nmol/hr).
[0150] Plant rGCB is Similar to Macrophage-Targeted
Glucocerebrosidase. We found reaction conditions to preferentially
inhibit rGCB enzyme activity in the presence of plant glucosidases
using the suicide substrate conduritol B-epoxide (CBE). Total
glucosidase activity, and RGCB activity were measured by hydrolysis
of the fluorescent substrate 4-methylumbelliferylglucopyranoside
(4-MUG) with and without CBE. Total protein was determined by the
method of Bradford. Detergents are necessary to solubilize and
stabilize activity of this membrane-associated enzyme. Using a
small scale (.about.100 mg fresh weight) extraction procedure,
several detergents were compared for yield of enzyme activity and
purity (including; IGEPAL CA-630, Tween-20, Tween-80, Triton X-100,
Triton X-114, CHAPS, taurocholic acid, cholic acid, deoxycholate
and taurodeoxycholate). Buffer without detergent, deoxycholate,
taurocholate and cholate below their critical micelle
concentrations (CMC) (0.1%) yielded low units of rGCB. All of the
other detergents gave comparable specific activity and yields of
total activity with Tween-80 yielding slightly higher activity. The
dialyzable bile salt, sodium taurocholate and the lower CMC
detergent Tween-80 were compared at a range of concentrations
(0.1-1% and 0.001-1%, respectively). Tween-80 at 0.15% and
taurocholate at 0.5% gave the best yield and purity.
[0151] A number of chromatography steps were evaluated for
purification of rGCB from total homogenates (Table 1). As is the
case for the native placental enzyme, hydrophobic resins provide
the most significant purification gains. Gel filtration, Con A
Sepharose and affinity chromatography also worked very well, but
some of these approaches may be impractical on a large scale. Both
anion and cation chromatography may prove useful, but the ideal
buffer conditions for stabilization of enzyme activity remain to be
determined.
2TABLE 2 SUMMARY OF CHROMOTOGRAPHY RESULTS Column Matrix Type
Results Octyl Sepharose 4 FF Hydrophobic + Phenyl Sepharose HP
Hydrophobic + Phenyl Sepharose 6 FF Hydrophobic + Butyl Sepharose 4
FF Hydrophobic - Alkyl Superose Hydrophobic - SP Sepharose FF
Strong Cation +/- - Q Sepharose FF Strong Anion +/- - Con A
Sepharose Lectin Affinity +/- NHS-Activated Sepharose HP Antibody
Affinity + Sephacryl S-100 HR Gel Filtration + (+) Effective
increase in Specific Activity; (+/-) Needs enzyme activity
stabilized; (+/- -) Variable results; (-) Poor binding.
[0152] The post-translational processing of native
glucocerebrosidase (GCR) in human cells is complex. Two primary
translation products are derived from two in-phase start codons.
These precursors, a 2:1 mixture of 60 kDa and 57 kDa proteins, are
proteolytically processed to 55 kDa as they pass into the lumen of
the ER. High mannose and complex glycans are subsequently added in
the ER and Golgi compartments to yield 62 and 66 kDa glycoforms.
Finally, exoglycosidases generate a mature 59 kDa lysosomal enzyme.
Recall that glycosylation is required for both enzymatic activity
and lysosomal targeting of transfused enzyme. Sialic acid,
galactose, and N-acetylglucosamine residues are enzymatically
removed in vitro by the sequential action of glycosidases to
prepare glucocerebrosidase for therapy. The core pathway for
biosynthesis and processing of N-linked complex glycans in plants
appears identical to that found in animals. There are three known
differences which occur later in the pathway. Sialic acid is not
reported in complex glycans from plants, and the .alpha.1-3 fucose
and .beta.1-2 xylose linkages are unique (34). As analyzed by
SDS/PAGE, rGCB has an apparent molecular weight of 59 kDa, and
comigrates with the mannose-terminal therapeutic glycoform. We have
not yet detected a significant shift in mobility upon treatment
with glycosidases (PNGase F, Endo H, .alpha. 1-3 fucosidase) in our
preliminary glycosylation analysis. However, the enzyme has an
apparent molecular weight increase of 4 kDa over the
proteolytically processed and unglycosylated form (55 kDa) and must
be glycosylated for activity. Additional digestions are in progress
with a more extensive set of endo- and exoglycosidases and known
plant glycoprotein controls. N-Glycosidase A is reported to
hydrolyze all types of N-glycan chains from glycopeptides and
glycoproteins.
[0153] The signal peptide of rGCB is processed at the correct site.
A very small quantity of protein was prepared for sequence analysis
by purification through Phenyl-Sepharose, ConA-Sepharose and
RP-HPLC to produce a single band on SDS-PAGE comigrating with
authentic glucocerebrosidase. The sequence obtained was consistent
with the known sequence of processed GCR (Table. 3). In this
particular analysis, the first two positions were not resolved
because some degradation occurred during sample preparation.
Correct proteolytic cleavage of a signal peptide is also confirmed
for a mouse antibody light chain molecule expressed in tobacco
leaves (35).
3TABLE 3 STRUCTURE OF THE N-TERMINUS OF rGCB N-terminal Amino Acid
Sequence X X P X I P K S F G Y rGCB from tobacco (SEQ ID NO: 35) A
R P C I P K S F G Y GCR human (SEQ ID NO: 36)
[0154] Plant rGCB Accumulates in the Leaf Intercellular Fluid. We
localized rGCB to the intercellular fluid of the leaf using the
following simple experimental design. Leaves were removed from the
plant at the petiole and slit down the midrib into two equal
halves. To obtain a total cellular homogenate, one group of
half-leaves was ground in the presence of 4 volumes of detergent
extraction buffer (100 mM potassium phosphate pH 6, 5 mM EDTA, 10
mM .beta.-mercaptoethanol and 0.5% w/v sodium taurocholate) with a
mortar and pestle. To recover the IF, the same enzyme extraction
buffer was infiltrated into the opposing group of half-leaves by
submerging the tissue and applying moderate vacuum pressure. After
draining off excess buffer, the undisrupted half-leaves were rolled
gently in Parafilm, placed in disposable tubes and the IF collected
by low-speed centrifugation. The IF fraction is quite clear and non
pigmented and can be applied directly to Phenyl Sepharose
hydrophobic resin.
[0155] The results of a typical experiment are shown in Table 4.
The increase in specific activity corresponds to a similar increase
in the amount of cross-reacting material observed in a Western blot
and is therefore not an artifact of the enzyme assay in the
different fractions. Furthermore, rGCB activity was very stable in
crude extracts using this particular detergent buffer. The increase
in specific activity can therefore be attributed to an enrichment
of rGCB in the IF relative to the whole cell homogenate. The actual
concentration of rGCB in the IF is likely to be much higher,
because PAGE analysis of the IF fraction shows some contamination
with known cytoplasmic markers. The highest specific activity we
have measured in an IF sample is 20,000 U/mg. If we assume rGCB has
the same specific activity as the human enzyme (1.5.times.10.sup.6
U/mg), this corresponds to 1.3% of the IF protein obtained by this
method.
4TABLE 4 LOCALIZATION OF rGCB TO THE INTERCELLULAR FLUID Fresh
Total Protein Total Protein rGCB Total rGCB Specific % Recovery
Weight Volume Conc. Protein Yield Conc. rGCB Yield Activity rGCB
X-Fold Sample (gr) (ml) (mg/ml) (mg) (mg/gr) (U/ml) (U) (U/gr)
(U/mg) in IF Purification Intercellular Fluid 2.48 1.9 0.24 0.45
0.18 720 1368 552 3007 22 18 Homogenate 2.08 8.1 3.89 31.48 15.13
653 5289 2543 168
[0156] Specific activity is based on the hydrolysis of 4-MUG
inhibited by 0.5 mM CBE. Units (U)=nmol/hr. Because the amount (in
nanograms) of cross reacting material observed in a quantitative
Western blot corresponds within experimental error to the amount
(in nanograms) of enzyme calculated on the basis of activity, we
believe the plant rGCB was synthesized with high specific activity.
This was a very important and favorable indirect estimate of
specific activity. The enzyme was purified to homogeneity to
measure more precisely the actual specific activity.
[0157] High Levels of rGCB Expression in Leaf Tissue Induce Gene
Silencing. The T0 individuals described in Table 4 are by
definition hemizygous. They contain various loci generated from
independent insertion events, having no corresponding insert on the
homologous chromosome. The thirteen T0 individuals from Group A
were self-pollinated and assayed for levels of enzyme expression in
the T1 generation in order to analyze the effects of gene dosage
(homozygotes versus hemizygotes) and to identify candidate T1
families for future seed increase. Kanamycin-resistant transgenic
plants were randomly selected from segregating families and
analyzed for rGCB expression. The number of probable loci was
estimated by chi-square analysis of the linked kanamycin-resistant
phenotype at >95% confidence level. There are several T1
families with a heritable mean rGCB activity in the range of
200-300 U/mg (nmol 4-MUG hydrolyzed per hour) in the total
homogenates that we have selected for further production of the
enzyme (Table 5).
5TABLE 5 EXPRESSION OF rGCB IN THE T1 GENERATION Mean Specific
Tobacco T1 Number Activity Standard Number of Cultivar Family of
Loci Units/mg Error Individuals Samsun 963 2 294 25 23 Samsun 881 1
242 22 16 MD609 920 1 205 15 38 Xanthi 902 1 202 17 5 Samsun 883 1
201 18 13 Xanthi 832 1 195 18 9 SR1 826 1 184 16 40 SR1 834 1 145 9
32 Xanthi 851 1 140 15 5 Samsun 837 1 129 16 8 Xanthi 831 1 114 21
10 Xanthi 833 1 107 12 5 Xanthi 807 1 to 2 87 12 9 Controls 40 8
20
[0158] However, of 235 T1 plants analyzed, the single individual
having the highest activity and the single observation of
completely null expression were siblings of the T1 family 826.
Moreover, extracts from 826 were also quantitatively the second
highest sample of the original 46 analyzed for enzyme activity in
the T0 generation. By Western blot, we analyzed protein extracts
from several T1 siblings of this family, including the highest (612
U/mg) and the lowest (0 U/mg) and found a clear linear correlation
between the amount of cross-reacting protein at 59 kDa and the
activity loaded in each lane. In addition to the 59 kDa band, there
were also variable amounts of cross-reacting protein at 52 kDa. In
the null individual there was only the 52 kDa protein. We never
observed this molecular weight species in the T0 extracts or in any
other T1 family. There was no evidence of proteolytic activity in
this sample as judged by mixing the null sample with high activity
extracts and analyzing by enzyme assays and Western blots after
incubation at 37.degree. C. If the apparently truncated rGCB was
derived from proteolytic cleavage, the protease activity must be
both physiologically induced and inactive under these isolation
conditions. When the null individual was self-pollinated and the T2
generation analyzed, enzyme expression reappeared as in the T1 and
T0. Our working hypothesis was that the tobacco plant is able to
limit the expression of the foreign enzyme as constitutively
expressed from this cDNA construct, and that the threshold for the
stochastic induction of this response during development occurs at
an expression level corresponding to approximately 600 U/mg
specific activity in the crude homogenate. Of the lines we created,
826 were able to produce enough mRNA to exceed this threshold in
the homozygous state.
[0159] The silencing of genes in plants is a recently described
phenomenon. Work has been done detailing a cellular surveillance
mechanism that has apparently evolved to specifically degrade
excess RNA (36). In one case, specific RNA cleavages near the
3'-end of the transcript initiate the removal of the transcript.
Our description of the silencing of rGCB above 600 U/mg is the
first association of silencing with a truncated protein, and may
well be caused by a specific mRNA (and not protein) cleavage event.
Gene silencing may determine an upper limit of expression
attainable using constitutive transgene expression.
[0160] We subcloned the cDNA for glucocerebrosidase into a
TMV-transient vector and cDNA combinations. Transcripts were
synthesized in vitro and inoculated directly onto lower leaves of
whole plants. In each case, there was an additional lag time of
about 2 weeks post-inoculation before appearance of virus in the
upper leaves of the plant and in each case the viral population no
longer carried a significant portion of the gene. We detected no
significant enzyme activity in either inoculated or systemically
infected leaves. Very recently, we detected the gene in root tissue
and in transfected protoplasts. There appears to be an
incompatibility with leaf expression under conditions of viral
amplification of the rGCB mRNA. This incompatibility selects for
loss of the sequence from the viral population.
[0161] To further investigate the nature of the leaf
incompatibility with rGCB expression, we built the construct
pBSG641. This plasmid contains the rGCB gene substituted into the
coat protein region. The remaining portion of the entire genome was
then placed under control of the 35S promoter. The promoter was
designed to initiate RNA synthesis such that the correct 5'-end of
TMV would be synthesized. A custom-designed, self-cleaving ribozyme
sequence positioned at the end of the genome yields a native 3'-end
upon cleavage. The vector was designed for synthesis of infectious
transcripts in vivo from a chromosomally integrated locus and
production of rGCB through viral amplification of subgenomic mRNA
in the cytoplasm. The vector alone without the gene for rGCB
produces a systemic but capsid-free, "naked-RNA" infection (38).
This RNA co-suppression is the subject of issued U.S. Pat. No.
5,922,602 issued Jul. 13, 1999, the disclosure of which is
incorporated herein by reference.
[0162] We introduced the construct depicted in FIG. 15 into
Agrobacterium and transformed tobacco plants as described above. In
this case many of the plant leaves displayed necrotic lesions as
transfection events randomly occurred during growth and development
and expansion of leaves. These lesions never formed on control
transformed plant lines containing vector only sequences capable of
replication. These lesions were identical in appearance to the
types of lesions induced by plant pathogens during a type of
disease resistance reaction, termed the hypersensitive response
(HR). Therefore, under conditions where we expect to accumulate
large quantities of active enzyme, an HR is signaled by some
component of the vector infection specific to rGCB. There are very
few of these so-called HR "elicitors" characterized in the
literature. Possibly the rGCB enzyme itself, or a secondary
metabolite resulting from enzymatic activity, or even rGCB RNA, may
induce the HR. In any case, we hypothesize that the HR selects for
loss of the gene from the viral RNA population. It is important to
remember that this is not a simple genetic instability phenomenon.
Under conditions where an HR is not induced, we have synthesized
many proteins using TMV-based RNA viral vectors to levels of
several percent of the total soluble cell protein without loss of
the inserted gene even after virion passage.
[0163] Expression of RGCB in Transgenic Tobacco is Robust. In
several experiments, we inoculated wild type TMV onto rGCB
containing transgenic tobacco and found a .about.1.5-2 fold
increase in the specific activity of total homogenates. It appears
that the viral infection causes an increase in promoter activity,
and/or the secretion and accumulation of active enzyme. This was an
important result, because it demonstrates that the expression was
compatible with a TMV infection, a physiologically severe stress
condition. Furthermore, in separate work, we have used chimeric TMV
particles as recombinant carriers for the production of small
peptides (31).
Conclusions
[0164] We used a wide range of gene expression tools to investigate
the accumulation of rGCB in mature tobacco plants. Our results
suggest attractive yield, quality and cost objectives can be met
with further development. We observed two independent phenomena
currently limiting the accumulation of enzyme activity in whole
plants; gene silencing in one transgenic line, and a plant leaf
hypersensitive response to transient vector mediated synthesis.
[0165] These current limitations in gene expression only serve to
underscore the advantages and utility of agriculture for
recombinant protein production. We have generated several
transgenic tobacco lines as a reliable source of biomass for the
production of high specific activity enzyme. Because the biomass is
accumulated under no sterile growth conditions and production is
inexpensively scaled to the quantities desired, it becomes feasible
to exploit a dilute but enriched source such as the intercellular
fluid fraction for industrial process development. This contrast is
most clearly summarized in Table 6.
6TABLE 6 INITAL STEPS IN THE PURIFICATION OF GLUCOCEREBROSIDASE
PLACENTA HOMOGENATE TOBACCO HOMOGENATE TOBACCO LEAF IF Specific
Specific Specific Purification Activity Activity Recovery Activity
Activity Recovery Activity Activity Recovery Procedure Units/kg
Units/mg % Units/kg Units/mg % Units/kg Units/mg % Detergent
1,510,000 375 100 1,870,000 230 100 877,000 9,967 100 Extraction
Concentration/ 707,000 9,330 47 1,540,000 14,400 82 Delipidation
Hydrophobic 554,000 147,000 36 1,242,000 82,000 74 535,000 34,547
61 Chromatography
[0166] The placental homogenate procedure is adapted from Furbish
et al., (10) starting with a 14,000.times.g sedimented material. In
a typical preparation 15-30 kg of fresh placentas were processed.
The tobacco homogenate is based on the average of 2 typical 1 kg
extractions of the leaf biomass. The IF data is from an average of
5 small scale extraction experiments (2-200 grams fresh weight),
and a single chromatography run of an IF concentrate. For
comparative purposes all yields are normalized to 1 kg.
7TABLE 7 GCB IF PILOT PROCESS Greenhouse Scale (1 kg) Field Scale
(100 kg) Specific Total Specific Total Purification Activity
Activity Recovery Purification Activity Activity Recovery
Purification Step Units/kg Units/mg % Fold Units/kg Units/mg % Fold
IF 4,153,533 20,388 100 1.0 434,927 2,745 100 1.0 Phenyl SL
3,738,180 147,813 91.4 7.25 194,722 12,960 44.4 5.0 SP Big
2,740,086 650,377 67.0 31.9 145,060 99,220 33.1 38.2 Beads
[0167] For comparative purposes all yields are normalized to 1 kg.
The greenhouse/laboratory scale process is based on an average of 2
infiltration/chromatography runs starting with 1 kilogram of fresh
weight leaf tissue.
[0168] The GenBank accession No. for glucocerebrosidase is M11080.
The field scale process is an average of 7 large scale
infiltrations consisting of 100 kilograms of fresh weight tissue.
Enzyme activity is based on the cleavage of
4-methylumbelliferylglucoside (1 Unit=1 nmol/hr). One factor
contributing to a lower apparent yield in the field on a fresh
weight basis is that rGCB is concentrated in the leaf lamina and in
the lab scale procedure the midrib was removed.
Preparation of Solutions for GCB Assay With 4-Methylumbelliferyl
.beta.-D-Glucopyranoside
[0169] 1. GCB Assay Buffer
[0170] 0.1 M Potassium Phosphate, 0.15% Triton X-100, 0.125% sodium
taurocholate (Sigma T-4009), 0.1% bovine serum albumin, 0.02%
sodium azide, pH 5.9.
[0171] Dissolve 13.6 grams of potassium phosphate monobasic
(KH.sub.2PO.sub.4) in 950 ml of distilled water. Add 1.25 g of
sodium taurocholate and 1.5 g of Triton X-100. Triton X-100 is a
very viscous liquid and should be weighed rather than pipetted in
order to achieve a reproducible buffer. Add 2 ml of 10% sodium
azide and 1 gram of bovine serum albumin (BSA). Stir until all
material has dissolved. Adjust the pH to 5.9 by the addition of a
small amount of 1 N NaOH, then bring up to 1000 ml with water.
[0172] Filter sterilize and store at 4.degree. C. This buffer is
stable for many months.
[0173] 2. Stopping Buffer
[0174] 0.1 M Glycine in 0.1 M NaOH
[0175] Dissolve 4 grams of NaOH and 7.51 grams of glycine in 1
liter of distilled water. Filter sterilize and store at 4.degree.
C. (Stable for years at 4.degree. C.).
[0176] 3. Substrate (Sigma M-3633) FW 338.3
[0177] 15 mM 4-methylumbelliferyl .beta.-D-glucopyranoside (4-MUG)
in assay buffer
[0178] Weigh out 1 gram of 4-MUG into a 500 ml Erlenmeyer flask.
Add exactly 197 ml of Assay Buffer (Substrate dilution Buffer) and
heat in a hot water bath to dissolve. Caution: Heating too
aggressively results in unacceptably high background
fluorescence.
[0179] After cooling, dispense into 5-7 ml aliquots in 15 ml
polypropylene tubes, let tubes cool to room temperature and freeze
at -20.degree. C. for later use.
[0180] 4. 125 mM Conduritol .beta.-Epoxide (CBE) (Toronto Research
C-66600)
[0181] MW=162.18
[0182] Dissolve 100 mg of CBE in 4.92 ml of 0.1 M KPO.sub.4 Buffer,
pH 6.0. Dispense into 200-500 .mu.l aliquots and store at
-20.degree. C.
[0183] 5. 0.1 M KPO.sub.4 Buffer, pH 6.0
[0184] 1.75 ml of 0.5 M KH.sub.2PO.sub.4 (Solution A) 87.5 mM
[0185] 0.246 ml of 0.5 M K.sub.2HPO.sub.4 (Solution B) 12.3 mM
[0186] Add distilled water to 10 ml.
[0187] Reagents:
[0188] Potassium Phosphate Monobasic (KH.sub.2PO.sub.4) Fisher
Scientific P285
[0189] Potassium Phosphate Dibasic (K.sub.2HPO.sub.4) Fisher
Scientific P288
[0190] TritonX-100 Sigma X-100
[0191] Sodium Taurocholic Acid Sigma T-4009
[0192] Bovine Serum Albumin, Fraction V Sigma A-2153
[0193] Sodium Azide Sigma S-2002
[0194] Glycine Sigma G-4392
[0195] Sodium Hydroxide Pellets Fisher Scientific S318
[0196] Conduritol .beta.-epoxide (CBE) Toronto Research C-66600 MW
=162.18
[0197] 4-Methylumbelliferyl .beta.-D-glucopyranoside
(.beta.-D-glucoside) Sigma M-3633
GCB Assay With 4-Methylumbelliferyl .beta.-D-Glucopyranoside
(MUG)
[0198] 1.0 PURPOSE
[0199] To measure the amount of glucocerebrosidase activity from
transgenic tobacco plants following infiltration and/or
homogenization of the tissue. Measurement of fluorometric activity
requires an accurate determination and relationship between
fluorescence of the released methylumbelliferone and its
concentration under the assay conditions.
[0200] SCOPE
[0201] This is an inhibition assay. CBE inhibits human GCB. The
fluorescent value used to calculate activity is based on the
difference in values with and without inhibitor present. The
fluorescent value with CBE (plant glucosidase) is subtracted from
the fluorescent value without inhibitor which is both plant and
human GCB activity. The difference being the value for human GCB
expressed in the transgenic plants. The assay is carried out using
5 .mu.l of sample with 45 .mu.l assay buffer +/-CBE at 37.degree.
C. This means that 2 tubes are needed per sample. This procedure is
applicable to the Glucocerebrosidase assay procedure requiring a
methylumbelliferone standard curve.
[0202] EQUIPMENT
[0203] Fluorometer (St. John Associates Fluoro-Tec 2001A with
KV-418 filter and 365 nm interference filter)
[0204] 10.times.75 mm cuvettes (St. John Associates)
[0205] Water Bath
[0206] Test Tubes 13.times.100 mm glass (VWR or equivalent)
[0207] 4-Methylumbelliferone (Sigma M-1381)
[0208] Pipettes and pipette tips, 5 .mu.l-1 ml (Rainin or
equivalent)
[0209] 1.5 ml microfuge tubes
[0210] PRECAUTIONS
[0211] The fluorometer should be warmed up for at least 20 minutes
prior to reading samples. The power switch should be left on at all
times. If the power switch was turned off it may take longer (up to
1 hour) for the instrument to stabilize.
[0212] Be certain to put away all reagents under proper storage
conditions after reading assays. Any left over fluorescent
substrates and CBE stock should be returned to -20.degree. C. The
fluorescent substrate and CBE stock can be frozen and thawed
numerous times without any breakdown of the reagents. Do not save
any substrate or assay buffer to which you added CBE. These should
be discarded. You should only make up enough reagent with the
inhibitor (CBE) that you currently need.
[0213] PROCEDURE
[0214] 1. Turn on the water bath and check to be certain the
temperature is set to 37.degree. C.
[0215] 2. Turn on fluorometer to warm up by flipping up the PMT
switch. It should be turned on at least 15-20 minutes before taking
readings. If the power switch was turned off it may take longer (up
to 1 hour) for the instrument to stabilize.
[0216] 3. Remove assay buffer from refrigerator and CBE from
-20.degree. C. freezer. Thaw CBE on ice.
[0217] 4. Defrost the appropriate amount of methylumbelliferyl
.beta.-D-glucopyranoside (MUG) substrate. You need 400 .mu.l of MUG
for each sample (+/-CBE). Place tubes in 37.degree. C. H.sub.2O
bath for approximately 10 minutes to get MUG into solution. Note:
There may be a small amount of insoluble material (MUG) in each
tube even after the 10 minutes at 37.degree. C. Vortex before use.
Keep at room temperature until ready to use.
[0218] 5. Remove enough GCB Assay Buffer from the stock bottle that
will be needed for your samples and transfer to a 15 ml tube. Add
appropriate amount of 125 mM stock solution of CBE to assay buffer
so the final concentration is 0.55 mM CBE. CBE stock is stored at
-20.degree. C. Thaw some CBE on ice now if you have not already
done so. The assay buffer +CBE may be kept at room temperature if
assays will be completed within 1 hour otherwise store solutions
with CBE on ice.
[0219] Note: you want the final conc. of CBE in the assay to be 0.5
mM, you are adding 45 .mu.l of buffer to 5 .mu.l of sample so the
starting conc. of CBE should be 0.55 mM.
[0220] Example: Add 8.8 .mu.l of 125 mM CBE stock solution to 1.991
ml of assay buffer to equal 0.55 mM CBE in assay buffer. This is
enough buffer to carry out at least 40 assays.
[0221] 6. Label two 13.times.100 mM glass tubes for each sample to
be assayed with a number and the same number and a "+" sign. (1,
1+, 2, 2+, etc). Tubes with "+" contain CBE, tubes with just a
number will not have CBE added to the assay buffer or MUG.
Carry Out the Following Steps on Ice
[0222] 7. Place numbered tubes in white racks and place in
Styrofoam ice chest filled with enough ice and H.sub.2O (Ice Bath)
to cover the volume of fluid in these tubes.
[0223] 8. Add 45 .mu.l assay buffer to all the tubes with numbers
only.
[0224] Add 45 .mu.l of assay buffer +CBE to all the "+" tubes.
[0225] Place pipette tip in bottom of tube to deliver assay buffer
to bottom of tube.
[0226] 9. Remove metal tip ejector from P-10 pipetman (so pipetman
will reach bottom of tube) and pipette 5 .mu.l of sample into each
set of appropriate tubes of assay buffer (one "+" and one tube with
a number only (-CBE) for each sample or twice this number if done
in duplicate). Place pipette tip in bottom of tube to deliver
sample directly into assay buffer. This is very important since you
will be pipetting small volumes into these tubes.
[0227] Be sure to include a Buffer sample to blank the fluorometer.
This will contain 5 .mu.l of the same buffer that the samples are
in.
[0228] Note: See Dilution of Enzymes if your sample is too
concentrated to read in the fluorometer. Basically, dilute your
sample 1:5, 1:10, etc. in assay buffer, mix well, pulse in
microfuge and add 5 .mu.l of diluted sample to assay buffer above.
You should only need 5-10 .mu.l of your sample for the
dilutions.
[0229] 10. Incubate tubes at 37.degree. C. for 10 minutes then
place tubes immediately on ice.
[0230] 11. Aliquot the volume of MUG needed for "+" tube assays
(200 .mu.l per assay +CBE) into a 15 ml polypropylene tube and add
CBE stock to a final concentration of 0.5 mM.
[0231] -4 .mu.l of 125 mM CBE per 1 ml MUG in assay buffer=0.5 mM
CBE
[0232] 12. Add MUG+/-CBE to appropriate tubes.
[0233] Add 200 .mu.l of MUG without CBE to all the tubes with a
number only (-CBE).
[0234] Add 200 .mu.l of MUG+CBE to all the "+" tubes.
[0235] Place a plastic cap over each tube. Vortex sample and place
back on ice.
[0236] 13. Transfer all tubes to 37.degree. C. H.sub.2O bath.
Incubate at 37.degree. C. for 15 minutes with shaking. Set the
shaker between the #4-6 settings.
[0237] 14. Transfer tubes to ice bath. Quickly add 1 ml of stopping
solution to each sample. Remove rack of samples from ice.
[0238] 15. You are now ready to read samples in fluorometer.
[0239] 16. Be certain to put away all reagents under proper storage
conditions after reading assays. Any left over fluorescent
substrates should be returned to -20.degree. C. The fluorescent
substrate and CBE stock can be frozen and thawed numerous times
without any breakdown of the reagents. Do not save any substrate or
assay buffer to which you added CBE. These should be discarded. You
should only make up enough reagent with the inhibitor (CBE) that
you currently need.
Dilution of Samples for Assays
[0240] Routine dilutions of samples should be carried out on ice
using the GCB Assay Buffer described above to maintain enzyme
activity. Generally a 1:5 or 1:10 dilution of the sample is
sufficient. Dilutions should be carried out in a microfuge tube.
(Example: 1: 10 dilution: 5 .mu.l of sample in 45 .mu.l of assay
buffer, mix well and pulse sample in microfuge to bring all of the
sample to the bottom of the tube). You should only need 5-10 .mu.l
of your sample for the dilutions.
EXAMPLE 2
Extraction of Glucocerebrosidase Protein
[0241] Glucocerebrosidase (GCB), either derived from human
placental tissue or a recombinant form from Chinese hamster ovary
cells (CHO), is presently used in an effective but costly treatment
of the heritable metabolic storage disorder known as Gaucher
disease. We combined a dual promoter from Cauliflower Mosaic Virus
(35S), a translational enhancer from Tobacco Etch Virus and a
polyadenylation region from the nopaline synthetase gene of
Agrobacterium tumefaciens with the native human GCB cDNA to create
plasmid pBSG638. These expression elements are widely used to
provide the highest possible constitutive expression of nuclear
encoded genes in plants. The CaMV promoter is further inducible by
stress or wound treatment.
[0242] Using a standard Agrobacterium-mediated transformation
method, we regenerated 93 independent kanamycin-resistant
transformants from leaf discs of four different tobacco cultivars
(the TO generation). In Western blots of total protein extracts,
cross-reacting antigen was detected in 46 of these TO individuals
with antibody raised against human glucocerebrosidase. Specificity
of the plant-expressed recombinant enzyme was confirmed by
hydrolysis of 14C-radiolabeled glucosylceramide. According to these
expression results the rGCB positive transformants were ranked into
moderate (A), low (B) and negligible (C) activity groups.
[0243] We also found reaction conditions to preferentially inhibit
rGCB enzyme activity in the presence of plant glucosidases using
the suicide substrate conduritol B-epoxide (CBE). Total glucosidase
activity, and rGCB activity were measured by hydrolysis of the
fluorescent substrate 4-methylumbelliferylglucopyranoside (4-MUG)
with and without CBE. Leaves from plants transfected with the
vector TT01A 103L were removed at the petiole and slit down the
midrib into two equal halves. To obtain a total cellular
homogenate, one group of half-leaves was ground in the presence of
4 volumes of detergent extraction buffer (100 mM potassium
phosphate p(I 6, 5 mM EDTA, 10 mM, B-mercaptoethanol and 0.5% w/v
sodium taurocholate) with a mortar and pestle after freezing the
tissue in liquid nitrogen. To recover the intercellular fluid (IF),
the same enzyme extraction buffer was infiltrated into the opposing
group of half-leaves by submerging the tissue and applying moderate
vacuum pressure (500 mm Hg). After draining off excess buffer, the
undisrupted half-leaves were rolled gently in Parafilm, placed in
disposable tubes and the intercellular fluid (IF) was collected by
low-speed centrifugation (1,000 g). The weight of buffer recovered
from the infiltrated leaf tissue is recorded and varies from
approximately one-half to equal the original weight of the leaf.
GCB expression in IF extracts was quantified using a commercially
available enzyme assay reagents and protocol. Total protein was
determined by the method described by Bradford (Bradford, M. Anal.
Biochem 72:248, 1976).
[0244] We have demonstrated that active recombinant GCB may be
successfully extracted from the intercellular fluid of plant leaves
using the present method. The GCB assay is based on MUG hydrolysis
in the presence of CBE. The IF method results in a recovery of 22%
of the total GCB activity of the leaf at a 18-fold enrichment
relative to an extract obtained by homogenization (H). The GCB
production results may be improved by optimizing the time
post-inoculation with the viral vector and minimizing the
contaminating viral coat protein from the intercellular
fraction.
EXAMPLE 3
Laboratory Pilot Scale Purification of Glucocerebrosidase From the
Intercellular Fluid of Tobacco
[0245] MD609 leaf tissue (1-2 kilograms) of transgenic tobacco
expressing the lysosomal enzyme glucocerebrosidase was harvested,
the mid vein removed and the tissue weighed. Tissue was submerged
with 2-4 volumes of buffer (0.1 M KPO.sub.4 buffer, pH 6.0, 5 mM
EDTA, 0.5% taurocholic acid, 10 mM .beta.-mercaptoethanol) in an
infiltration vessel that accommodates several kilograms of leaf
tissue at one time. A perforated metal plate was placed on top of
tissue to weigh down the tissue. A vacuum of 25-27 in. Hg was
applied for 1-2 minutes.times.3. The vacuum was released between
subsequent applications. Tissue was rotated and the vacuum
reapplied to achieve complete infiltration. Multiple applications
of the vacuum without isolating the intercellular fluid constitutes
a single infiltration procedure. An indication of complete
infiltration is a distinct darkening in color of the underside of
the leaf tissue. Excess buffer on the tissue was drained. The
intercellular fluid was released from the tissue by centrifuging
the tissue in a basket rotor at 4200 RPM (2500.times.g) for 10
minutes. The intercellular fluid was collected using an aspirator
hooked up to a vacuum pump (IF-1). Alternatively, the leaf tissue
can be re-infiltrated by placing the leaves back in the
infiltration vessel in the same buffer used above and the process
repeated (IF-2). The second infiltration does not require as many
applications of the vacuum. Additionally, the buffer may be drained
from the infiltration vessel (spent buffer) and pooled with the 1st
and 2nd IF fractions. Collectively, IF-1, IF-2 and Spent Buffer
constitutes the IF pool. The volume of intercellular fluid
collected from the infiltrated leaf tissue was between 50-100% of
the leaf tissue by weight depending on the number of infiltrations
carried out.
[0246] Recombinant GCB was purified by loading the dilute
intercellular (feed stream) directly on a Pharmacia Streamline 25
column containing Phenyl Streamline resin. Expanded bed
chromatography enabled us to capture, clarify and concentrate our
protein in one step without the need for centrifugation and/or
microfiltration steps. The column was equilibrated and washed until
UV-signal on recorder returned to baseline with 25 mM citrate, 20%
ethylene glycol, pH 5.0 and then eluted with 25 mM citrate, 70%
ethylene glycol. The eluted material was further purified on a
cation exchange resin, SP Big Beads (Pharmacia), equilibrated in 25
mM citrate, 75 mM NaCl, pH 5.0. GCB was eluted with either a step
gradient of 25 mM citrate, 0.5 M NaCl, 10% ethylene glycol, pH 5.0
or a linear gradient of 75 mM-0,4 M NaCl in 25 mM citrate, pH 5.0.
All chromatography steps were carried out at room temperature.
[0247] Using the suicide substrate, conduritol B-epoxide (CBE),
inhibition of recombinant glucocerebrosidase (rGCB) activity in the
presence of plant glucosidases was achieved. Enzyme activity was
measured at 37.degree. C. in a reaction mixture containing 5 mM
methylumbelliferyl .beta.-D glucoside, 0.1 M Potassium Phosphate,
0.15% Triton-X100, 0.125% sodium taurocholate, 0.1% bovine serum
albumin, pH 5.9 with and without CBE. Total glucosidase activity
and rGCB activity were measured by hydrolysis of the fluorescent
substrate 4-methylumbelliferyl glucopyranoside. One unit of
activity is defined as the amount of enzyme required to catalyze
the hydrolysis of 1 nmol of substrate per hour. Total protein was
determined using the Bio-Rad Protein Assay based on the method of
Bradford (Bradford, M. Anal. Biochem. 72:248; 1976).
[0248] Typically from 1 kilogram of leaves where IF-1 alone was
collected we obtained 4 million unites of GCB at a specific
activity of 20,000. The Units/kg increased to 6 million with a
lower specific activity of 10,000 when IF Pool was collected (IF-1,
IF-2 and spent buffer). For more information on these experiments,
see U.S. Ser. Nos. 09/132,989 and 09/500,554. The disclosures of
which are incorporated herein by reference.
EXAMPLE 4
Ultrafiltration/Concentration of Intercellular Fluid From Tobacco
Expressing Glucocerebrosidase
[0249] 2.3 kilograms of MD609 leaf tissue from transgenic tobacco
expressing the lysosomal enzyme glucocerebrosidase was harvested,
the mid vein removed and the tissue weighed. Tissue was submerged
with 2-4 volumes of buffer (0.1 M KPO.sub.4 buffer, pH 6.0, 5 mM
EDTA, 0.5% taurocholic acid, 10 mM .beta.-mercaptoethanol) in an
infiltration vessel that accommodates several kilograms of leaf
tissue at one time. A perforated metal plate was placed on top of
tissue to weigh down the tissue. A vacuum of 25-27 in. Hg was
applied for 1-2 minutes.times.3. The vacuum was released between
subsequent applications. Tissue was rotated and the vacuum
reapplied to achieve complete infiltration. Excess buffer on the
tissue was drained. The intercellular fluid was released from the
tissue by centrifuging the tissue in a basket rotor at 4200 RPM
(2500.times.g) for 10 minutes. The intercellular fluid was
collected using an aspirator hooked up to a vacuum pump (IF-1). The
leaf tissue was re-infiltrated by placing the leaves back in the
infiltration vessel in the same buffer used above and the process
repeated (IF-2). The buffer was drained from the infiltration
vessel (spent buffer) and pooled with the 1st and 2nd IF fractions.
Collectively, IF-1, IF-2 and Spent Buffer constitutes the IF pool.
The IF pool was filtered through Miracloth and then concentrated 6
fold by passing the IF pool through a 1 sq. ft. spiral membrane
(30K molecular weight cutoff) using an Amicon RA 2000 concentrator
equipped with an LP-1 pump.
[0250] Using the suicide substrate, conduritol .beta.-epoxide
(CBE), inhibition of recombinant glucocerebrosidase (rGCB) activity
in the presence of plant glucosidases was achieved. Enzyme activity
was measured at 37.degree. C. in a reaction mixture containing 5 mM
methylumbelliferyl .beta.-D glucoside, 0.1 M Potassium Phosphate,
0.15% Triton-X100, 0.125% sodium taurocholate, 0.1% bovine serum
albumin, pH 5.9 with and without CBE. Total glucosidase activity
and rGCB activity were measured by hydrolysis of the fluorescent
substrate 4-methylumbelliferyl glucopyranoside. One unit of
activity is defined as the amount of enzyme required to catalyze
the hydrolysis of 1 nmol of substrate per hour. Total protein was
determined using the Bio-Rad Protein Assay based on the method of
Bradford (Bradford, M. Anal. Biochem. 72:248; 1976).
EXAMPLE 5
Pilot Scale Purification of Glucocerebrosidase From the
Intercellular Fluid of Field Grown Tobacco
[0251] 100 kilograms of MD609 leaf tissue from transgenic tobacco
expressing the lysosomal enzyme glucocerebrosidase was harvested
from the field each day for a period of two weeks. The tissue was
stripped off the stalks by hand and weighed. Five kilograms of
leaves were placed into polyester bags (Filtra-Spec, 12-2-1053) and
four.times.5 kg bags of leaves were placed into a metal basket. The
metal basket containing the leaf material was placed in a 200 L
Mueller vacuum tank containing .about.100 liters of buffered
solution (0.1 KPO.sub.4 buffer, pH 6.0, 5 mM EDTA, 0.5% taurocholic
acid, 10 mM B-mercaptoethanol). A 70 lb. stainless steel plate was
placed over the leaves/bags to assure complete immersion. A vacuum
was pulled 27 in. Hg, held for 1 minute and then rapidly released.
This vacuum infiltration was repeated for a total of two cycles.
Multiple applications of the vacuum without isolating the
intercellular fluid constitutes a single infiltration procedure. An
indication of complete infiltration is a distinct darkening in
color of the underside of the leaf tissue. Following the vacuum
infiltrations, the leaves and basket were removed from the vacuum
tank. The bags containing the vacuum infiltrated leaves were
allowed to gravity drain surface buffer for .about.10 minutes,
prior to centrifugation. The intercellular fluid (IF) was recovered
from the vacuum infiltrated leaves by centrifugation
(1,800.times.g, 30 minutes) using a Heine basket centrifuge (bowl
dimensions, 28.0 inches diameter.times.16.5 inches). Collected IF
was filtered through a 50 uM cartridge filter and then stored at
4.degree. C., until the entire 100 kilograms of tissue was
infiltrated. This process was repeated with the next set of four 5
kg bags (5.times.20 Kg cycles total) until all the tissue was
infiltrated. Additional buffer was added during each infiltration
cycle to completely immerse the tissue. Alternatively, the leaf
tissue can be re-infiltrated by placing the leaves back in the
infiltration vessel in the same buffer used above and the process
repeated (IF-2). Additionally, the buffer may be drained from the
infiltration vessel (spent buffer) and may be pooled with the 1st
and 2nd IF fractions. Collectively, IF-1, IF-2 and Spent Buffer
constitutes the IF pool. The volume of intercellular fluid
collected from the infiltrated leaf tissue was between 42-170% of
the leaf tissue by weight depending on the number of infiltrations
carried out.
[0252] Recombinant GCB was purified by loading the dilute
intercellular (feed stream) directly on a Pharmacia Streamline 200
column containing Phenyl Streamline resin. Expanded bed
chromatography enabled us to capture, clarify and concentrate our
protein in one step without the need for centrifugation and/or
microfiltration steps. The column was equilibrated and washed until
UV-signal on recorder returned to baseline with 25 mM citrate, 20%
ethylene glycol, pH 5.0 and then eluted with 25 mM citrate, 70%
ethylene glycol. The eluted material was sterile filtered by
passing the eluted material through a 1 sq. ft. 0.8 um Sartoclean
GF capsule followed by a 1 sq. ft. 0.2 um Sartobran P sterile
filter (Sartorius, Corp.) and stored at 4.degree. C. until the next
chromatography step. The eluted material from 4-5 days of Phenyl
Streamline chromatography runs was pooled together and further
purified on a cation exchange resin, SP Big Beads (Pharmacia),
equilibrated in 25 mM citrate, 75 mM NaCl, pH 5.0. GCB was eluted
with a step gradient of 25 mM citrate, 0.4 M NaCl, 10% ethylene
glycol, pH 5.0. All chromatography steps were carried out at room
temperature. The eluted material was sterile filtered by passing
the eluted material through a 1 sq. ft. 0.8 um Sartoclean GF
capsule followed by a 1 sq. ft. 0.2 um Sartobran P sterile filter
(Sartorius, Corp.) and stored at 4.degree. C.
[0253] Using the suicide substrate, conduritol .beta.-epoxide
(CBE), inhibition of recombinant glucocerebrosidase (rGCB) activity
in the presence of plant glucosidases was achieved. Enzyme activity
was measured at 37.degree. C. in a reaction mixture containing 5 mM
methylumbelliferyl .beta.-D glucoside, 0.1 M Potassium Phosphate,
0.15% Triton-X100, 0.125% sodium taurocholate, 0.1% bovine serum
albumin, pH 5.9 with and without CBE. Total glucosidase activity
and rGCB activity were measured by hydrolysis of the fluorescent
substrate 4-methylumbelliferyl glucopyranoside. Total protein was
determined using the Bio-Rad Protein Assay based on the method of
Bradford (Bradford, M. Anal. Biochem. 72:248; 1976).
[0254] Typically from 1 kilogram of field grown tobacco, expressing
GCB, where IF-1 alone was collected we obtained 435,000 units of
GCB at a specific activity of 2,745. The Units/kg increased to
755,000 with a specific activity of 3,400 when IF Pool was
collected (IF-1, IF-2 and spent buffer).
EXAMPLE 6
Total GCB (IF vs. Homogenate) in "GCB Field Test Virus"
[0255] 100 kilograms of MD609 leaf tissue from transgenic tobacco
expressing the lysosomal enzyme glucocerebrosidase was harvested
from the field each day for a period of two weeks. The tissue was
stripped off the stalks by hand and weighed. Five kilograms of
leaves were placed into polyester bags (Filtra-Spec, 12-2-1053) and
four.times.5 kg bags of leaves were placed into a metal basket. The
metal basket containing the leaf material was placed in a 200 L
Mueller vacuum tank containing .about.100 liters of buffered
solution (0.1 KPO.sub.4 buffer, pH 6.0, 5 mM EDTA, 0.5% taurocholic
acid, 10 mM .beta.-mercaptoethanol). A 70 lb. stainless steel plate
was placed over the leaves/bags to assure complete immersion. A
vacuum was pulled 27 in. Hg, held for 1 minute and then rapidly
released. This vacuum infiltration was repeated for a total of two
cycles. Following the vacuum infiltrations, the leaves and basket
were removed from the vacuum tank. The bags containing the vacuum
infiltrated leaves were allowed to gravity drain surface buffer for
.about.10 minutes, prior to centrifugation. The intercellular fluid
(IF) was recovered from the vacuum infiltrated leaves by
centrifugation (1,800.times.g, 30 minutes) using a Heine basket
centrifuge (bowl dimensions, 28.0 inches diameter.times.16.5
inches). Collected IF was filtered through a 50 uM cartridge filter
and then stored at 4.degree. C., until the entire 100 kilograms of
tissue was infiltrated. This process was repeated with the next set
of four 5 kg bags (5.times.20 Kg cycles total) until all the tissue
was infiltrated. Additional buffer was added during each
infiltration cycle to completely immerse the tissue. In order to
evaluate how much enzyme was recovered in the intercellular fluid,
the tissue from which the intercellular fluid was isolated was then
homogenized in a Waring blender with 4 volumes of the same
infiltration buffer as above, centrifuged and the supernatant
assayed for enzyme activity.
EXAMPLE 7
Chops Experiment
[0256] An experiment was carried out where 100 kilograms of MD609
leaf tissue of transgenic tobacco expressing the lysosomal enzyme
glucocerebrosidase was harvested off the stalks by hand, weighed
and chopped into small pieces to increase the surface area for
buffer infiltration. Five kilograms of leaves were placed into
polyester bags (Filtra-Spec, 12-2-1053) and four.times.5 kg bags of
leaves were placed into a metal basket. The metal basket containing
the leaf material was placed in a 200 L Mueller vacuum tank
containing .about.100 liters of buffered solution (0.1 KPO.sub.4
buffer, pH 6.0, 5 mM EDTA, 0.5% taurocholic acid, 10 mM
.beta.-mercaptoethanol). A 70 lb. stainless steel plate was placed
over the leaves/bags to assure complete immersion. A vacuum was
pulled 27 in. Hg, held for 1 minute and then rapidly released. This
vacuum infiltration was repeated for a total of two cycles.
Following the vacuum infiltrations, the leaves and basket were
removed from the vacuum tank. The bags containing the vacuum
infiltrated leaves were allowed to gravity drain surface buffer for
.about.10 minutes, prior to centrifugation. The intercellular fluid
(IF) was recovered from the vacuum infiltrated leaves by
centrifugation (1,800.times.g, 30 minutes) using a Heine basket
centrifuge (bowl dimensions, 28.0 inches diameter.times.16.5
inches). Collected IF was filtered through a 50 uM cartridge filter
and then stored at 4.degree. C., until the entire 100 kilograms of
tissue was infiltrated. This process was repeated with the next set
of four 5 kg bags (5.times.20 Kg cycles total) until all the tissue
was infiltrated. Additional buffer was added during each
infiltration cycle to completely immerse the tissue. In order to
evaluate how much enzyme was recovered in the intercellular fluid,
the tissue from which the intercellular fluid was isolated was then
homogenized in a Waring blender with 4 volumes of the same
infiltration buffer as above, centrifuged and the supernatant
assayed for enzyme activity.
[0257] Recombinant GCB was purified by loading the dilute
intercellular (feed stream) directly on a Pharmacia Streamline 200
column containing Phenyl Streamline resin. The column was
equilibrated and washed until UV-signal on recorder returned to
baseline with 25 mM citrate, 20% ethylene glycol, pH 5.0 and then
eluted with 25 mM citrate, 70% ethylene glycol. All chromatography
steps were carried out at room temperature Table 10 below contains
data from the chops experiment.
EXAMPLE 8
Pilot Scale of Purification of Alpha Galactosidase From the
Intercellular Fluid of Nicotiana Benthamiana
[0258] Young actively growing Nicotiana benthamiana plants were
inoculated with infectious transcripts of a recombinant plant viral
construct containing the lysosomal enzyme .alpha. galactosidase
gene. Systemically infected leaf tissue (1-2 kilograms) was
harvested from Nicotiana benthamiana expressing .alpha.
galactosidase 14 days post inoculation. The tissue was weighed and
submerged with 2-4 volumes of buffer (25 mM Bis Tris Propane
Buffer, pH 6.0, 5 mM EDTA, 0.1 M NaCl, 10 mM
.beta.-mercaptoethanol) in an infiltration vessel that can
accommodate several kilograms of leaf tissue at one time. A
perforated metal plate was placed on top of tissue to weigh down
the tissue. A vacuum of 25-27 in. Hg was applied for 30 seconds and
then quickly released. The tissue was rotated and the vacuum
reapplied to achieve complete infiltration which was confirmed by a
distinct darkening in color of the underside of the leaf tissue.
Excess buffer on the tissue was drained. The intercellular fluid
was released from the tissue by centrifuging the tissue in a basket
rotor at 3800 RPM (2100.times.g) for 10-15 minutes. The
intercellular fluid was collected using an aspirator hooked up to a
vacuum pump. In some instances only infected leaf tissue was
harvested. Alternatively, petioles and stems have been harvested
along with the leaf tissue for infiltration. The mid vein was not
removed from the tissue prior to infiltration.
[0259] Alpha galactosidase was purified by loading the dilute
intercellular (fed stream) directly onto a Pharmacia Streamline 25
column containing Butyl Streamline resin. Expanded bed
chromatography enabled us to capture, clarify and concentrate our
protein in one step without the need for centrifugation and/or
microfiltration steps. The column was equilibrated and washed until
UV-signal on recorder returned to baseline with 25 mM Bis Tris
Propane, pH 6.0 20% (NH.sub.4).sub.2S04 and then eluted with 25 mM
Bis Tris Propane, pH 6.0. The eluted material was further purified
on Hydroxyapatite equilibrated with 1 mM NaPO.sub.4 Buffer, 5%
glycerol, pH 6.0 and eluted with either a 1-250 mM NaPO.sub.4
buffer, 5% glycerol, pH 6.0 linear gradient or a step gradient. All
chromatography steps were carried out at room temperature.
[0260] Alpha galactosidase activity was measured by hydrolysis of
the fluorescent substrate 4-methylumbelliferyl a-D
galactopyranoside. Enzyme activity was measured at 37.degree. C. in
a reaction mixture containing 5 mM methylumbelliferyl a-D
galactopyranoside, 0.1 M Potassium Phosphate, 0.15% Triton-X100,
0.125% sodium taurocholate, 0.1% bovine serum albumin, pH 5.9.
Total protein was determined using the Bio-Rad Protein Assay based
on the method of Bradford (Bradford, M. Anal. Biochem. 72: 248;
1976).
[0261] From 1 kilogram of leaves, we typically obtain between
140-160 million units of .alpha. galactosidase at a specific
activity of 800,000 following a single infiltration procedure
(IF-1). Table 11 below contains data that is representative of
several experiments.
EXAMPLE 9
Pilot Scale Purification of Glucocerebrosidase From the
Intercellular Fluid of Field Grown Tobacco
[0262] Transgenic tobacco (MD609) expressing the lysosomal enzyme
glucocerebrosidase was mechanically inoculated with a tobacco
mosaic virus derivative containing a coat protein loop fusion,
TMV291, (Turpen, et.al., 1995, Bio/Technology 13: 23-57). A total
of 100 Kg of transgenic, transfected leaf tissue was harvested from
the field, five weeks post inoculation. The tissue was stripped off
the stalks by hand and weighed. Five kilograms of leaves were
placed into polyester bags (Filtra-Spec, 12-2-1053) and
four.times.5 kg bags of leaves were placed into a metal basket. The
metal basket containing the leaf material was placed in a 200 L
Mueller vacuum tank containing .about.100 liters of buffered
solution (0.1 KPO.sub.4 buffer, pH 6.0, 5 mM EDTA, 0.5% taurocholic
acid, 10 mM .beta.-mercaptoethanol). A 70 lb. stainless steel plate
was placed over the leaves/bags to assure complete immersion. A
vacuum was pulled 27 in. Hg, held for 1 minute and then rapidly
released. This vacuum infiltration was repeated for a total of two
cycles. Multiple applications of the vacuum without isolating the
intercellular fluid constitutes a single infiltration procedure. An
indication of complete infiltration is a distinct darkening in
color of the underside of the leaf tissue. Following the vacuum
infiltrations, the leaves and basket were removed from the vacuum
tank. The bags containing the vacuum infiltrated leaves were
allowed to gravity drain surface buffer for .about.10 minutes,
prior to centrifugation. The intercellular fluid (IF) was recovered
from the vacuum infiltrated leaves by centrifugation
(1,800.times.g, 30 minutes) using a Heine basket centrifuge (bowl
dimensions, 28.0 inches diameter.times.16.5 inches). Collected IF
was filtered through a 50 uM cartridge filter and then stored at
4.degree. C., until the entire 100 kilograms of tissue was
infiltrated. This process was repeated with the next set of four 5
kg bags (5.times.20 Kg cycles total) until all the tissue was
infiltrated. Additional buffer was added during each infiltration
cycle to completely immerse the tissue.
[0263] Recombinant GCB was purified by loading the dilute
intercellular (feed stream) directly on a Pharmacia Streamline 200
column containing Phenyl Streamline resin. Expanded bed
chromatography enabled us to capture, clarify and concentrate our
protein in one step without the need for centrifugation and/or
microfiltration steps. The column was equilibrated and washed until
UV-signal on recorder returned to baseline with 25 mM citrate, 20%
ethylene glycol, pH 5.0 and then eluted with 25 mM citrate, 70%
ethylene glycol. The eluted material was sterile filtered by
passing the eluted material through a 1 sq. ft. 0.8 um Sartoclean
GF capsule followed by a 1 sq. ft. 0.2 um Sartobran P sterile
filter (Sartorius, Corp.) and stored at 4.degree. C. until the next
chromatography step. The eluted material from 4-5 days of Phenyl
Streamline chromatography runs was pooled together and further
purified on a cation exchange resin, SP Big Beads (Pharmacia),
equilibrated in 25 mM citrate, 75 mM NaCl, pH 5.0. GCB was eluted
with a step gradient of 25 mM citrate, 0.4 M NaCl, 10% ethylene
glycol, pH 5.0. All chromatography steps were carried out at room
temperature. The eluted material was sterile filtered by passing
the eluted material through a 1 sq. ft. 0.8 um Sartoclean GF
capsule followed by a 1 sq. ft. 0.2 um Sartobran P sterile filter
(Sartorius, Corp.) and stored at 4.degree. C.
[0264] Using the suicide substrate, conduritol .beta.-epoxide
(CBE), inhibition of recombinant glucocerebrosidase (rGCB) activity
in the presence of plant glucosidases was achieved. Enzyme activity
was measured at 37.degree. C. in a reaction mixture containing 5 mM
methylumbelliferyl .beta.-D glucoside, 0.1 M Potassium Phosphate,
0.15% Triton-X100, 0.125% sodium taurocholate, 0.1% bovine serum
albumin, pH 5.9 with and without CBE. Total glucosidase activity
and rGCB activity were measured by hydrolysis of the fluorescent
substrate 4-methylumbelliferyl glucopyranoside. Total protein was
determined using the Bio-Rad Protein Assay based on the method of
Bradford (Bradford, M. Anal. Biochem. 72:248; 1976). Table 7
contains the GCB recovery data from TMV transfected plant
tissue.
[0265] The quantity of virus present in IF extracted leaf tissue
was determined using homogenization and polyethylene glycol
precipitation methods. In addition, the amount of virus present in
the pooled, intercellular fluid was determined by direct
polyethylene glycol precipitation. Final virus yields from
precipitated samples was determined spectrophotometrically by
absorbance at 260 nm.
8 TABLE 8 Sample Virus Titer IF extracted leaf tissue 0.206 mg
virus/g fresh weight Pooled IF 0.004 mg virus/g fresh weight, 0.010
mg virus/ml IF
EXAMPLE 10
MAKING rGAL-A ENZYME
[0266] Experimental Results. Achieving high steady-state mRNA
levels is a prerequisite for vector development. However, there are
many complex biochemical and host compatibility interactions that
ultimately determine the overall performance of a heterologous
expression system for a given protein. For this reason, we
initiated some preliminary experiments to test the potential for
RNA-viral mediated synthesis of active rGal-A in whole plants.
[0267] In order to ensure efficient delivery of rGal-A into the
lumen of the plant endoplasmic reticulum, we fused the Gal-A cDNA
(31) to a plant signal peptide sequence derived from rice
.alpha.-amylase gene (32,33). We also hypothesized that addition of
an ER-retention signal (SEKDEL) (SEQ ID NO:37) might prolong the
resident time of the recombinant protein in the ER to increase the
fraction of correctly assembled and catalytically active enzyme
under extreme conditions of protein synthesis. These constructs
were subcloned into the viral vector TTODA, a chimera between
tobacco and tomato mosaic viruses (FIG. 1). Transcripts were
prepared in vitro and inoculated onto the lower leaves of whole
plants (Nicotiana benthamiana). 1-3 weeks after inoculation, leaves
were weighed, rolled in a strip of Parafilm and placed in a
disposable chromatography column and submerged in enzyme extraction
buffer (0.1 M K/P04, 0.1 M NaCl, 5 mM EDTA, 10 mM .beta.-ME and
0.5% sodium taurocholate, pH 6.0). In order to infiltrate the
buffer into the tissue, a vacuum of 730-750 mmHg was twice applied.
After draining the excess buffer, the intercellular fluid fraction
was recovered by low-speed centrifugation (.about.1,500.times.g, 15
min). To measure enzyme remaining in the tissue after this
treatment, the leaf was unrolled after centrifugation and two discs
removed with a #14 cork borer. This tissue sample was transferred
to an eppendorf tube, frozen in liquid nitrogen and ground in four
volumes of enzyme extraction buffer. In rGal-A enzyme assays, we
measured cleavage of the fluorogenic substrate 4-methyl umbeliferyl
.alpha.-D-galactopyranoside (4-MUG) against known standards using
established protocols (34). Units are nmoles of 4-MUG hydrolyzed
per hour at 37.degree. C.
[0268] In several initial experiments, plant leaves transfected
with all constructs accumulated 1-2% of the total soluble plant
protein as cross reacting immunologic material (CRIM) using
antisera specific for Gal-A in quantitative Western analyses (data
not shown). However, enzyme activity was much lower than expected
for this amount of CRIM and furthermore was only 2-4 fold higher
than activity due to endogenous plant .alpha.-galactosidase
isozymes. It also appeared that addition of the ER retention signal
allowed highest accumulation of steady state activity and that the
IF contained little if any additional activity or CRIM. There are
three cellular fates for any glycoprotein synthesized in a plant
leaf: secretion to the IF, retention in the ER or sorting to the
vacuole (35). We reasoned that because the ER retention signal
slightly increased expression, the majority of the enzyme was
inactivated later in the secretory pathway. This could most likely
occur by aggregation in the trans-golgi network as is reported
during over-production of this enzyme in CHO-cells (36), and/or in
the plant leaf vacuole. The IF fraction is quite clear and
non-pigmented and is suitable for direct chromatography. Using the
initial construct (rGal-SEKDEL) (SEQ ID NO: 24) we partially
purified small amounts of rGal-A from the IF on hydrophobic, lectin
and size exclusion resins.
[0269] For several plant proteins vacuolar sorting information is
located in a carboxy-terminal propeptide (CTPP; 37,38). During the
original cloning and characterization of human Gal-A, Quinn et al.,
postulated a cathepsin-like potential CTPP cleavage for this enzyme
at or near two arginine residues, 26 and 28 AA from the termination
codon (39,40). The precise AA sequence at the carboxy terminus has,
to our knowledge, never been reported. Because secretion in the
plant leaf is through a default pathway we reasoned that deletion
of specific sorting information from a postulated CTPP might yield
more active enzyme in the IF. Analysis of a second set of
constructs containing either 12 or 25 AA truncations, with and
without the ER retention signal provided dramatic evidence for the
significance of this region (See Table 9). In one construct, rGal
12-SEKDEL, virtually all of the CRIM is now assembled and stored as
fully active enzyme and is secreted to the IF in significant
quantities. As demonstrated in FIG. 3, rGal-A (.about.52 kDa) is
now the most abundant plant protein in a crude leaf IF sample. The
other predominant band at 17.5 kDa is the viral structural protein
which likely contaminates this fraction from broken trichomes of
the leaf surface.
9TABLE 9 rGal-A Expression (U/Gram Leaf Tissue) Residual
Contract/Sample Intercellular Fluid Homogenate Total Experiment
2,800 7,500 10,300 Uninfected Plant rGal-A 5,100 10,900 25,000
rGal-A 5,400 15,000 20,400 rGal-A-SEKDEL 6,800 30,300 37,100
rGal-A-SEKDEL 5,200 34,500 39,700 Experiment 2,300 4,800 7,100
Uninfected Plant rGal-A 25 4,000 8,900 12,900 rGal-A 25 2,300 9,000
11,300 rGal-A 25-SEKDEL 3,200 10,000 13,200 rGal-A 25-SEKDEL 2,800
8,600 11,400 rGal-A 12 5,500 11,700 17,200 rGal-A 12-SEKDEL 109,800
117,700 227,500 rGal-A 12-SEKDEL 199,000 329,500 528,500
EXAMPLE 11
.alpha.-Galactosidase Expression Vector Development, Construction
and Testing
[0270] The following example describes the series of
.alpha.-galactosidase vectors that were constructed and tested for
enzyme production. Initially, the human .alpha.-galactosidase A
cDNA (Sugimoto, Y., Aksentijevich, I., Murray, G. J., Brady, R. O.,
Pastan, I., and Gottesman, M. M. Retroviral coexpression of a
multidrug resistance gene (MDRI) and human .alpha.-galactosidase A
for gene therapy of Fabry disease. Human Gene Therapy 6:905,
1995.)was fused to a plant signal peptide sequence derived from a
rice a-amylase gene (Kumagai, M. H., Shah, M., Terashima, M.,
Vrkljan, Z., Whitaker, J. R., and Rodriguez, R. L. Expression and
secretion of rice .alpha.-amylase by Saccharomyces cerevisiae. Gene
94:209, 1990.). This chimeric gene was subcloned into the TMV based
expression vector TTODA resulting in a construct designated rGAL-A,
see Table 1. Vector rGAL-A was modified by the addition of the
putative ER retention signal SEKDEL, resulting in the vector
designated rGAL-AR, see Table 1.
[0271] A series of C-terminal amino acid deletions were introduced
into the .alpha.-galactosidase gene. Deletions of 4, 8, 12 or 25
codons from the C-terminus of rGAL-A were generated as well as the
addition of the putative ER retention sequence (SEKDEL), see Table
10 and FIG. 12 (sequence of TTODA (rGAL-12R). The deletion vectors
were designated as described in Table 10:
10TABLE 10 Vector Designation Carboxy-Terminal Modifications (Amino
Acid Sequence) rGAL-A TSRLRSHINPTGTVLLQLENTMQMSLKDLL (SEQ ID NO:
23) rGAL-AR TSRLRSHINPTGTVLLQLENTMQMSLKDLLSEKDEL (SEQ ID NO: 24)
rGAL-4 TSRLRSHINPTGTVLLQLENTMQMSL (SEQ ID NO: 25) rGAL-4R
TSRLRSHINPTGTVLLQLENTMQMSLSEKDEL (SEQ ID NO: 26) rGAL-8
TSRLRSHINPTGTVLLQLENTM (SEQ ID NO: 27) rGAL-8R
TSRLRSHINPTGTVLLQLENTMSEKDEL (SEQ ID NO: 28) rGAL-12
TSRLRSHINPTGTVLLQL (SEQ ID NO: 29) rGAL-12R
TSRLRSHINPTGTVLLQLSEKDEL (SEQ ID NO: 30) rGAL-25 TSRLR (SEQ ID NO:
31) rGAL-25R TSRLRSEKDEL (SEQ ID NO: 32)
[0272] The .alpha.-galactosidase gene fragment present in vector
rGAL-12R was placed into TMV vector SBS5. In addition, the rice
.alpha.-amylase signal peptide present in rGAL-12R was replaced by
the native human .alpha.-galactosidase signal peptide. The
resultant vector designated SBS5-rGAL-12R, see FIG. 13, exhibited
genetic stability upon serial passage on N. benthamiana plants.
[0273] .alpha.-galactosidase was extracted from inoculated plants
using interstitial fluid and homogenization methods. Fluids were
analyzed for .alpha.-galactosidase yield, enzyme activity and
cellular partitioning and targeting, see Table 11. In all cases,
infectious transcripts were prepared in vitro and inoculated onto
the lower leaves of actively growing Nicotiana benthamiana plants.
Characteristic viral symptoms, vein clearing and leaf curling, were
noted .about.6-8 dpi (days post inoculation). Tissue samples were
obtained from infected plants 1-3 weeks after inoculation. Leaves
were weighed, rolled in a strip of Parafilm and placed in a
disposable chromatography column and submerged in extraction buffer
(0.1 M K/P04, 0.1 M NaCl, 5 mM EDTA, 10 mM .beta.-ME and 0.5%
sodium taurocholate, pH 6.0). Extraction buffer was infiltrated
into the tissue by pumping a vacuum of 730-750 mmHg. The vacuum was
applied and released two times. After draining the excess buffer,
the interstitial fluid (IF) fraction was recovered by low-speed
centrifugation (.about.1,500.times.g, 15 min). To measure enzyme
remaining in the tissue after this treatment, the leaf was unrolled
after centrifugation and two discs (.about.1 mg each) removed with
a #14 cork borer. This tissue sample was transferred to an
Eppendorf tube, frozen in liquid nitrogen and ground in four
volumes of extraction buffer. The total homogenate was then
subjected to centrifugation at .about.5,000.times.g and the
supernatant fraction was saved for further analysis.
[0274] Extracts from IF and homogenates from post-IF leaf tissue
were analyzed for enzymatic activity by the hydrolysis of the
fluorescent substrate 4-methyl umbeliferyl
.alpha.-D-galactopyranoside (4-MUG). Known standards and
established protocols (Suzuki, K. Enzymatic diagnosis of
sphingolipidoses. Meth. Enzy. 138:727, 1987.) were used to obtain
the number of enzymatic units (nmoles of 4-MUG hydrolyzed per hour
at 37.degree. C.) per gram fresh weight of tissue harvested.
11TABLE 11 Interstitial Total Enzyme Ratio of Fluid Homogenate
Activity Activity Vector Units/gram Units/gram Units/gram IF/
Designation leaf leaf leaf Homogenate Uninfected 3,837 9,404 13,241
0.41 rGAL-A 6,833 189,971 196,804 0.04 rGAL-AR 6,829 312,068
318,897 0.02 rGAL-4 16,088 262,806 278,894 0.06 rGAL-4R 8,245
357,414 365,659 0.02 rGAL-8 261,814 524,857 789,671 0.50 rGAL-8R
10,628 469,956 480,584 0.02 rGAL-12 2,564 8,743 11,307 0.29
rGAL-12R 305,803 1,033,921 1,339,724 0.30 rGAL-25 1,265 6,629 7,894
0.19 rGAL-25R 2,489 6,394 8,883 0.39
[0275] Enzyme activity data from IF and homogenates derived from
plants expressing .alpha.-galactosidase from the vectors in Table
2. indicate that carboxy-terminal deletions (4-12 codons) results
in increased .alpha.-galactosidase expression. Vector rGAL-12R
expressed the highest level of total .alpha.-galactosidase and also
secreted the highest quantity of active enzyme.
EXAMPLE 12
Pilot Scale Purification of .alpha.-Galactosidase
[0276] Actively growing Nicotiana benthamiana plants, propagated in
an uncontrolled horticultural greenhouse, were inoculated with
encapsidated transcripts derived from the expression vector,
SBS5-rGAL-12R. Tissue was harvested 14-17 days post inoculation.
Five kilograms of leaves were placed into polyester bags
(Filtra-Spec.RTM., 12-2-1053) and four.times.5 kg bags of leaves
were placed into a metal basket. The metal basket containing the
leaf material was placed in a 200 liter Mueller.RTM. vacuum tank
containing .about.100 liters of buffered solution (50 mM acetate, 5
mM EDTA, 10 mM 2-mercaptoethanol, pH 5.0). A 70 lb. stainless steel
plate was placed over the leaves/bags to assure complete immersion.
A vacuum was pumped to 695 mm Hg, held for 1 minute and then
rapidly released. This vacuum infiltration was repeated for a total
of two cycles. Multiple applications of the vacuum without
isolating the interstitial fluid constitutes a single infiltration
procedure. An indication of complete infiltration is a distinct
darkening in color of the underside of the leaf tissue. Following
the vacuum infiltrations, the leaves and basket were removed from
the vacuum tank. The bags containing the vacuum infiltrated leaves
were allowed to gravity drain surface buffer for .about.10 minutes,
prior to centrifugation. The interstitial fluid (IF) was recovered
from the vacuum infiltrated leaves by centrifugation
(1,800.times.G, 30 minutes) using a Heine.RTM. basket centrifuge
(bowl dimensions, 28.0 inches diameter.times.16.5 inches). The IF
was filtered through a 50 .mu.m cartridge filter to remove plant
debris prior to purification.
[0277] Ammonium sulfate was added to the IF to 15% saturation,
mixed for 10 minutes and loaded onto a Pharmacia Streamline 200
column containing 4 liters of Butyl Streamline resin equilibrated
with 25 mM Imidizole, 15% (NH.sub.4).sub.2SO.sub.4, pH 6.0 at 1.2
L/min. The column was washed to UV baseline with 25 mM Imidizole,
pH 6.0, 15% (NH.sub.4).sub.2SO.sub.4 and .alpha. Gal was eluted
with a step gradient of 25 mM Imidizole, pH 6.0. The eluent was
filtered through a Sartorius glass fiber .fwdarw.0.8 um cartridge
filter and loaded directly onto 3 liters of Blue Sepharose in a
Pharmacia BPG 200 column equilibrated with 25 mM Imidizole, pH 6.0.
The column was washed to UV baseline with 25 mM Imidizole, pH 6.0
and .alpha. gal was eluted with a step gradient of 25 mM Imidizole,
650 mM NaCl, pH 6.0. The eluent was concentrated using a 10 kD
MWCO, cellulose acetate, 3 ft.sup.2 spiral membrane in an Amicon
CH-2 concentrator and then sterile filtered.
[0278] Further purification was carried out either on Octyl
Sepharose FF or Hydroxyapatite. For Octyl Sepharose the column was
equilibrated with 25 mM Imidizole, 25% ammonium sulfate, pH 6.0 and
eluted using a linear gradient of 25-0% (NH.sub.4).sub.2SO.sub.4 in
25 mM Imidizole, pH 6.0. For Hydroxyapatite purification, the
sample was dialyzed overnight against 10 mM KPO.sub.4Buffer, pH 7.0
and then loaded on a column was equilibrated with 10 mM
KPO.sub.4Buffer, pH 7.0. The column was washed with equilibration
buffer until the UV reached baseline, followed by a linear gradient
of 10-200 mM KPO.sub.4Buffer, pH 7.0. The .alpha. gal flowed
through the column free of the contaminating proteins.
[0279] Alpha gal activity was measured throughout the process with
a fluorescent assay using the synthetic substrate,
4-methylumbelliferyl-.al- pha.-D-galactopyranoside (MU-.alpha.
gal). Enzyme activity was measured at 37.degree. C. in a reaction
mixture containing 5 mM methylumbelliferyl
.alpha.-D-galactopyranoside, 0.1 M Potassium Phosphate, 0.15%
Triton-X100, 0.125% sodium taurocholate, and 0.1% bovine serum
albumin, pH 5.9. One unit of enzymatic activity hydrolyzes 1 nmol
of MU-.alpha.-gal per hour at 37.degree. C. Total protein was
determined using the Bio-Rad Protein Assay based on the method of
Bradford (Bradford, M. Anal. Biochem. 72: 248; 1976). Results of
.alpha.-galactosidase activity (Total units and specific activity)
from different enzyme production lots are shown in Table 12.
12TABLE 12 Specific Activity Units/mg protein Lot Number Kg Biomass
Extracted Total Units (IF) (Purified) 981215 44.4 2.9 .times.
10.sup.9 5.0 .times. 10.sup.6 991115 100 5.5 .times. 10.sup.9 3.6
.times. 10.sup.6 991116 120 6.9 .times. 10.sup.9 4.0 .times.
10.sup.6 991117 120 5.9 .times. 10.sup.9 3.5 .times. 10.sup.6*
991118 95.6 7.0 .times. 10.sup.9 3.5 .times. 10.sup.6* *Butyl
eluents from lots 991117 and 991118 were pooled before final
chromatography and purification. The data presented in Table 12
demonstrates the consistency of pilot-scale extraction with respect
to secreted enzyme yield and specific activity.
EXAMPLE 13
Analysis of Purified .alpha.-Galactosidase
N-terminal Sequence Analysis
[0280] N-terminal sequence analysis of .alpha.-galactosidase,
purified from plants inoculated with transcripts derived from the
vector rGAL-12R, MLDNGLARTPT (see SEQ ID NO: 1), had a 100%
sequence homology to 11 amino acids of human placental
.alpha.-galactosidase with the addition of an N-terminal
methionine. In contrast, N-terrninal sequence of
.alpha.-galactosidase, purified from plants inoculated with
transcripts derived from the vector SBS5-rGAL-12R, LDNGLARTPT (see
SEQ ID NO:2), was as expected from native human enzyme. These data
indicates the high degree of fidelity that post-translational
modifications are carried out within plant leaf cells and that
human signal peptides are processed with equal specificity in
plants as in the native mammalian source.
C-Terminal Sequence Analysis
[0281] C-Terminal sequence of the rGAL-12R and SBS5-rGAL-12R plant
produced enzyme was obtained by Edman degradation using the
commercial service of the Mayo Foundation. Three cycles were
achieved before the signal was too low to read additional sequence.
Expected C-Terminus: LLQLSEKDEL (see SEQ ID NO:30).
13 Cycle Major amino acids 1st L, E 2nd D, V, A 3rd Q, G, T
[0282] It is important to note that the C-terminal amino acid was
found to be heterogeneous, either L or E. The presence of glutamic
acid in the first cycle greatly reduced the signal because glutamic
acid can form a cyclic structure during the activation step that
disables cleavage from the chain and therefore blocks a portion of
the sample to further sequencing. This reduced that ability of the
software to interpret cycle 3 and beyond. However, the presence of
L, E and D in the first two cycles and the absence of other amino
acids present in the analysis in an order resembling the
.alpha.-galactosidase sequence strongly suggests that a population
of the enzyme terminates with a DEL sequence as expected from the
sequence of the DNA clone.
Molecular Weight Determination
[0283] The apparent molecular weight of SBS5-rGAL-12R derived
.alpha.-galactosidase (.about.50 kDa) was quite similar to human
.alpha.-galactosidase A, purified from human placenta, as judged by
both coomassie and silver stained SDS-PAGE. However, the protein
purified from plant sources showed less molecular weight variation
than the native human protein, indicating less heterogeneity in
plant glycosylation or a higher purity plant enzyme
preparation.
[0284] The molecular mass of several lots of plant derived
.alpha.-galactosidase were determined by MALDI-TOF mass
spectroscopy to be 48,963, 48,913, 49,100 daltons. These weights
are consistent with the predicted mass of .alpha.-galactosidase,
based upon amino acid sequence, allowing for broader peaks due to
glycosylation. The calculated molecular weight of SBS5-rGAL-12R
derived .alpha.-galactosidase is 44,619. The difference in
predicted and observed mass would equate to approximately 10.0%
carbohydrate.
Glycan Analysis
[0285] There are four potential N-glycosylation consensus sequences
(N-X-T/S) reported for human .alpha. gal A (Matsuura, et. al.
Glycobiology 8:329-339, 1998). We have identified four potential
sites (108, 161, 184, 377) in our plant expressed .alpha. gal. One
potential glycosylation site, in our a gal, is not glycosylated
(377), as is the case for human .alpha. gal A expressed in
CHO-cells.
[0286] Plants have both high mannose and complex glycans that
differ from mammalian complex glycans by the presence of an
.alpha.1,3 fucose on the proximal GlcNac and a .beta.1,2 xylose on
the .beta.-linked mannose of the core. Four potential
N-glycosylation sites have been identified for the plant derived
.alpha.-galactosidase. The predicted amino acid sequence has four
possible glycosylation sites (Asn-Xaa-Ser/Thr) at Asn residues
(108, 161, 184, 377). The glycosylation site at amino acid 377 was
not glycosylated, similar to CHO cell derived .alpha.-galactosidase
glycosylation. The four possible N-glycosylation sites are all
located in .beta. turns within hydrophilic regions of the enzyme.
It was estimated the mature human .alpha.-galactosidase consists of
about 370 amino acids and approx. 15% carbohydrate (Calhoun et al.
PNAS 82: 7364-7368, 1985). Matsuura et al (Glycobiology
8:329-339,1998) reports that in CHO-cell produced .alpha. gal there
are four N-glycosylation sites (139, 193, 215, 407) and 3 of the 4
sites are occupied (407 is not glycosylated).
[0287] We have determined that our plant expressed protein is
indeed glycosylated because the enzyme will bind to ConA which has
a specificity for high mannose structures. Also, the plant derived
enzyme was chemically deglycosylated with TFMS
(trifluoromethanesulfonic acid). The .alpha.-galactosidase appeared
to be cleaved as observed by a shift in molecular weight on both a
silver stained gel and a Western blot with .alpha. gal antibody.
Early attempts to cleave rGal-A with PNGaseF to release N-linked
carbohydrate have been unsuccessful suggesting the presence of
.alpha.1,3 fucose on the terminal GlcNac of the carbohydrate side
chain. This was verified by glycan analysis work carried out by the
Glycobiology Core Group at University of California San Diego
Cancer Center. Carbohydrate profiling and compositional analysis
was done. NMR experiments confirmed that rGal-A from the plant IF
contains an N-linked glycan containing plant-specific carbohydrate
linkages of a .beta.1,2 xylose and .alpha.1,3 fucose on the
trimannosyl core. This N-linked structure has been previously
reported to occur in glycoproteins isolated from plant seeds and
tissue cultures. Five (5) ug was hydrolyzed with 2M TFA for 4 hours
and analyzed by HPAEC-PAD. The total amount of sugar and sugar
content was 560 ug and 12%. NMR analysis of the major peak showed a
trimannosyl-chitobiose core, with .alpha.1,3 linked fucose and a
.beta.1,2 linked xylose.
[0288] .alpha.-galactosidase glycan structures were determined by
MALDI-TOF and/or MALDI-MS in collaboration with the Universitaet
fuer Bodenkultur, see Table 13. For MALDI, 5 .mu.g of plant derived
.alpha.-galactosidase was digested with pepsin in a mass ratio of
1:40 in 5% formic acid. After evaporation the peptides were
dissolved in ammonium acetate buffer, pH 5.0, boiled and
subsequently digested with PNGase A overnight. Since the sample has
a mass of 49.000 g/mol, there are 100 pmol of glycoprotein. After
evaporation, the peptides were removed by cation exchange
chromatography and the glycans are analyzed by MALDI (or
pyridylaminated).
[0289] The molecular mass of the glycan was determined by MALDI-MS
using a ThermoBio Analysis DYNAMO (linear MALDI-TOF MS with delayed
extraction) instrument. A small portion of the sample was dried on
the sample target and subsequently overlaid with "matrix" (gentisic
acid). The samples contained complex type sugar chains with fucose,
xylose and varying amounts of terminal GlcNAc. Small fractions were
devoid of fucose and therefore amenable to hydrolysis by PNGase
F.
14TABLE 13 Lot #980805 Lot #981215 Molecular Weight % Glycan %
Glycan Glycan Structure Daltons Structure Structure MOXF 1050.5 3
-- MMX 1066.5 2 2 MMXF 1212.7 22 8 Man 5 1237.5 -- 1.8 GnMX/MGnX
1269.8 6 0.5 GnMXF/MGnXF 1416.4 53 16 GnGnX 1473.3 5 7 GnGnXF
1619.9 9 55
[0290]
15TABLE 14 Characteristic Plant Derived CHO Cell Secreted Number of
Core Structures 8 23 Sialic Acid Absent Present Xylose .beta. (1,2)
Linkage Absent Fucose .alpha. (1,3) Linkage .alpha. (1,6) Linkage %
Complex Structures % Weight Glycosylated 10-12% 15% Specific
Activity
[0291]
16TABLE 15 Specific Activity .alpha.-Galactosidase Source 4-MU
Substrate Reference Nicotiana benthamiana 5.0 .times. 10.sup.6 This
Patent Application Human, Recombinant Human Spleen 1.88 .times.
10.sup.6 Bishop and Desnick, 1981, J. Biol. Chem. 256 (3):
1307-1316 Human Placenta 0.99 .times. 10.sup.6 Bishop and Desnick,
1981, J. Biol. Chem. 256 (3): 1307-1316 Human Plasma 7.4 .times.
10.sup.5 Bishop and Sweeley, 1978, Biochim. Bioph. Acta, 525:
399-409
[0292] This example demonstrates the ability to extract two
different products from the same leaf tissue based upon extraction
procedures that specifically target products localized in the
apoplast and cytosol.
[0293] Although the invention has been described with reference to
the presently preferred embodiments, it should be understood that
various modifications can be made without departing from the spirit
of the invention.
[0294] All publications, patents, patent applications, and web
sites are herein incorporated by reference in their entirety to the
same extent as if each individual patent, patent application, or
web site was specifically and individually indicated to be
incorporated by reference in its entirety.
LITERATURE CITED
[0295] 1. Brady, R. O. Fabry Disease, In: Peripheral Neropathyrn
3rd ed., J. W. Griffin, P. A. Low, and J. F. Poduslo (eds.) W. B.
Saunders. pp. 1169, 1993.
[0296] 2. Desnick, R. J., Ioannou, Y. A., and Eng, C. M.
Alpha-Galactosidase A Deficiency: Fabry Disease, In: The Metabolic
Bases of Inherited Diseases, C. R. Scriver, A. L. Beaudet, W. S.
Sly, D. Valle (eds.) McGraw-Hill, pp. 2741, 1995.
[0297] 3. Brady, R. O. Sphingolipidoses, a Medical Progress Report.
N. Engl. J. Med. 275: 312, 1966.
[0298] 4. Brady R. O., Pentchev P. G., Gal A. E., Hibbert S. R.,
and Dekaban A. S. Replacement therapy for inherited enzyme
deficiency: Use of purified glucocerebrosidase in Gaucher's
disease. N. Engl. J. Med. 291:989, 1974.
[0299] 5. Furbish F. S., Blair H. E., Shiloach J., Pentchev P. G.,
and Brady R. O. Enzyme replacement therapy in Gaucher's disease:
Large-scale purification of glucocerebrosidase suitable for human
administration. Proc. Natl. Acad. Sci. USA 74: 560, 1977.
[0300] 6. Furbish F. S., Steer C. J., Krett N. L., and Barranger,
J. A. Uptake and distribution of placental glucocerebrosidase in
rat hepatic cells and effects of sequential deglycosylation.
Biochim. Biophys. Acta 673: 425, 1981.
[0301] 7. Barton, N. W., Furbish, F. S., Murray, G. J., Garfield,
M., and Brady, R. O. Therapeutic response to intravenous infusions
of glucocerebrosidase in a patient with Gaucher disease. Proc.
Natl. Acad. Sci. USA 87: 1913, 1990.
[0302] 8. Barton, N. W., Brady, R. O., Dambrosia, J. M.,
DiBisceglie, A. M., Doppelt, S. H., Hill, S. C., Mankin, H. J.,
Murray, G. J., Parker, R. I., Argoff, C. E., Grewal, R. P., and Yu,
K.-T. Replacement therapy for inherited enzyme
deficiency--macrophage-targeted glucocerebrosidase for Gaucher's
disease. N. Engl. J. Med. 324: 1464, 1991.
[0303] 9. Parker, R. I., Barton, N. W., Read, E. J., and Brady, R.
O. Hematologic improvement in a patient with Gaucher's disease on
long-term replacement therapy: Evidence for decreased splenic
sequestration and improved red blood cell survival. Am. J. Hematol.
38:130, 1991.
[0304] 10. Hill, S. C., Parker, C. C., Brady, R. O., and Barton, N.
W. MRI of multiple platyspondyly in Gaucher disease: Response to
enzyme replacement therapy. J. Comput. Assist. Tomog. 17: 806,
1993.
[0305] 11. Beutler, E., Kay, A., Saven, A., Garver, P., Thurston,
D., Dawson, A., and Rosenbloom, B. Enzyme replacement therapy for
Gaucher disease. Blood 78:1183, 1991.
[0306] 12. Fallet, S., Grace, M. E., Sibille, A., Mendelson, D. S.,
Shapiro, R. S., Hermann, G., and Grabowski, G. A. Enzyme
augmentation in moderate to life-threatening Gaucher disease.
Pediatr. Res. 31: 496, 1992.
[0307] 13. Mistry, P. K., Davies, S., Corfield, A., Dixon, A. K.,
and Cox, T. M. Successful treatment of bone marrow failure in
Gaucher's disease with low-dose modified glucocerebrosidase. Quart.
J. Med. New Series 84: 541, 1992.
[0308] 14. Grabowski, G. A., Barton, N. W., Pastores, G.,Dambrosia,
J. M., Banejee, T. K., McKee, M. A., Parker, C., Schiffinann, R.,
Hill, S. C., Brady, R. O. Enzyme therapy in Type 1 Gaucher disease:
Comparative efficacy of mannose-terminated glucocerebrosidase from
natural and recombinant sources. Ann. Inter. Med. 122:33, 1995.
[0309] 15. Hasholt L., Sorensen, S. A. A microtechnique for
quantitative mesurements of acid hydrolases in fibroblasts. Its
application in diagnosis of Fabry disease and enzyme replacement
studies. Clin. Chim. Acta 142:257, 1984.
[0310] 16. Mapes, C. A., Anderson, R. L., Sweeley, C. C., Desnick,
R. J., Krivit, W. Enzyme replacement in Fabry's disease, an inborn
error of metabolism. Science 169:987, 1970.
[0311] 17. Brady, R. O., Tallman, J. F., Johnson, W. G., Gal, A.
E., Leahy, W. R., Quirk, J. M., Dekaban, A. S. Replacement therapy
for inherited enzyme deficiency: Use of purified
ceramidetrihexosidease in Fabry's disease. N. Eng. J. Med. 289:9,
1973.
[0312] 18. Desnick, R. J., Dean, K. J., Grabowski, G. A., Bishop,
D. F., Sweeley, C. C. Enzyme therapy XII: Enzyme therapy in Fabry's
disease: Differential enzyme and substrate clearance kinetics of
plasma and splenic Alpha-galactosidase isozymes. Proc. Natl. Acad.
Sci USA 76:5326, 1979.
[0313] 19. Beutler, E. The cost of treating Gaucher disease. Nature
Medicine 2:523, 1996.
[0314] 20. NIH Technology Assessment Panel on Gaucher Disease.
Gaucher Disease: Current issues in diagnosis and treatment. JAMA
275:548, 1995.
[0315] 21. Hiatt, A., Cafferkey, R., and Bowdish, K. Production of
antibodies in transgenic plants. Nature 342:76, 1989.
[0316] 22. Assembly of multimeric proteins in plant cells:
Characteristics and uses of plant-derived antibodies, In:
Transgenic Plants, Fundamentals and Applications, A. Hiatt, (ed.)
Marcel Dekker, Inc. New York, N.Y. pp. 221, 1992.
[0317] 23. Ma, J. K.-C., and Hein, M. B. Plant antibodies for
immunotherapy. Plant Physiol. 109:341, 1995.
[0318] 25. Sijmons, P. C., Dekker, B. M. M., Schrammeijer, B.,
Verwoerd, T. C., van den Elzen, P. J. M., and Hoekema, A.
Production of correctly processed human serum albumin in transgenic
plants. Bio/Technology 8:217, 1990.
[0319] 26. Mason, H. S., Lam D. M.-K., and Arntzen, C. J.
Expression of hepatitis B surface antigen in transgenic plants.
Proc. Natl. Acad. Sci. USA 89:11745, 1992.
[0320] 27. Haq, T. A., Mason, H. S., Clements, J. D., and Arntzen,
C. J. Oral immunization with a recombinant bacterial antigen
produced in transgenic plants. Science 268:714, 1995.
[0321] 28. Turpen, T. H., Reinl, S. J., Charoenvit, Y., Hoffinan,
S. L., Fallarme, V., and Grill, L. K. Malarial epitopes expressed
on the surface of recombinant tobacco mosaic virus. Bio/Technology
13:53, 1995.
[0322] 29. Kumagai, M. H., Turpen, T. H., Weinzettl, N.,
della-Cioppa, G., Turpen, A. M., Donson, J., Hilf, M. E., Grantham,
G. L., Dawson, W. O., Chow, T. P., Piatak Jr., M., and Grill, L. K.
Rapid, high level expression of biologically active
.quadrature.-trichosanthin in transfected plants by a novel RNA
viral vector. Proc. Natl. Acad. Sci. USA 90:427, 1993.
[0323] 30. Turpen, T. H., and Dawson, W. O Amplification, movement
and expression of genes in plants by viral-based vectors, In:
Transgenic Plants, Fundamentals and Applications, A. Hiatt, (ed.)
Marcel Dekker, Inc. New York, N.Y. pp. 195, 1992.
[0324] 31. Sugimoto, Y., Aksentijevich, I., Murray, G. J., Brady,
R. O., Pastan, I., and Gottesman, M. M. Retroviral coexpression of
a multidrug resistance gene (MDRI) and human Alpha-galactosidase A
for gene therapy of Fabry disease. Human Gene Therapy 6:905,
1995.
[0325] 32. O'Neill, S. D., Kumagai, M. H., Majumdar, A., Huang, N.,
Sutliff, T. D. and Rodriguez, R. L. The .alpha.-amylase genes in
Oryza sativa: Characterization of cDNA clones and mRNA expression
during seed germination. Mol. Gen. Genet. 221:235, 1990.
[0326] 33. Kumagai, M. H., Shah, M., Terashima, M., Vrkljan, Z.,
Whitaker, J. R., and Rodriguez, R. L. Expression and secretion of
rice .alpha.-amylase by Saccharomyces cerevisiae. Gene 94:209,
1990.
[0327] 34. Suzuki, K. Enzymatic diagnosis of sphingolipidoses.
Meth. Enzy. 138:727, 1987.
[0328] 35. Chrispeels, M. J. Sorting of proteins in the secretory
system. Annu. Rev. Plant Physiol. Plant Mol. Biol. 42:21, 1991.
[0329] 36. Ioannou, Y. A., Bishop, D. F., and Desnick, R. J.
Overexpression of human Alpha-galactosidase A results in its
intracellular aggregation, crystallization in lysosomes, and
selective secretion. J. Cell Biol. 119:1137, 1992.
[0330] 37. Dombrowski, J. E., and Raikhel, N. V. Protein targeting
to the plant vacuole--a historical perspective. Brazilian Journal
of Medical and Biological Research 29:413, 1996.
[0331] 38. Kermode, A. R. Mechanisms of intracellular protein
transport and targeting in plant cells. Crit. Rev. Plant Sci.
15:285, 1996.
[0332] 39. Bishop, D. F., Calhoun, D. H., Bernstein, H. S.,
Hantzopoulos, P., Quinn, M., and Desnick, R. J. Human
Alpha-galactosidase A: Nucleotide sequence of a cDNA clone encoding
the mature enzyme. Proc. Natl. Acad. Sci. USA 83:4859, 1986.
[0333] 40. Quinn, M., Hantzopoulos, P., Fidanza, V. and Calhoun, D.
H. A genomic clone containing the promoter for the gene encoding
the human lysosomal enzyme, Alpha-galactosidase A. Gene 58:177,
1987.
[0334] 41. Coppola, G., Yan, Y., Hantzopoulos, P., Segura, E.,
Stroh, J. G., and Calhoun, D. H. Characterization of glycosylated
and catalytically active recombinant human Alpha-galactosidase A
using a baculovirus vector. Gene 144:197.
[0335] 42. Miyamura, N., Araki, E., Matsuda, K., Yoshimura, R.,
Furukawa, N., Tsuruzoe, K., Shirotani, T., Kishikawa, H.,
Yamaguchi, K., and Shichiri, M. A carboxy-terminal truncation of
human Alpha-galactosidase A in a heterozygous female with Fabry
disease and modification of the enzymatic activity by the
carboxy-terminal domain. J. Clin. Invest. 18009, 1996.
[0336] 43. National Research Council. Putting biotechnology to
work. Bioprocess engineering. National Academy Press, Washington,
D.C. 1992.
[0337] 44. Prescribing Information, Ceredase.TM., (alglucerase
injection). Genzyme Corporation, 1/1995.
[0338] 45. Wilkins, T., Bednarek, S. Y., Raikhel, N. V. Role of
propetide glycan in post-translational processing and transport of
barley lectin to vacuoles in transgenic tobacco. Plant Cell 2:301,
1990.
[0339] 46. Melchers, L. S., Sela-Buurlage, M. B., Vloemans, S. A.,
Woloshuk, C. P., Van Roekel, J. S. C., Pen, J., Van den Elzen, P.
J. M., Comelissen, B. J. C. Extracellular targeting of the vacuolar
tobacco proteins AP24, chitinase and .quadrature.-1,3-glucanase in
transgenic plants. Plant Mol. Biol. 21:583, 1993.
[0340] 47. Sato, F., Koiwa, H., Sakai, Y., Kato, N., Yamada, Y.
Synthesis and secretion of tobacco neutral PR-5 protein by
transgenic tobacco and yeast. Biochem. Biophys. Res. Comm. 211:909,
1995.
[0341] 48. Maggio, A., D'Urzo, M. P., Abad, L. R., Takeda, S.,
Hasegawa, P. M., and Bressan, R. Large quantities of recombinant
PR-5 proteins from the extracellular matrix of tobacco: Rapid
production of microbial-recalcitrant proteins. Plant Mol. Biol.
Rep. 14:249, 1996.
[0342] 49. Calhoun, D. H., Bishop, D. F., Bernstein, H. S., Quinn,
M., Hantzopoulos, P., Desnick, R. J. Fabry disease: Isolation of a
cDNA clone encoding human Alpha-galactosidase A. Proc. Natl. Acad.
Sci. USA 82:7364, 1985.
[0343] 50. Jenkins, N., Parekh, R. B., James, D. C. Getting the
glycosylation right: Implications for the biotechnology industry.
Nature Biotech. 14:975, 1996.
[0344] 51. Fitchette-Lain, A-C., Gomord, V., Chekkafi, A., and
Faye, L. Distribution of xylosylation and fucosylation in the plant
Golgi apparatus. Plant J. 5:673, 1994.
[0345] 52. Hein, M. B., Tang, Y., McLeod, D. A., Janda, K. D.,
Hiatt, A. C. Evaluation of immunoglobulins from plant cells.
Biotechnol. Prog. 7:455, 1991.
[0346] 53. Garcia-Casado, G. Sanchez-Monge, R., Chrispeels, M. J.,
Armentia, A., Salcedo, G., and Gomez, L. Role of complex
asparagine-linked glycans in the allergenicity of plant
glycoproteins. Glycobiol. 6:471, 1996.
[0347] 54. Chrispeels, M. J., and Faye, L. The production of
recombinant glycoproteins with defined non-immunogenic glycans, In:
Transgenic Plants, A production system for industrial and
pharmaceutical proteins. M. R. L. Owen and J. Pen, (eds.) John
Wiley & Sons Ltd. pp. 99, 1996.
[0348] 55. von Schaewen, A., Strum, A., O'Neill, J., Chrispeels, M.
J. Isolation of a mutant Arabidopsis plant that lacks N-acetyl
glucosaminyl transferase I and is unable to synthesize
golgi-modified complex N-linked glycans. Plant Physiol. 102:1109,
1993.
[0349] 56. Takasaki, S., Murray, G. J., Furbish, F. S., Brady, R.
O., Barranger, J. A., and Kobata, A. Structure of the
N-asparagine-linked oligosaccharide units of human placental
.alpha.-glucocerebrosidase. J. Biol. Chem. 259:10112, 1984.
[0350] 57. Murray, G. J., Lectin-specific targeting of lysosomal
enzymes to reticuloendothelial cells. Meth. Enzy. 149:25, 1987.
[0351] 58. Ohshima, T., Murray, G. J., Nagle, J. W., Quirk, J. M.,
Kraus, M. H., Barton, N. W., Brady, R. O., and Kulkarni, A. B.
Structural organization and expression of the mouse gene encoding
Alpha-galactosidase A. Gene 166:277, 1995.
[0352] 59. Horsch et al., Science 227 (1985) 1229-1231.
[0353] 60. An, G., Watson, B D, Chiang, C C Plant Physiol 81 (1986)
301-305.
[0354] 61. Gelvin, S B, Schilperoort, R A (eds.) Plant Molec Biol
Manual (1988).
[0355] 62. Kint, 1971, Arch. Int. Physiol. Biochem. 79:633-644.
[0356] 63. Beutler & Kuhl, 1972, Amer. J. Hum. Genet.
24:237-249.
[0357] 64. Romeo, et al., 1972, FEBS Lett. 27:161-166.
[0358] 65. Wood & Nadler, 1972, Am. J. Hum. Genet.
24:250-255.
[0359] 66. Ho, et al., 1972, Am. J. Hum. Genet. 24:256-266.
[0360] 67. Desnick, et al., 1973, J. Lab. Clin. Med.
81:157-171.
[0361] 68. Desnick, et al., 1989, in The Metabolic Basis of
Inherited Disease, Scriver, C. R., Beaudet, A. L. Sly, W. S. and
Valle, D., eds, pp. 1751-1796, McGraw Hill, New York.
[0362] 70. Kint, 1971, Arch. Int. Physiol. Biochem. 79:633-644.
[0363] 71. Beutler & Kuhl, 1972, J. Biol. Chem. 247:
7195-7200.
[0364] 72. Callahan, et al., 1973, Biochem. Med. 7: 424-431.
[0365] 73. Dean, et al., 1977, Biochem. Biophys. Res. Comm.
77:1411-1417.
[0366] 74. Schram, et al., 1977, Biochim. Biophys. Acta.
482:138-144.
[0367] 75. Kusiak, et al., 1978, J. Biol. Chem. 253:184-190.
[0368] 76. Dean, et al., 1979, J. Biol. Chem. 254:10001-10005.
[0369] 77. Bishop, et al., 1980, in Enzyme Therapy in Genetic
Disease:2, Desnick, R. J., ed., pp. 17-32, Alan R. Liss, Inc., New
York.
[0370] 78. Beutler & Kuhl, 1972, J. Biol. Chem.
247:7195-7200.
[0371] 79. Schram, et al., 1977, Biochim. Biophys. Acta.
482:138-144).
[0372] 80. Kint, 1971; Arch. Int. Physiol. Biochem. 79: 633-644.
Sequence CWU 1
1
32 1 15 PRT Rice 1 Ser Asn Leu Thr Ala Gly Met Leu Asp Asn Gly Leu
Ala Arg Thr 1 5 10 15 2 15 PRT Homo Sapiens 2 Asp Ile Pro Gly Ala
Arg Ala Leu Asp Asn Gly Leu Ala Arg Thr 1 5 10 15 3 1290 DNA Homo
sapiens 3 atgcagctga ggaacccaga actacatctg ggctgcgcgc ttgcgcttcg
cttcctggcc 60 ctcgtttcct gggacatccc tggggctaga gcactggaca
atggattggc aaggacgcct 120 accatgggct ggctgcactg ggagcgcttc
atgtgcaacc ttgactgcca ggaagagcca 180 gattcctgca tcagtgagaa
gctcttcatg gagatggcag agctcatggt ctcagaaggc 240 tggaaggatg
caggttatga gtacctctgc attgatgact gttggatggc tccccaaaga 300
gattcagaag gcagacttca ggcagaccct cagcgctttc ctcatgggat tcgccagcta
360 gctaattatg ttcacagcaa aggactgaag ctagggattt atgcagatgt
tggaaataaa 420 acctgcgcag gcttccctgg gagttttgga tactacgaca
ttgatgccca gacctttgct 480 gactggggag tagatctgct aaaatttgat
ggttgttact gtgacagttt ggaaaatttg 540 gcagatggtt ataagcacat
gtccttggcc ctgaatagga ctggcagaag cattgtgtac 600 tcctgtgagt
ggcctcttta tatgtggccc tttcaaaagc ccaattatac agaaatccga 660
cagtactgca atcactggcg aaattttgct gacattgatg attcctggaa aagtataaag
720 agtatcttgg actggacatc ttttaaccag gagagaattg ttgatgttgc
tggaccaggg 780 ggttggaatg acccagatat gttagtgatt ggcaactttg
gcctcagctg gaatcagcaa 840 gtaactcaga tggccctctg ggctatcatg
gctgctcctt tattcatgtc taatgacctc 900 cgacacatca gccctcaagc
caaagctctc cttcaggata aggacgtaat tgccatcaat 960 caggacccct
tgggcaagca agggtaccag cttagacagg gagacaactt tgaagtgtgg 1020
gaacgacctc tctcaggctt agcctgggct gtagctatga taaaccggca ggagattggt
1080 ggacctcgct cttataccat cgcagttgct tccctgggta aaggagtggc
ctgtaatcct 1140 gcctgcttca tcacacagct cctccctgtg aaaaggaagc
tagggttcta tgaatggact 1200 tcaaggttaa gaagtcacat aaatcccaca
ggcactgttt tgcttcagct agaaaacaca 1260 atgcagatgt ctttaaaaga
cttactttaa 1290 4 428 PRT Homo sapiens 4 Gln Leu Arg Asn Pro Glu
Leu His Leu Gly Cys Ala Leu Ala Leu Arg 1 5 10 15 Phe Leu Ala Leu
Val Ser Trp Asp Ile Pro Gly Ala Arg Ala Leu Asp 20 25 30 Asn Gly
Leu Ala Arg Thr Pro Thr Met Gly Trp Leu His Trp Glu Arg 35 40 45
Phe Met Cys Asn Leu Asp Cys Gln Glu Glu Pro Asp Ser Cys Ile Ser 50
55 60 Glu Lys Leu Phe Met Glu Met Ala Glu Leu Met Val Ser Glu Gly
Trp 65 70 75 80 Lys Asp Ala Gly Tyr Glu Tyr Leu Cys Ile Asp Asp Cys
Trp Met Ala 85 90 95 Pro Gln Arg Asp Ser Glu Gly Arg Leu Gln Ala
Asp Pro Gln Arg Phe 100 105 110 Pro His Gly Ile Arg Gln Leu Ala Asn
Tyr Val His Ser Lys Gly Leu 115 120 125 Lys Leu Gly Ile Tyr Ala Asp
Val Gly Asn Lys Thr Cys Ala Gly Phe 130 135 140 Pro Gly Ser Phe Gly
Tyr Tyr Asp Ile Asp Ala Gln Thr Phe Ala Asp 145 150 155 160 Trp Gly
Val Asp Leu Leu Lys Phe Asp Gly Cys Tyr Cys Asp Ser Leu 165 170 175
Glu Asn Leu Ala Asp Gly Tyr Lys His Met Ser Leu Ala Leu Asn Arg 180
185 190 Thr Gly Arg Ser Ile Val Tyr Ser Cys Glu Trp Pro Leu Tyr Met
Trp 195 200 205 Pro Phe Gln Lys Pro Asn Tyr Thr Glu Ile Arg Gln Tyr
Cys Asn His 210 215 220 Trp Arg Asn Phe Ala Asp Ile Asp Asp Ser Trp
Lys Ser Ile Lys Ser 225 230 235 240 Ile Leu Asp Trp Thr Ser Phe Asn
Gln Glu Arg Ile Val Asp Val Ala 245 250 255 Gly Pro Gly Gly Trp Asn
Asp Pro Asp Met Leu Val Ile Gly Asn Phe 260 265 270 Gly Leu Ser Trp
Asn Gln Gln Val Thr Gln Met Ala Leu Trp Ala Ile 275 280 285 Met Ala
Ala Pro Leu Phe Met Ser Asn Asp Leu Arg His Ile Ser Pro 290 295 300
Gln Ala Lys Ala Leu Leu Gln Asp Lys Asp Val Ile Ala Ile Asn Gln 305
310 315 320 Asp Pro Leu Gly Lys Gln Gly Tyr Gln Leu Arg Gln Gly Asp
Asn Phe 325 330 335 Glu Val Trp Glu Arg Pro Leu Ser Gly Leu Ala Trp
Ala Val Ala Met 340 345 350 Ile Asn Arg Gln Glu Ile Gly Gly Pro Arg
Ser Tyr Thr Ile Ala Val 355 360 365 Ala Ser Leu Gly Lys Gly Val Ala
Cys Asn Pro Ala Cys Phe Ile Thr 370 375 380 Gln Leu Leu Pro Val Lys
Arg Lys Leu Gly Phe Tyr Glu Trp Thr Ser 385 390 395 400 Arg Leu Arg
Ser His Ile Asn Pro Thr Gly Thr Val Leu Leu Gln Leu 405 410 415 Glu
Asn Thr Met Gln Met Ser Leu Lys Asp Leu Leu 420 425 5 1308 DNA Homo
sapiens 5 atgcagctga ggaacccaga actacatctg ggctgcgcgc ttgcgcttcg
cttcctggcc 60 ctcgtttcct gggacatccc tggggctaga gcactggaca
atggattggc aaggacgcct 120 accatgggct ggctgcactg ggagcgcttc
atgtgcaacc ttgactgcca ggaagagcca 180 gattcctgca tcagtgagaa
gctcttcatg gagatggcag agctcatggt ctcagaaggc 240 tggaaggatg
caggttatga gtacctctgc attgatgact gttggatggc tccccaaaga 300
gattcagaag gcagacttca ggcagaccct cagcgctttc ctcatgggat tcgccagcta
360 gctaattatg ttcacagcaa aggactgaag ctagggattt atgcagatgt
tggaaataaa 420 acctgcgcag gcttccctgg gagttttgga tactacgaca
ttgatgccca gacctttgct 480 gactggggag tagatctgct aaaatttgat
ggttgttact gtgacagttt ggaaaatttg 540 gcagatggtt ataagcacat
gtccttggcc ctgaatagga ctggcagaag cattgtgtac 600 tcctgtgagt
ggcctcttta tatgtggccc tttcaaaagc ccaattatac agaaatccga 660
cagtactgca atcactggcg aaattttgct gacattgatg attcctggaa aagtataaag
720 agtatcttgg actggacatc ttttaaccag gagagaattg ttgatgttgc
tggaccaggg 780 ggttggaatg acccagatat gttagtgatt ggcaactttg
gcctcagctg gaatcagcaa 840 gtaactcaga tggccctctg ggctatcatg
gctgctcctt tattcatgtc taatgacctc 900 cgacacatca gccctcaagc
caaagctctc cttcaggata aggacgtaat tgccatcaat 960 caggacccct
tgggcaagca agggtaccag cttagacagg gagacaactt tgaagtgtgg 1020
gaacgacctc tctcaggctt agcctgggct gtagctatga taaaccggca ggagattggt
1080 ggacctcgct cttataccat cgcagttgct tccctgggta aaggagtggc
ctgtaatcct 1140 gcctgcttca tcacacagct cctccctgtg aaaaggaagc
tagggttcta tgaatggact 1200 tcaaggttaa gaagtcacat aaatcccaca
ggcactgttt tgcttcagct agaaaacaca 1260 atgcagatgt ctttaaaaga
cttactttct gaaaaggacg aattatga 1308 6 435 PRT Homo sapiens 6 Met
Gln Leu Arg Asn Pro Glu Leu His Leu Gly Cys Ala Leu Ala Leu 1 5 10
15 Arg Phe Leu Ala Leu Val Ser Trp Asp Ile Pro Gly Ala Arg Ala Leu
20 25 30 Asp Asn Gly Leu Ala Arg Thr Pro Thr Met Gly Trp Leu His
Trp Glu 35 40 45 Arg Phe Met Cys Asn Leu Asp Cys Gln Glu Glu Pro
Asp Ser Cys Ile 50 55 60 Ser Glu Lys Leu Phe Met Glu Met Ala Glu
Leu Met Val Ser Glu Gly 65 70 75 80 Trp Lys Asp Ala Gly Tyr Glu Tyr
Leu Cys Ile Asp Asp Cys Trp Met 85 90 95 Ala Pro Gln Arg Asp Ser
Glu Gly Arg Leu Gln Ala Asp Pro Gln Arg 100 105 110 Phe Pro His Gly
Ile Arg Gln Leu Ala Asn Tyr Val His Ser Lys Gly 115 120 125 Leu Lys
Leu Gly Ile Tyr Ala Asp Val Gly Asn Lys Thr Cys Ala Gly 130 135 140
Phe Pro Gly Ser Phe Gly Tyr Tyr Asp Ile Asp Ala Gln Thr Phe Ala 145
150 155 160 Asp Trp Gly Val Asp Leu Leu Lys Phe Asp Gly Cys Tyr Cys
Asp Ser 165 170 175 Leu Glu Asn Leu Ala Asp Gly Tyr Lys His Met Ser
Leu Ala Leu Asn 180 185 190 Arg Thr Gly Arg Ser Ile Val Tyr Ser Cys
Glu Trp Pro Leu Tyr Met 195 200 205 Trp Pro Phe Gln Lys Pro Asn Tyr
Thr Glu Ile Arg Gln Tyr Cys Asn 210 215 220 His Trp Arg Asn Phe Ala
Asp Ile Asp Asp Ser Trp Lys Ser Ile Lys 225 230 235 240 Ser Ile Leu
Asp Trp Thr Ser Phe Asn Gln Glu Arg Ile Val Asp Val 245 250 255 Ala
Gly Pro Gly Gly Trp Asn Asp Pro Asp Met Leu Val Ile Gly Asn 260 265
270 Phe Gly Leu Ser Trp Asn Gln Gln Val Thr Gln Met Ala Leu Trp Ala
275 280 285 Ile Met Ala Ala Pro Leu Phe Met Ser Asn Asp Leu Arg His
Ile Ser 290 295 300 Pro Gln Ala Lys Ala Leu Leu Gln Asp Lys Asp Val
Ile Ala Ile Asn 305 310 315 320 Gln Asp Pro Leu Gly Lys Gln Gly Tyr
Gln Leu Arg Gln Gly Asp Asn 325 330 335 Phe Glu Val Trp Glu Arg Pro
Leu Ser Gly Leu Ala Trp Ala Val Ala 340 345 350 Met Ile Asn Arg Gln
Glu Ile Gly Gly Pro Arg Ser Tyr Thr Ile Ala 355 360 365 Val Ala Ser
Leu Gly Lys Gly Val Ala Cys Asn Pro Ala Cys Phe Ile 370 375 380 Thr
Gln Leu Leu Pro Val Lys Arg Lys Leu Gly Phe Tyr Glu Trp Thr 385 390
395 400 Ser Arg Leu Arg Ser His Ile Asn Pro Thr Gly Thr Val Leu Leu
Gln 405 410 415 Leu Glu Asn Thr Met Gln Met Ser Leu Lys Asp Leu Leu
Ser Glu Lys 420 425 430 Asp Glu Leu 435 7 1278 DNA Homo sapiens 7
atgcagctga ggaacccaga actacatctg ggctgcgcgc ttgcgcttcg cttcctggcc
60 ctcgtttcct gggacatccc tggggctaga gcactggaca atggattggc
aaggacgcct 120 accatgggct ggctgcactg ggagcgcttc atgtgcaacc
ttgactgcca ggaagagcca 180 gattcctgca tcagtgagaa gctcttcatg
gagatggcag agctcatggt ctcagaaggc 240 tggaaggatg caggttatga
gtacctctgc attgatgact gttggatggc tccccaaaga 300 gattcagaag
gcagacttca ggcagaccct cagcgctttc ctcatgggat tcgccagcta 360
gctaattatg ttcacagcaa aggactgaag ctagggattt atgcagatgt tggaaataaa
420 acctgcgcag gcttccctgg gagttttgga tactacgaca ttgatgccca
gacctttgct 480 gactggggag tagatctgct aaaatttgat ggttgttact
gtgacagttt ggaaaatttg 540 gcagatggtt ataagcacat gtccttggcc
ctgaatagga ctggcagaag cattgtgtac 600 tcctgtgagt ggcctcttta
tatgtggccc tttcaaaagc ccaattatac agaaatccga 660 cagtactgca
atcactggcg aaattttgct gacattgatg attcctggaa aagtataaag 720
agtatcttgg actggacatc ttttaaccag gagagaattg ttgatgttgc tggaccaggg
780 ggttggaatg acccagatat gttagtgatt ggcaactttg gcctcagctg
gaatcagcaa 840 gtaactcaga tggccctctg ggctatcatg gctgctcctt
tattcatgtc taatgacctc 900 cgacacatca gccctcaagc caaagctctc
cttcaggata aggacgtaat tgccatcaat 960 caggacccct tgggcaagca
agggtaccag cttagacagg gagacaactt tgaagtgtgg 1020 gaacgacctc
tctcaggctt agcctgggct gtagctatga taaaccggca ggagattggt 1080
ggacctcgct cttataccat cgcagttgct tccctgggta aaggagtggc ctgtaatcct
1140 gcctgcttca tcacacagct cctccctgtg aaaaggaagc tagggttcta
tgaatggact 1200 tcaaggttaa gaagtcacat aaatcccaca ggcactgttt
tgcttcagct agaaaacaca 1260 atgcagatgt ctttatga 1278 8 424 PRT Homo
sapiens 8 Gln Leu Arg Asn Pro Glu Leu His Leu Gly Cys Ala Leu Ala
Leu Arg 1 5 10 15 Phe Leu Ala Leu Val Ser Trp Asp Ile Pro Gly Ala
Arg Ala Leu Asp 20 25 30 Asn Gly Leu Ala Arg Thr Pro Thr Met Gly
Trp Leu His Trp Glu Arg 35 40 45 Phe Met Cys Asn Leu Asp Cys Gln
Glu Glu Pro Asp Ser Cys Ile Ser 50 55 60 Glu Lys Leu Phe Met Glu
Met Ala Glu Leu Met Val Ser Glu Gly Trp 65 70 75 80 Lys Asp Ala Gly
Tyr Glu Tyr Leu Cys Ile Asp Asp Cys Trp Met Ala 85 90 95 Pro Gln
Arg Asp Ser Glu Gly Arg Leu Gln Ala Asp Pro Gln Arg Phe 100 105 110
Pro His Gly Ile Arg Gln Leu Ala Asn Tyr Val His Ser Lys Gly Leu 115
120 125 Lys Leu Gly Ile Tyr Ala Asp Val Gly Asn Lys Thr Cys Ala Gly
Phe 130 135 140 Pro Gly Ser Phe Gly Tyr Tyr Asp Ile Asp Ala Gln Thr
Phe Ala Asp 145 150 155 160 Trp Gly Val Asp Leu Leu Lys Phe Asp Gly
Cys Tyr Cys Asp Ser Leu 165 170 175 Glu Asn Leu Ala Asp Gly Tyr Lys
His Met Ser Leu Ala Leu Asn Arg 180 185 190 Thr Gly Arg Ser Ile Val
Tyr Ser Cys Glu Trp Pro Leu Tyr Met Trp 195 200 205 Pro Phe Gln Lys
Pro Asn Tyr Thr Glu Ile Arg Gln Tyr Cys Asn His 210 215 220 Trp Arg
Asn Phe Ala Asp Ile Asp Asp Ser Trp Lys Ser Ile Lys Ser 225 230 235
240 Ile Leu Asp Trp Thr Ser Phe Asn Gln Glu Arg Ile Val Asp Val Ala
245 250 255 Gly Pro Gly Gly Trp Asn Asp Pro Asp Met Leu Val Ile Gly
Asn Phe 260 265 270 Gly Leu Ser Trp Asn Gln Gln Val Thr Gln Met Ala
Leu Trp Ala Ile 275 280 285 Met Ala Ala Pro Leu Phe Met Ser Asn Asp
Leu Arg His Ile Ser Pro 290 295 300 Gln Ala Lys Ala Leu Leu Gln Asp
Lys Asp Val Ile Ala Ile Asn Gln 305 310 315 320 Asp Pro Leu Gly Lys
Gln Gly Tyr Gln Leu Arg Gln Gly Asp Asn Phe 325 330 335 Glu Val Trp
Glu Arg Pro Leu Ser Gly Leu Ala Trp Ala Val Ala Met 340 345 350 Ile
Asn Arg Gln Glu Ile Gly Gly Pro Arg Ser Tyr Thr Ile Ala Val 355 360
365 Ala Ser Leu Gly Lys Gly Val Ala Cys Asn Pro Ala Cys Phe Ile Thr
370 375 380 Gln Leu Leu Pro Val Lys Arg Lys Leu Gly Phe Tyr Glu Trp
Thr Ser 385 390 395 400 Arg Leu Arg Ser His Ile Asn Pro Thr Gly Thr
Val Leu Leu Gln Leu 405 410 415 Glu Asn Thr Met Gln Met Ser Leu 420
9 1296 DNA Homo sapiens 9 atgcagctga ggaacccaga actacatctg
ggctgcgcgc ttgcgcttcg cttcctggcc 60 ctcgtttcct gggacatccc
tggggctaga gcactggaca atggattggc aaggacgcct 120 accatgggct
ggctgcactg ggagcgcttc atgtgcaacc ttgactgcca ggaagagcca 180
gattcctgca tcagtgagaa gctcttcatg gagatggcag agctcatggt ctcagaaggc
240 tggaaggatg caggttatga gtacctctgc attgatgact gttggatggc
tccccaaaga 300 gattcagaag gcagacttca ggcagaccct cagcgctttc
ctcatgggat tcgccagcta 360 gctaattatg ttcacagcaa aggactgaag
ctagggattt atgcagatgt tggaaataaa 420 acctgcgcag gcttccctgg
gagttttgga tactacgaca ttgatgccca gacctttgct 480 gactggggag
tagatctgct aaaatttgat ggttgttact gtgacagttt ggaaaatttg 540
gcagatggtt ataagcacat gtccttggcc ctgaatagga ctggcagaag cattgtgtac
600 tcctgtgagt ggcctcttta tatgtggccc tttcaaaagc ccaattatac
agaaatccga 660 cagtactgca atcactggcg aaattttgct gacattgatg
attcctggaa aagtataaag 720 agtatcttgg actggacatc ttttaaccag
gagagaattg ttgatgttgc tggaccaggg 780 ggttggaatg acccagatat
gttagtgatt ggcaactttg gcctcagctg gaatcagcaa 840 gtaactcaga
tggccctctg ggctatcatg gctgctcctt tattcatgtc taatgacctc 900
cgacacatca gccctcaagc caaagctctc cttcaggata aggacgtaat tgccatcaat
960 caggacccct tgggcaagca agggtaccag cttagacagg gagacaactt
tgaagtgtgg 1020 gaacgacctc tctcaggctt agcctgggct gtagctatga
taaaccggca ggagattggt 1080 ggacctcgct cttataccat cgcagttgct
tccctgggta aaggagtggc ctgtaatcct 1140 gcctgcttca tcacacagct
cctccctgtg aaaaggaagc tagggttcta tgaatggact 1200 tcaaggttaa
gaagtcacat aaatcccaca ggcactgttt tgcttcagct agaaaacaca 1260
atgcagatgt ctttatctga aaaggacgaa ttatga 1296 10 431 PRT Homo
sapiens 10 Met Gln Leu Arg Asn Pro Glu Leu His Leu Gly Cys Ala Leu
Ala Leu 1 5 10 15 Arg Phe Leu Ala Leu Val Ser Trp Asp Ile Pro Gly
Ala Arg Ala Leu 20 25 30 Asp Asn Gly Leu Ala Arg Thr Pro Thr Met
Gly Trp Leu His Trp Glu 35 40 45 Arg Phe Met Cys Asn Leu Asp Cys
Gln Glu Glu Pro Asp Ser Cys Ile 50 55 60 Ser Glu Lys Leu Phe Met
Glu Met Ala Glu Leu Met Val Ser Glu Gly 65 70 75 80 Trp Lys Asp Ala
Gly Tyr Glu Tyr Leu Cys Ile Asp Asp Cys Trp Met 85 90 95 Ala Pro
Gln Arg Asp Ser Glu Gly Arg Leu Gln Ala Asp Pro Gln Arg 100 105 110
Phe Pro His Gly Ile Arg Gln Leu Ala Asn Tyr Val His Ser Lys Gly 115
120 125 Leu Lys Leu Gly Ile Tyr Ala Asp Val Gly Asn Lys Thr Cys Ala
Gly 130 135 140 Phe Pro Gly Ser Phe Gly Tyr Tyr Asp Ile Asp Ala Gln
Thr Phe Ala 145 150 155 160 Asp Trp Gly Val Asp Leu Leu Lys Phe Asp
Gly Cys Tyr Cys Asp Ser 165 170 175 Leu Glu Asn Leu Ala Asp Gly Tyr
Lys His Met Ser Leu Ala Leu Asn 180 185 190 Arg Thr Gly Arg Ser Ile
Val Tyr Ser Cys Glu Trp Pro Leu Tyr Met 195 200 205 Trp Pro Phe Gln
Lys Pro Asn Tyr Thr Glu Ile Arg Gln Tyr Cys Asn 210 215 220 His Trp
Arg Asn Phe Ala Asp Ile Asp Asp Ser Trp Lys Ser Ile Lys 225 230
235
240 Ser Ile Leu Asp Trp Thr Ser Phe Asn Gln Glu Arg Ile Val Asp Val
245 250 255 Ala Gly Pro Gly Gly Trp Asn Asp Pro Asp Met Leu Val Ile
Gly Asn 260 265 270 Phe Gly Leu Ser Trp Asn Gln Gln Val Thr Gln Met
Ala Leu Trp Ala 275 280 285 Ile Met Ala Ala Pro Leu Phe Met Ser Asn
Asp Leu Arg His Ile Ser 290 295 300 Pro Gln Ala Lys Ala Leu Leu Gln
Asp Lys Asp Val Ile Ala Ile Asn 305 310 315 320 Gln Asp Pro Leu Gly
Lys Gln Gly Tyr Gln Leu Arg Gln Gly Asp Asn 325 330 335 Phe Glu Val
Trp Glu Arg Pro Leu Ser Gly Leu Ala Trp Ala Val Ala 340 345 350 Met
Ile Asn Arg Gln Glu Ile Gly Gly Pro Arg Ser Tyr Thr Ile Ala 355 360
365 Val Ala Ser Leu Gly Lys Gly Val Ala Cys Asn Pro Ala Cys Phe Ile
370 375 380 Thr Gln Leu Leu Pro Val Lys Arg Lys Leu Gly Phe Tyr Glu
Trp Thr 385 390 395 400 Ser Arg Leu Arg Ser His Ile Asn Pro Thr Gly
Thr Val Leu Leu Gln 405 410 415 Leu Glu Asn Thr Met Gln Met Ser Leu
Ser Glu Lys Asp Glu Leu 420 425 430 11 1266 DNA Homo sapiens 11
atgcagctga ggaacccaga actacatctg ggctgcgcgc ttgcgcttcg cttcctggcc
60 ctcgtttcct gggacatccc tggggctaga gcactggaca atggattggc
aaggacgcct 120 accatgggct ggctgcactg ggagcgcttc atgtgcaacc
ttgactgcca ggaagagcca 180 gattcctgca tcagtgagaa gctcttcatg
gagatggcag agctcatggt ctcagaaggc 240 tggaaggatg caggttatga
gtacctctgc attgatgact gttggatggc tccccaaaga 300 gattcagaag
gcagacttca ggcagaccct cagcgctttc ctcatgggat tcgccagcta 360
gctaattatg ttcacagcaa aggactgaag ctagggattt atgcagatgt tggaaataaa
420 acctgcgcag gcttccctgg gagttttgga tactacgaca ttgatgccca
gacctttgct 480 gactggggag tagatctgct aaaatttgat ggttgttact
gtgacagttt ggaaaatttg 540 gcagatggtt ataagcacat gtccttggcc
ctgaatagga ctggcagaag cattgtgtac 600 tcctgtgagt ggcctcttta
tatgtggccc tttcaaaagc ccaattatac agaaatccga 660 cagtactgca
atcactggcg aaattttgct gacattgatg attcctggaa aagtataaag 720
agtatcttgg actggacatc ttttaaccag gagagaattg ttgatgttgc tggaccaggg
780 ggttggaatg acccagatat gttagtgatt ggcaactttg gcctcagctg
gaatcagcaa 840 gtaactcaga tggccctctg ggctatcatg gctgctcctt
tattcatgtc taatgacctc 900 cgacacatca gccctcaagc caaagctctc
cttcaggata aggacgtaat tgccatcaat 960 caggacccct tgggcaagca
agggtaccag cttagacagg gagacaactt tgaagtgtgg 1020 gaacgacctc
tctcaggctt agcctgggct gtagctatga taaaccggca ggagattggt 1080
ggacctcgct cttataccat cgcagttgct tccctgggta aaggagtggc ctgtaatcct
1140 gcctgcttca tcacacagct cctccctgtg aaaaggaagc tagggttcta
tgaatggact 1200 tcaaggttaa gaagtcacat aaatcccaca ggcactgttt
tgcttcagct agaaaacaca 1260 atgtaa 1266 12 421 PRT Homo sapiens 12
Met Gln Leu Arg Asn Pro Glu Leu His Leu Gly Cys Ala Leu Ala Leu 1 5
10 15 Arg Phe Leu Ala Leu Val Ser Trp Asp Ile Pro Gly Ala Arg Ala
Leu 20 25 30 Asp Asn Gly Leu Ala Arg Thr Pro Thr Met Gly Trp Leu
His Trp Glu 35 40 45 Arg Phe Met Cys Asn Leu Asp Cys Gln Glu Glu
Pro Asp Ser Cys Ile 50 55 60 Ser Glu Lys Leu Phe Met Glu Met Ala
Glu Leu Met Val Ser Glu Gly 65 70 75 80 Trp Lys Asp Ala Gly Tyr Glu
Tyr Leu Cys Ile Asp Asp Cys Trp Met 85 90 95 Ala Pro Gln Arg Asp
Ser Glu Gly Arg Leu Gln Ala Asp Pro Gln Arg 100 105 110 Phe Pro His
Gly Ile Arg Gln Leu Ala Asn Tyr Val His Ser Lys Gly 115 120 125 Leu
Lys Leu Gly Ile Tyr Ala Asp Val Gly Asn Lys Thr Cys Ala Gly 130 135
140 Phe Pro Gly Ser Phe Gly Tyr Tyr Asp Ile Asp Ala Gln Thr Phe Ala
145 150 155 160 Asp Trp Gly Val Asp Leu Leu Lys Phe Asp Gly Cys Tyr
Cys Asp Ser 165 170 175 Leu Glu Asn Leu Ala Asp Gly Tyr Lys His Met
Ser Leu Ala Leu Asn 180 185 190 Arg Thr Gly Arg Ser Ile Val Tyr Ser
Cys Glu Trp Pro Leu Tyr Met 195 200 205 Trp Pro Phe Gln Lys Pro Asn
Tyr Thr Glu Ile Arg Gln Tyr Cys Asn 210 215 220 His Trp Arg Asn Phe
Ala Asp Ile Asp Asp Ser Trp Lys Ser Ile Lys 225 230 235 240 Ser Ile
Leu Asp Trp Thr Ser Phe Asn Gln Glu Arg Ile Val Asp Val 245 250 255
Ala Gly Pro Gly Gly Trp Asn Asp Pro Asp Met Leu Val Ile Gly Asn 260
265 270 Phe Gly Leu Ser Trp Asn Gln Gln Val Thr Gln Met Ala Leu Trp
Ala 275 280 285 Ile Met Ala Ala Pro Leu Phe Met Ser Asn Asp Leu Arg
His Ile Ser 290 295 300 Pro Gln Ala Lys Ala Leu Leu Gln Asp Lys Asp
Val Ile Ala Ile Asn 305 310 315 320 Gln Asp Pro Leu Gly Lys Gln Gly
Tyr Gln Leu Arg Gln Gly Asp Asn 325 330 335 Phe Glu Val Trp Glu Arg
Pro Leu Ser Gly Leu Ala Trp Ala Val Ala 340 345 350 Met Ile Asn Arg
Gln Glu Ile Gly Gly Pro Arg Ser Tyr Thr Ile Ala 355 360 365 Val Ala
Ser Leu Gly Lys Gly Val Ala Cys Asn Pro Ala Cys Phe Ile 370 375 380
Thr Gln Leu Leu Pro Val Lys Arg Lys Leu Gly Phe Tyr Glu Trp Thr 385
390 395 400 Ser Arg Leu Arg Ser His Ile Asn Pro Thr Gly Thr Val Leu
Leu Gln 405 410 415 Leu Glu Asn Thr Met 420 13 1284 DNA Homo
sapiens 13 atgcagctga ggaacccaga actacatctg ggctgcgcgc ttgcgcttcg
cttcctggcc 60 ctcgtttcct gggacatccc tggggctaga gcactggaca
atggattggc aaggacgcct 120 accatgggct ggctgcactg ggagcgcttc
atgtgcaacc ttgactgcca ggaagagcca 180 gattcctgca tcagtgagaa
gctcttcatg gagatggcag agctcatggt ctcagaaggc 240 tggaaggatg
caggttatga gtacctctgc attgatgact gttggatggc tccccaaaga 300
gattcagaag gcagacttca ggcagaccct cagcgctttc ctcatgggat tcgccagcta
360 gctaattatg ttcacagcaa aggactgaag ctagggattt atgcagatgt
tggaaataaa 420 acctgcgcag gcttccctgg gagttttgga tactacgaca
ttgatgccca gacctttgct 480 gactggggag tagatctgct aaaatttgat
ggttgttact gtgacagttt ggaaaatttg 540 gcagatggtt ataagcacat
gtccttggcc ctgaatagga ctggcagaag cattgtgtac 600 tcctgtgagt
ggcctcttta tatgtggccc tttcaaaagc ccaattatac agaaatccga 660
cagtactgca atcactggcg aaattttgct gacattgatg attcctggaa aagtataaag
720 agtatcttgg actggacatc ttttaaccag gagagaattg ttgatgttgc
tggaccaggg 780 ggttggaatg acccagatat gttagtgatt ggcaactttg
gcctcagctg gaatcagcaa 840 gtaactcaga tggccctctg ggctatcatg
gctgctcctt tattcatgtc taatgacctc 900 cgacacatca gccctcaagc
caaagctctc cttcaggata aggacgtaat tgccatcaat 960 caggacccct
tgggcaagca agggtaccag cttagacagg gagacaactt tgaagtgtgg 1020
gaacgacctc tctcaggctt agcctgggct gtagctatga taaaccggca ggagattggt
1080 ggacctcgct cttataccat cgcagttgct tccctgggta aaggagtggc
ctgtaatcct 1140 gcctgcttca tcacacagct cctccctgtg aaaaggaagc
tagggttcta tgaatggact 1200 tcaaggttaa gaagtcacat aaatcccaca
ggcactgttt tgcttcagct agaaaacaca 1260 atgtctgaaa aggacgaatt atga
1284 14 427 PRT Homo sapiens 14 Met Gln Leu Arg Asn Pro Glu Leu His
Leu Gly Cys Ala Leu Ala Leu 1 5 10 15 Arg Phe Leu Ala Leu Val Ser
Trp Asp Ile Pro Gly Ala Arg Ala Leu 20 25 30 Asp Asn Gly Leu Ala
Arg Thr Pro Thr Met Gly Trp Leu His Trp Glu 35 40 45 Arg Phe Met
Cys Asn Leu Asp Cys Gln Glu Glu Pro Asp Ser Cys Ile 50 55 60 Ser
Glu Lys Leu Phe Met Glu Met Ala Glu Leu Met Val Ser Glu Gly 65 70
75 80 Trp Lys Asp Ala Gly Tyr Glu Tyr Leu Cys Ile Asp Asp Cys Trp
Met 85 90 95 Ala Pro Gln Arg Asp Ser Glu Gly Arg Leu Gln Ala Asp
Pro Gln Arg 100 105 110 Phe Pro His Gly Ile Arg Gln Leu Ala Asn Tyr
Val His Ser Lys Gly 115 120 125 Leu Lys Leu Gly Ile Tyr Ala Asp Val
Gly Asn Lys Thr Cys Ala Gly 130 135 140 Phe Pro Gly Ser Phe Gly Tyr
Tyr Asp Ile Asp Ala Gln Thr Phe Ala 145 150 155 160 Asp Trp Gly Val
Asp Leu Leu Lys Phe Asp Gly Cys Tyr Cys Asp Ser 165 170 175 Leu Glu
Asn Leu Ala Asp Gly Tyr Lys His Met Ser Leu Ala Leu Asn 180 185 190
Arg Thr Gly Arg Ser Ile Val Tyr Ser Cys Glu Trp Pro Leu Tyr Met 195
200 205 Trp Pro Phe Gln Lys Pro Asn Tyr Thr Glu Ile Arg Gln Tyr Cys
Asn 210 215 220 His Trp Arg Asn Phe Ala Asp Ile Asp Asp Ser Trp Lys
Ser Ile Lys 225 230 235 240 Ser Ile Leu Asp Trp Thr Ser Phe Asn Gln
Glu Arg Ile Val Asp Val 245 250 255 Ala Gly Pro Gly Gly Trp Asn Asp
Pro Asp Met Leu Val Ile Gly Asn 260 265 270 Phe Gly Leu Ser Trp Asn
Gln Gln Val Thr Gln Met Ala Leu Trp Ala 275 280 285 Ile Met Ala Ala
Pro Leu Phe Met Ser Asn Asp Leu Arg His Ile Ser 290 295 300 Pro Gln
Ala Lys Ala Leu Leu Gln Asp Lys Asp Val Ile Ala Ile Asn 305 310 315
320 Gln Asp Pro Leu Gly Lys Gln Gly Tyr Gln Leu Arg Gln Gly Asp Asn
325 330 335 Phe Glu Val Trp Glu Arg Pro Leu Ser Gly Leu Ala Trp Ala
Val Ala 340 345 350 Met Ile Asn Arg Gln Glu Ile Gly Gly Pro Arg Ser
Tyr Thr Ile Ala 355 360 365 Val Ala Ser Leu Gly Lys Gly Val Ala Cys
Asn Pro Ala Cys Phe Ile 370 375 380 Thr Gln Leu Leu Pro Val Lys Arg
Lys Leu Gly Phe Tyr Glu Trp Thr 385 390 395 400 Ser Arg Leu Arg Ser
His Ile Asn Pro Thr Gly Thr Val Leu Leu Gln 405 410 415 Leu Glu Asn
Thr Met Ser Glu Lys Asp Glu Leu 420 425 15 1254 DNA Homo sapiens 15
atgcagctga ggaacccaga actacatctg ggctgcgcgc ttgcgcttcg cttcctggcc
60 ctcgtttcct gggacatccc tggggctaga gcactggaca atggattggc
aaggacgcct 120 accatgggct ggctgcactg ggagcgcttc atgtgcaacc
ttgactgcca ggaagagcca 180 gattcctgca tcagtgagaa gctcttcatg
gagatggcag agctcatggt ctcagaaggc 240 tggaaggatg caggttatga
gtacctctgc attgatgact gttggatggc tccccaaaga 300 gattcagaag
gcagacttca ggcagaccct cagcgctttc ctcatgggat tcgccagcta 360
gctaattatg ttcacagcaa aggactgaag ctagggattt atgcagatgt tggaaataaa
420 acctgcgcag gcttccctgg gagttttgga tactacgaca ttgatgccca
gacctttgct 480 gactggggag tagatctgct aaaatttgat ggttgttact
gtgacagttt ggaaaatttg 540 gcagatggtt ataagcacat gtccttggcc
ctgaatagga ctggcagaag cattgtgtac 600 tcctgtgagt ggcctcttta
tatgtggccc tttcaaaagc ccaattatac agaaatccga 660 cagtactgca
atcactggcg aaattttgct gacattgatg attcctggaa aagtataaag 720
agtatcttgg actggacatc ttttaaccag gagagaattg ttgatgttgc tggaccaggg
780 ggttggaatg acccagatat gttagtgatt ggcaactttg gcctcagctg
gaatcagcaa 840 gtaactcaga tggccctctg ggctatcatg gctgctcctt
tattcatgtc taatgacctc 900 cgacacatca gccctcaagc caaagctctc
cttcaggata aggacgtaat tgccatcaat 960 caggacccct tgggcaagca
agggtaccag cttagacagg gagacaactt tgaagtgtgg 1020 gaacgacctc
tctcaggctt agcctgggct gtagctatga taaaccggca ggagattggt 1080
ggacctcgct cttataccat cgcagttgct tccctgggta aaggagtggc ctgtaatcct
1140 gcctgcttca tcacacagct cctccctgtg aaaaggaagc tagggttcta
tgaatggact 1200 tcaaggttaa gaagtcacat aaatcccaca ggcactgttt
tgcttcagct ataa 1254 16 417 PRT Homo sapiens 16 Met Gln Leu Arg Asn
Pro Glu Leu His Leu Gly Cys Ala Leu Ala Leu 1 5 10 15 Arg Phe Leu
Ala Leu Val Ser Trp Asp Ile Pro Gly Ala Arg Ala Leu 20 25 30 Asp
Asn Gly Leu Ala Arg Thr Pro Thr Met Gly Trp Leu His Trp Glu 35 40
45 Arg Phe Met Cys Asn Leu Asp Cys Gln Glu Glu Pro Asp Ser Cys Ile
50 55 60 Ser Glu Lys Leu Phe Met Glu Met Ala Glu Leu Met Val Ser
Glu Gly 65 70 75 80 Trp Lys Asp Ala Gly Tyr Glu Tyr Leu Cys Ile Asp
Asp Cys Trp Met 85 90 95 Ala Pro Gln Arg Asp Ser Glu Gly Arg Leu
Gln Ala Asp Pro Gln Arg 100 105 110 Phe Pro His Gly Ile Arg Gln Leu
Ala Asn Tyr Val His Ser Lys Gly 115 120 125 Leu Lys Leu Gly Ile Tyr
Ala Asp Val Gly Asn Lys Thr Cys Ala Gly 130 135 140 Phe Pro Gly Ser
Phe Gly Tyr Tyr Asp Ile Asp Ala Gln Thr Phe Ala 145 150 155 160 Asp
Trp Gly Val Asp Leu Leu Lys Phe Asp Gly Cys Tyr Cys Asp Ser 165 170
175 Leu Glu Asn Leu Ala Asp Gly Tyr Lys His Met Ser Leu Ala Leu Asn
180 185 190 Arg Thr Gly Arg Ser Ile Val Tyr Ser Cys Glu Trp Pro Leu
Tyr Met 195 200 205 Trp Pro Phe Gln Lys Pro Asn Tyr Thr Glu Ile Arg
Gln Tyr Cys Asn 210 215 220 His Trp Arg Asn Phe Ala Asp Ile Asp Asp
Ser Trp Lys Ser Ile Lys 225 230 235 240 Ser Ile Leu Asp Trp Thr Ser
Phe Asn Gln Glu Arg Ile Val Asp Val 245 250 255 Ala Gly Pro Gly Gly
Trp Asn Asp Pro Asp Met Leu Val Ile Gly Asn 260 265 270 Phe Gly Leu
Ser Trp Asn Gln Gln Val Thr Gln Met Ala Leu Trp Ala 275 280 285 Ile
Met Ala Ala Pro Leu Phe Met Ser Asn Asp Leu Arg His Ile Ser 290 295
300 Pro Gln Ala Lys Ala Leu Leu Gln Asp Lys Asp Val Ile Ala Ile Asn
305 310 315 320 Gln Asp Pro Leu Gly Lys Gln Gly Tyr Gln Leu Arg Gln
Gly Asp Asn 325 330 335 Phe Glu Val Trp Glu Arg Pro Leu Ser Gly Leu
Ala Trp Ala Val Ala 340 345 350 Met Ile Asn Arg Gln Glu Ile Gly Gly
Pro Arg Ser Tyr Thr Ile Ala 355 360 365 Val Ala Ser Leu Gly Lys Gly
Val Ala Cys Asn Pro Ala Cys Phe Ile 370 375 380 Thr Gln Leu Leu Pro
Val Lys Arg Lys Leu Gly Phe Tyr Glu Trp Thr 385 390 395 400 Ser Arg
Leu Arg Ser His Ile Asn Pro Thr Gly Thr Val Leu Leu Gln 405 410 415
Leu 17 1272 DNA Homo sapiens 17 atgcagctga ggaacccaga actacatctg
ggctgcgcgc ttgcgcttcg cttcctggcc 60 ctcgtttcct gggacatccc
tggggctaga gcactggaca atggattggc aaggacgcct 120 accatgggct
ggctgcactg ggagcgcttc atgtgcaacc ttgactgcca ggaagagcca 180
gattcctgca tcagtgagaa gctcttcatg gagatggcag agctcatggt ctcagaaggc
240 tggaaggatg caggttatga gtacctctgc attgatgact gttggatggc
tccccaaaga 300 gattcagaag gcagacttca ggcagaccct cagcgctttc
ctcatgggat tcgccagcta 360 gctaattatg ttcacagcaa aggactgaag
ctagggattt atgcagatgt tggaaataaa 420 acctgcgcag gcttccctgg
gagttttgga tactacgaca ttgatgccca gacctttgct 480 gactggggag
tagatctgct aaaatttgat ggttgttact gtgacagttt ggaaaatttg 540
gcagatggtt ataagcacat gtccttggcc ctgaatagga ctggcagaag cattgtgtac
600 tcctgtgagt ggcctcttta tatgtggccc tttcaaaagc ccaattatac
agaaatccga 660 cagtactgca atcactggcg aaattttgct gacattgatg
attcctggaa aagtataaag 720 agtatcttgg actggacatc ttttaaccag
gagagaattg ttgatgttgc tggaccaggg 780 ggttggaatg acccagatat
gttagtgatt ggcaactttg gcctcagctg gaatcagcaa 840 gtaactcaga
tggccctctg ggctatcatg gctgctcctt tattcatgtc taatgacctc 900
cgacacatca gccctcaagc caaagctctc cttcaggata aggacgtaat tgccatcaat
960 caggacccct tgggcaagca agggtaccag cttagacagg gagacaactt
tgaagtgtgg 1020 gaacgacctc tctcaggctt agcctgggct gtagctatga
taaaccggca ggagattggt 1080 ggacctcgct cttataccat cgcagttgct
tccctgggta aaggagtggc ctgtaatcct 1140 gcctgcttca tcacacagct
cctccctgtg aaaaggaagc tagggttcta tgaatggact 1200 tcaaggttaa
gaagtcacat aaatcccaca ggcactgttt tgcttcagct atctgaaaag 1260
gacgaattat ga 1272 18 423 PRT Homo sapiens 18 Met Gln Leu Arg Asn
Pro Glu Leu His Leu Gly Cys Ala Leu Ala Leu 1 5 10 15 Arg Phe Leu
Ala Leu Val Ser Trp Asp Ile Pro Gly Ala Arg Ala Leu 20 25 30 Asp
Asn Gly Leu Ala Arg Thr Pro Thr Met Gly Trp Leu His Trp Glu 35 40
45 Arg Phe Met Cys Asn Leu Asp Cys Gln Glu Glu Pro Asp Ser Cys Ile
50 55 60 Ser Glu Lys Leu Phe Met Glu Met Ala Glu Leu Met Val Ser
Glu Gly 65 70 75 80 Trp Lys Asp Ala Gly Tyr Glu Tyr Leu Cys Ile Asp
Asp Cys Trp Met 85 90 95 Ala Pro Gln Arg Asp Ser Glu Gly Arg Leu
Gln Ala Asp Pro Gln Arg 100 105
110 Phe Pro His Gly Ile Arg Gln Leu Ala Asn Tyr Val His Ser Lys Gly
115 120 125 Leu Lys Leu Gly Ile Tyr Ala Asp Val Gly Asn Lys Thr Cys
Ala Gly 130 135 140 Phe Pro Gly Ser Phe Gly Tyr Tyr Asp Ile Asp Ala
Gln Thr Phe Ala 145 150 155 160 Asp Trp Gly Val Asp Leu Leu Lys Phe
Asp Gly Cys Tyr Cys Asp Ser 165 170 175 Leu Glu Asn Leu Ala Asp Gly
Tyr Lys His Met Ser Leu Ala Leu Asn 180 185 190 Arg Thr Gly Arg Ser
Ile Val Tyr Ser Cys Glu Trp Pro Leu Tyr Met 195 200 205 Trp Pro Phe
Gln Lys Pro Asn Tyr Thr Glu Ile Arg Gln Tyr Cys Asn 210 215 220 His
Trp Arg Asn Phe Ala Asp Ile Asp Asp Ser Trp Lys Ser Ile Lys 225 230
235 240 Ser Ile Leu Asp Trp Thr Ser Phe Asn Gln Glu Arg Ile Val Asp
Val 245 250 255 Ala Gly Pro Gly Gly Trp Asn Asp Pro Asp Met Leu Val
Ile Gly Asn 260 265 270 Phe Gly Leu Ser Trp Asn Gln Gln Val Thr Gln
Met Ala Leu Trp Ala 275 280 285 Ile Met Ala Ala Pro Leu Phe Met Ser
Asn Asp Leu Arg His Ile Ser 290 295 300 Pro Gln Ala Lys Ala Leu Leu
Gln Asp Lys Asp Val Ile Ala Ile Asn 305 310 315 320 Gln Asp Pro Leu
Gly Lys Gln Gly Tyr Gln Leu Arg Gln Gly Asp Asn 325 330 335 Phe Glu
Val Trp Glu Arg Pro Leu Ser Gly Leu Ala Trp Ala Val Ala 340 345 350
Met Ile Asn Arg Gln Glu Ile Gly Gly Pro Arg Ser Tyr Thr Ile Ala 355
360 365 Val Ala Ser Leu Gly Lys Gly Val Ala Cys Asn Pro Ala Cys Phe
Ile 370 375 380 Thr Gln Leu Leu Pro Val Lys Arg Lys Leu Gly Phe Tyr
Glu Trp Thr 385 390 395 400 Ser Arg Leu Arg Ser His Ile Asn Pro Thr
Gly Thr Val Leu Leu Gln 405 410 415 Leu Ser Glu Lys Asp Glu Leu 420
19 1215 DNA Homo sapiens 19 atgcagctga ggaacccaga actacatctg
ggctgcgcgc ttgcgcttcg cttcctggcc 60 ctcgtttcct gggacatccc
tggggctaga gcactggaca atggattggc aaggacgcct 120 accatgggct
ggctgcactg ggagcgcttc atgtgcaacc ttgactgcca ggaagagcca 180
gattcctgca tcagtgagaa gctcttcatg gagatggcag agctcatggt ctcagaaggc
240 tggaaggatg caggttatga gtacctctgc attgatgact gttggatggc
tccccaaaga 300 gattcagaag gcagacttca ggcagaccct cagcgctttc
ctcatgggat tcgccagcta 360 gctaattatg ttcacagcaa aggactgaag
ctagggattt atgcagatgt tggaaataaa 420 acctgcgcag gcttccctgg
gagttttgga tactacgaca ttgatgccca gacctttgct 480 gactggggag
tagatctgct aaaatttgat ggttgttact gtgacagttt ggaaaatttg 540
gcagatggtt ataagcacat gtccttggcc ctgaatagga ctggcagaag cattgtgtac
600 tcctgtgagt ggcctcttta tatgtggccc tttcaaaagc ccaattatac
agaaatccga 660 cagtactgca atcactggcg aaattttgct gacattgatg
attcctggaa aagtataaag 720 agtatcttgg actggacatc ttttaaccag
gagagaattg ttgatgttgc tggaccaggg 780 ggttggaatg acccagatat
gttagtgatt ggcaactttg gcctcagctg gaatcagcaa 840 gtaactcaga
tggccctctg ggctatcatg gctgctcctt tattcatgtc taatgacctc 900
cgacacatca gccctcaagc caaagctctc cttcaggata aggacgtaat tgccatcaat
960 caggacccct tgggcaagca agggtaccag cttagacagg gagacaactt
tgaagtgtgg 1020 gaacgacctc tctcaggctt agcctgggct gtagctatga
taaaccggca ggagattggt 1080 ggacctcgct cttataccat cgcagttgct
tccctgggta aaggagtggc ctgtaatcct 1140 gcctgcttca tcacacagct
cctccctgtg aaaaggaagc tagggttcta tgaatggact 1200 tcaaggttaa gataa
1215 20 401 PRT Homo sapiens 20 Arg Asn Pro Glu Leu His Leu Gly Cys
Ala Leu Ala Leu Arg Phe Leu 1 5 10 15 Ala Leu Val Ser Trp Asp Ile
Pro Gly Ala Arg Ala Leu Asp Asn Gly 20 25 30 Leu Ala Arg Thr Pro
Thr Met Gly Trp Leu His Trp Glu Arg Phe Met 35 40 45 Cys Asn Leu
Asp Cys Gln Glu Glu Pro Asp Ser Cys Ile Ser Glu Lys 50 55 60 Leu
Phe Met Glu Met Ala Glu Leu Met Val Ser Glu Gly Trp Lys Asp 65 70
75 80 Ala Gly Tyr Glu Tyr Leu Cys Ile Asp Asp Cys Trp Met Ala Pro
Gln 85 90 95 Arg Asp Ser Glu Gly Arg Leu Gln Ala Asp Pro Gln Arg
Phe Pro His 100 105 110 Gly Ile Arg Gln Leu Ala Asn Tyr Val His Ser
Lys Gly Leu Lys Leu 115 120 125 Gly Ile Tyr Ala Asp Val Gly Asn Lys
Thr Cys Ala Gly Phe Pro Gly 130 135 140 Ser Phe Gly Tyr Tyr Asp Ile
Asp Ala Gln Thr Phe Ala Asp Trp Gly 145 150 155 160 Val Asp Leu Leu
Lys Phe Asp Gly Cys Tyr Cys Asp Ser Leu Glu Asn 165 170 175 Leu Ala
Asp Gly Tyr Lys His Met Ser Leu Ala Leu Asn Arg Thr Gly 180 185 190
Arg Ser Ile Val Tyr Ser Cys Glu Trp Pro Leu Tyr Met Trp Pro Phe 195
200 205 Gln Lys Pro Asn Tyr Thr Glu Ile Arg Gln Tyr Cys Asn His Trp
Arg 210 215 220 Asn Phe Ala Asp Ile Asp Asp Ser Trp Lys Ser Ile Lys
Ser Ile Leu 225 230 235 240 Asp Trp Thr Ser Phe Asn Gln Glu Arg Ile
Val Asp Val Ala Gly Pro 245 250 255 Gly Gly Trp Asn Asp Pro Asp Met
Leu Val Ile Gly Asn Phe Gly Leu 260 265 270 Ser Trp Asn Gln Gln Val
Thr Gln Met Ala Leu Trp Ala Ile Met Ala 275 280 285 Ala Pro Leu Phe
Met Ser Asn Asp Leu Arg His Ile Ser Pro Gln Ala 290 295 300 Lys Ala
Leu Leu Gln Asp Lys Asp Val Ile Ala Ile Asn Gln Asp Pro 305 310 315
320 Leu Gly Lys Gln Gly Tyr Gln Leu Arg Gln Gly Asp Asn Phe Glu Val
325 330 335 Trp Glu Arg Pro Leu Ser Gly Leu Ala Trp Ala Val Ala Met
Ile Asn 340 345 350 Arg Gln Glu Ile Gly Gly Pro Arg Ser Tyr Thr Ile
Ala Val Ala Ser 355 360 365 Leu Gly Lys Gly Val Ala Cys Asn Pro Ala
Cys Phe Ile Thr Gln Leu 370 375 380 Leu Pro Val Lys Arg Lys Leu Gly
Phe Tyr Glu Trp Thr Ser Arg Leu 385 390 395 400 Arg 21 1233 DNA
Homo sapiens 21 atgcagctga ggaacccaga actacatctg ggctgcgcgc
ttgcgcttcg cttcctggcc 60 ctcgtttcct gggacatccc tggggctaga
gcactggaca atggattggc aaggacgcct 120 accatgggct ggctgcactg
ggagcgcttc atgtgcaacc ttgactgcca ggaagagcca 180 gattcctgca
tcagtgagaa gctcttcatg gagatggcag agctcatggt ctcagaaggc 240
tggaaggatg caggttatga gtacctctgc attgatgact gttggatggc tccccaaaga
300 gattcagaag gcagacttca ggcagaccct cagcgctttc ctcatgggat
tcgccagcta 360 gctaattatg ttcacagcaa aggactgaag ctagggattt
atgcagatgt tggaaataaa 420 acctgcgcag gcttccctgg gagttttgga
tactacgaca ttgatgccca gacctttgct 480 gactggggag tagatctgct
aaaatttgat ggttgttact gtgacagttt ggaaaatttg 540 gcagatggtt
ataagcacat gtccttggcc ctgaatagga ctggcagaag cattgtgtac 600
tcctgtgagt ggcctcttta tatgtggccc tttcaaaagc ccaattatac agaaatccga
660 cagtactgca atcactggcg aaattttgct gacattgatg attcctggaa
aagtataaag 720 agtatcttgg actggacatc ttttaaccag gagagaattg
ttgatgttgc tggaccaggg 780 ggttggaatg acccagatat gttagtgatt
ggcaactttg gcctcagctg gaatcagcaa 840 gtaactcaga tggccctctg
ggctatcatg gctgctcctt tattcatgtc taatgacctc 900 cgacacatca
gccctcaagc caaagctctc cttcaggata aggacgtaat tgccatcaat 960
caggacccct tgggcaagca agggtaccag cttagacagg gagacaactt tgaagtgtgg
1020 gaacgacctc tctcaggctt agcctgggct gtagctatga taaaccggca
ggagattggt 1080 ggacctcgct cttataccat cgcagttgct tccctgggta
aaggagtggc ctgtaatcct 1140 gcctgcttca tcacacagct cctccctgtg
aaaaggaagc tagggttcta tgaatggact 1200 tcaaggttaa gatctgaaaa
ggacgaatta tga 1233 22 409 PRT Homo sapiens 22 Gln Leu Arg Asn Pro
Glu Leu His Leu Gly Cys Ala Leu Ala Leu Arg 1 5 10 15 Phe Leu Ala
Leu Val Ser Trp Asp Ile Pro Gly Ala Arg Ala Leu Asp 20 25 30 Asn
Gly Leu Ala Arg Thr Pro Thr Met Gly Trp Leu His Trp Glu Arg 35 40
45 Phe Met Cys Asn Leu Asp Cys Gln Glu Glu Pro Asp Ser Cys Ile Ser
50 55 60 Glu Lys Leu Phe Met Glu Met Ala Glu Leu Met Val Ser Glu
Gly Trp 65 70 75 80 Lys Asp Ala Gly Tyr Glu Tyr Leu Cys Ile Asp Asp
Cys Trp Met Ala 85 90 95 Pro Gln Arg Asp Ser Glu Gly Arg Leu Gln
Ala Asp Pro Gln Arg Phe 100 105 110 Pro His Gly Ile Arg Gln Leu Ala
Asn Tyr Val His Ser Lys Gly Leu 115 120 125 Lys Leu Gly Ile Tyr Ala
Asp Val Gly Asn Lys Thr Cys Ala Gly Phe 130 135 140 Pro Gly Ser Phe
Gly Tyr Tyr Asp Ile Asp Ala Gln Thr Phe Ala Asp 145 150 155 160 Trp
Gly Val Asp Leu Leu Lys Phe Asp Gly Cys Tyr Cys Asp Ser Leu 165 170
175 Glu Asn Leu Ala Asp Gly Tyr Lys His Met Ser Leu Ala Leu Asn Arg
180 185 190 Thr Gly Arg Ser Ile Val Tyr Ser Cys Glu Trp Pro Leu Tyr
Met Trp 195 200 205 Pro Phe Gln Lys Pro Asn Tyr Thr Glu Ile Arg Gln
Tyr Cys Asn His 210 215 220 Trp Arg Asn Phe Ala Asp Ile Asp Asp Ser
Trp Lys Ser Ile Lys Ser 225 230 235 240 Ile Leu Asp Trp Thr Ser Phe
Asn Gln Glu Arg Ile Val Asp Val Ala 245 250 255 Gly Pro Gly Gly Trp
Asn Asp Pro Asp Met Leu Val Ile Gly Asn Phe 260 265 270 Gly Leu Ser
Trp Asn Gln Gln Val Thr Gln Met Ala Leu Trp Ala Ile 275 280 285 Met
Ala Ala Pro Leu Phe Met Ser Asn Asp Leu Arg His Ile Ser Pro 290 295
300 Gln Ala Lys Ala Leu Leu Gln Asp Lys Asp Val Ile Ala Ile Asn Gln
305 310 315 320 Asp Pro Leu Gly Lys Gln Gly Tyr Gln Leu Arg Gln Gly
Asp Asn Phe 325 330 335 Glu Val Trp Glu Arg Pro Leu Ser Gly Leu Ala
Trp Ala Val Ala Met 340 345 350 Ile Asn Arg Gln Glu Ile Gly Gly Pro
Arg Ser Tyr Thr Ile Ala Val 355 360 365 Ala Ser Leu Gly Lys Gly Val
Ala Cys Asn Pro Ala Cys Phe Ile Thr 370 375 380 Gln Leu Leu Pro Val
Lys Arg Lys Leu Gly Phe Tyr Glu Trp Thr Ser 385 390 395 400 Arg Leu
Arg Ser Glu Lys Asp Glu Leu 405 23 30 PRT Tobacco mosaic virus 23
Thr Ser Arg Leu Arg Ser His Ile Asn Pro Thr Gly Thr Val Leu Leu 1 5
10 15 Gln Leu Glu Asn Thr Met Gln Met Ser Leu Lys Asp Leu Leu 20 25
30 24 36 PRT Tobacco mosaic virus 24 Thr Ser Arg Leu Arg Ser His
Ile Asn Pro Thr Gly Thr Val Leu Leu 1 5 10 15 Gln Leu Glu Asn Thr
Met Gln Met Ser Leu Lys Asp Leu Leu Ser Glu 20 25 30 Lys Asp Glu
Leu 35 25 26 PRT Tobacco mosaic virus 25 Thr Ser Arg Leu Arg Ser
His Ile Asn Pro Thr Gly Thr Val Leu Leu 1 5 10 15 Gln Leu Glu Asn
Thr Met Gln Met Ser Leu 20 25 26 32 PRT Tobacco mosaic virus 26 Thr
Ser Arg Leu Arg Ser His Ile Asn Pro Thr Gly Thr Val Leu Leu 1 5 10
15 Gln Leu Glu Asn Thr Met Gln Met Ser Leu Ser Glu Lys Asp Glu Leu
20 25 30 27 22 PRT Tobacco mosaic virus 27 Thr Ser Arg Leu Arg Ser
His Ile Asn Pro Thr Gly Thr Val Leu Leu 1 5 10 15 Gln Leu Glu Asn
Thr Met 20 28 29 PRT Tobacco mosaic virus 28 Thr Ser Arg Leu Arg
Ser His Ile Asn Pro Thr Gly Thr Thr Val Leu 1 5 10 15 Leu Gln Leu
Glu Asn Thr Met Ser Glu Lys Asp Glu Leu 20 25 29 18 PRT Tobacco
mosaic virus 29 Thr Ser Arg Leu Arg Ser His Ile Asn Pro Thr Gly Thr
Val Leu Leu 1 5 10 15 Gln Leu 30 24 PRT Tobacco mosaic virus 30 Thr
Ser Arg Leu Arg Ser His Ile Asn Pro Thr Gly Thr Val Leu Leu 1 5 10
15 Gln Leu Ser Glu Lys Asp Glu Leu 20 31 5 PRT Tobacco mosaic virus
31 Thr Ser Arg Leu Arg 1 5 32 11 PRT Tobacco mosaic virus 32 Thr
Ser Arg Leu Arg Ser Glu Lys Asp Glu Leu 1 5 10
* * * * *