U.S. patent application number 10/001426 was filed with the patent office on 2002-10-31 for drug-immobilized particles and a process of purifying proteins.
Invention is credited to Handa, Hiroshi, Kawaguchi, Haruma.
Application Number | 20020160472 10/001426 |
Document ID | / |
Family ID | 26355561 |
Filed Date | 2002-10-31 |
United States Patent
Application |
20020160472 |
Kind Code |
A1 |
Handa, Hiroshi ; et
al. |
October 31, 2002 |
Drug-immobilized particles and a process of purifying proteins
Abstract
The invention includes a microsphere comprising styrene-glycidyl
methacrylate polymer, and methods for isolation, purification and
identification of receptors to a specific compound possessing
physiological activity. In addition, the invention provides
proteins isolated and purified using the microspheres of the
invention.
Inventors: |
Handa, Hiroshi; (Tokyo,
JP) ; Kawaguchi, Haruma; (Yokohama-shi, JP) |
Correspondence
Address: |
Dike, Bronstein, Roberts & Cushman
Intellectual Property Practice Group
EDWARDS & ANGELL, LLP
P.O. Box 9169
Boston
MA
02209
US
|
Family ID: |
26355561 |
Appl. No.: |
10/001426 |
Filed: |
November 2, 2001 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
10001426 |
Nov 2, 2001 |
|
|
|
09440597 |
Nov 15, 1999 |
|
|
|
Current U.S.
Class: |
435/180 ;
435/176; 435/181 |
Current CPC
Class: |
Y10S 435/803 20130101;
C07K 14/705 20130101; G01N 33/54353 20130101; Y10S 435/815
20130101; Y10S 530/816 20130101; Y10S 530/815 20130101; G01N
33/54313 20130101; G01N 33/94 20130101 |
Class at
Publication: |
435/180 ;
435/181; 435/176 |
International
Class: |
C12N 011/08; C12N
011/06; C12N 011/14 |
Foreign Application Data
Date |
Code |
Application Number |
Feb 5, 1996 |
JP |
18827/1996 |
Sep 17, 1996 |
JP |
266711/1996 |
Claims
What is claimed is:
1. A microsphere which is prepared by coupling a substance
possessing physiological activity to a styrene-glycidyl
methyacrylate polymer through a spacer, wherein at least one
functional group of any of the substance possessing physiological
activity, the polymer or spacer is converted to another type of
functional group.
2. The microsphere according to claim 1, wherein the functional
group is on the particle.
3. The microsphere according to claim 1, wherein the functional
group is on the spacer.
4. The microsphere according to claim 1, wherein the functional
group is on the substance possessing physiological activity.
5. The microsphere according to the claim 1, wherein the spacer is
an ethylene glycol diglycidyl ether derivative.
6. The microsphere of claim 1, wherein the polymer consists of
units of styrene and glycidyl methacrylate.
7. The microsphere according to claim 1, wherein the functional
group is an epoxide.
8. The microsphere according to claim 1, wherein the functional
group is covalently bound to a nucleophile.
9. The microsphere according to claim 1, wherein the functional
group is converted to a hydroxy group, amino group, thiol group or
carboxyl group.
10. A microsphere comprising a substance possessing physiological
activity, a polymer and a spacer, wherein at least one functional
group of any of the substance possessing physiological activity,
the polymer or spacer is converted to another type of functional
group.
11. A process of preparing a microsphere comprising coupling a
substance possessing physiological activity to a styrene-glycidyl
methyacrylate polymer through a spacer, wherein at least one
functional group of any of the substance possessing physiological
activity, the polymer or spacer, is converted to another type of
functional group.
12. The process according to claim 11, wherein the functional group
is on the particle.
13. The process according to claim 11, wherein the functional group
is on the spacer.
14. The process according to claim 11, wherein the functional group
is on the substance possessing physiological activity.
15. The process according to claim 11, wherein the functional group
is an epoxide.
16. The process according to claim 11, wherein the functional group
is covalently bound to a nucleophile.
17. The process according to claim 11, wherein the functional group
is converted to a hydroxy group, amino group, thiol group or
carboxyl group.
18. A process of isolating a substance that can adhere to a
substance possessing physiological activity from a mixture
containing the substance, comprising contacting the mixture with a
microsphere prepared by coupling the substance possessing
physiological activity to a polymer through a spacer, and isolating
the substance from the mixture, wherein the substance is selected
from the group consisting of DM852, H-9, DQ2511 and KF49389 and
derivatives thereof.
Description
BACKGROUND OF THE INVENTION
[0001] 1. Field of the Invention
[0002] The present invention relates to a microsphere which is
prepared by coupling a substance possessing physiological
activities to a styrene-glycidyl methacrylate polymer through a
spacer as well as a process of isolating an objective or targeted
substance by using the microsphere of the invention.
[0003] 2. Background
[0004] Cells constituting a living body are exposed to various
kinds of stimulation from the external environment all the time. To
respond to such stimulation the cells lead some gene groups to
expression. As a result, various living phenomena can occur, such
as induction of cell growth and/or cell differentiation and
maintenance of physiological homeostasis. Extracellular stimulation
is transformed into an intracellular signal, which activates a
specific proteinous transcription factor. The functionally
activated transcription factor binds to a specific base sequence on
a chromosome to induce a gene group under its regulation to
expression. The product of the induced gene expression primarily
functions to respond to the stimulation in some cases. In the other
cases, the product of the induced gene expression further activates
another transcription factor that induces another gene group under
its regulation to expression to secondarily respond to the
stimulation. In either case, cellular response to the stimulation
from the external environment is concluded to be functional
transformation of transcription factors.
[0005] In recent years, an extremely interesting fact was revealed.
That is, mechanisms of action of cyclosporin A (CysA) and FK506,
immunosuppressive drugs, have been revealed. See J. Lin et al.,
Cell, 66:807-815 (1991); S. J. O'Keefe et al., Nature, 357:692
(1992); and N. A. Clipstone et al., Nature, 357:695 (1992). The
first opportunity for revealing the mechanisms is the
identification of intracellular receptors to these drugs. See R. E.
Handschumacher et al., Science, 226, 554; and J. J. Sekierka et
al., J. Immunol., 143:1580-1583 (1989). On the basis of these
findings, a series of signaling pathway following stimulation by
antigen was revealed in T-cell that is immunocompetent cell.
[0006] Accordingly, investigation and identification of
intracellular receptors to drugs, as well as elucidation of
signaling pathway, are expected to be further developed into
developmental research of new drugs targeting the signaling pathway
and research for novel drug designs.
[0007] Conventional methods of isolation and purification of
intracellular receptors to drugs are fractionation of crude cell
extracts by using various columns, followed by detection of factors
binding to labeled drugs in each fraction. Therefore, two steps of
procedure, the first one was isolation and purification using
columns and the second one was assay for binding activity against
drugs, have been necessarily performed until now.
[0008] Accordingly, for the purpose of purification, identification
and functional analysis of receptors to a specific drug, located
within cells or on cellular membrane, certain drug-immobilized
microspheres have been designed and constituted.
SUMMARY OF THE INVENTION
[0009] According to the conventional methods of purification, it
can take an exceedingly long time to purify drug-binding factors
from crude cell extracts and moreover, a yield of factors is quite
low due to repeated fractionation using various columns. Therefore,
a huge amount of starting material is necessary for the
determination of an amino acid sequence of drug-binding factors. It
also can be most difficult to establish an assay method for binding
activity of receptors against drugs because obtained drug receptors
are usually not identified. Conventional methods of determination
of binding of receptors to drugs are filter binding method and gel
filtration method which utilize the fact that drug receptors
(proteins) bind to filters and that sizes of drugs binding to
receptors become larger than free drugs and receptors. However,
some receptors that do not bind to filters or other receptors
change their conformation after binding to filters and discharge
drugs. Therefore, properties of drug receptors should be
preliminarily investigated in the conventional methods. The present
invention aims at solving the above mentioned problems to provide
drug-immobilized particles and a process of purifying proteins.
[0010] According to the present invention, a microsphere comprising
styrene-glycidyl methacrylate polymer is provided, and isolation,
purification and identification of receptors to a specific compound
possessing physiological activities are easily performed.
[0011] In addition, the present invention is concerned with
microspheres prepared by coupling substances and proteins purified
using the microspheres of the invention.
[0012] The present invention is further concerned with microspheres
comprising a substance possessing physiological activity, a polymer
and a spacer, wherein at least one functional group of any of the
substance possessing physiological activity, the polymer or spacer
is converted to another type of functional group. The present
invention also relates to a process of preparing such
microspheres.
BRIEF DESCRIPTION OF THE DRAWINGS
[0013] FIG. 1 is a schematic for the preparation method of a
styrene-glycidyl methacrylate polymer and a styrene-glycidyl
methacrylate polymer connected with a spacer.
[0014] FIG. 2 is a schematic for the isolation method of a protein
using microspheres of the present invention.
[0015] FIG. 3(A) shows the effects of E3330 on AP endonuclease
activity of Ref-1. FIG. 3(B) shows the effects of NH.sub.2-E3330 on
AP endonuclease activity of Ref- 1.
[0016] FIG. 4 shows the enhancement of the DNA-binding activity of
NF-.sub..kappa.B by recombinant rRef-1 and the repression of the
recombinant rRef-1 activity by E3330.
[0017] FIG. 5 shows the effects of recombinant rRef-1 on the
DNA-binding activities of r-p65 and/or r-p50.
[0018] FIG. 6 shows the procedure and the results of the GST
pull-down assay.
[0019] FIG. 7 is a schematic for the structure of each recombinant
protein of Ref-1 expressed by various deletion mutants.
[0020] FIG. 8 shows the results of binding assays against E3330
using the recombinant proteins of Ref-1 expressed in E. coli by
various deletion mutants.
[0021] FIG. 9 shows the results of binding assays against E3330
using the recombinant proteins of Ref-1 expressed in E. coli by
various deletion mutants.
[0022] FIG. 10 shows the results of identification of E3330-binding
domain using the recombinant proteins of Ref-1 expressed by various
deletion mutants.
[0023] FIG. 11 shows the results of identification of E3330-binding
domain using the recombinant proteins of Ref-1 expressed by various
deletion mutants.
[0024] FIG. 12 shows the summary of E3330-binding domain in Ref-1
identified using the recombinant proteins of Ref-1 expressed by
various deletion mutants.
[0025] FIG. 13 shows reaction schemes for the conversion of epoxy
groups to other chemical groups.
[0026] FIG. 14 shows the isolation and purification of
E3330-binding proteins using E3330-immobilized particles.
[0027] FIG. 15 shows the isolation and purification of
E3330-binding proteins using E3330-immobilized particles.
DETAILED DESCRIPTION OF THE INVENTION
[0028] The present invention provides a microsphere prepared by
coupling a compound possessing physiological activity to a
styrene-glycidyl methacrylate polymer through a spacer. In
addition, the present invention provides a process of isolating a
substance by using a microsphere prepared by coupling a compound
possessing physiological activities to a styrene-glycidyl
methacrylate polymer through a spacer.
[0029] More particularly, the present invention is concerned with a
process of isolating an objective substance that can adhere to a
substance possessing physiological activities from a mixture
containing the objective substance by using a microsphere prepared
by coupling the substance possessing physiological activities to a
styrene-glycidyl methacrylate polymer through a spacer. In more
detail, the process of isolating a substance according to the
present invention includes mixing crude cell extracts and
microspheres prepared by coupling compounds possessing
physiological activity to styrene-glycidyl methacrylate polymers
through spacers, followed by isolation of microspheres, and then,
eluting the objective substance adhering to the substances
possessing physiological activities on the microspheres, to provide
a useful process of isolating an objective or targeted
substance.
[0030] The present invention also provides with proteins isolated
according to the above procedure. In addition, the present
invention provides peptides or proteins comprising active moieties
of isolated proteins as receptors.
[0031] As the substance forming particles of microspheres in the
present invention, styrene-glycidyl methacrylate polymers are
employed. There is no special restriction on their states of
polymerization or morphological properties in the preparation
method in which formed particles should be isolated from a liquid
phase. However, it is preferable that particles are prepared by
soap-free emulsion polymerization according to the method developed
by Inomata et al. such as described in Y. Inomata et al., Anal.
Biochem., 206:109 (1992).
[0032] The spacer in the present invention is a chemical compound
interposed between the above particle and a compound possessing
physiological activity as discussed in more detail herein. A
preferable spacer is a compound possessing one or more functional
groups, such as an amino group, carboxyl group and epoxy group, on
both its ends before binding to a particle and a substance
possessing physiological activity. As for the selection of a spacer
in the present invention, there is no special restriction but the
spacer should be a substance connecting the above styrene-glycidyl
methacrylate polymer with a substance possessing physiological
activities at an appropriate distance. A particularly preferred
spacer is an ethylene glycol diglycidyl ether derivative.
[0033] As for the selection of a substance possessing physiological
activity (which will be occasionally abbreviated as physiologically
active substance, hereinafter) in the present invention, there is
no special restriction but the substance should possess activity in
a living body and interaction and/or affinity to another substance
of intra- or extra-living body. It is further preferable to employ
a compound that specifically binds to a receptor located within
cells or on cellular membrane. In a case where the substance
possessing physiological activity has functional groups connectable
with the above spacer in its molecular structure, such as amino
group and hydroxyl group, the functional group is utilized as a
group connected with a spacer. In the other case where the
substance possessing physiological activity has no functional group
connectable with the above spacer in its molecular structure, a
functional group connectable with the above spacer is additionally
induced into the concerned physiologically active substance and
then, it is connected with a spacer. In either case it is necessary
to pay attention not to inactivate physiological activity of the
concerned physiologically active substance by connecting the
physiologically active substance with a spacer. Namely, it is
important to confirm that an objective or desired physiological
activity is not inactivated by connecting the physiological active
substance with a spacer.
[0034] As the substance possessing physiological activities in the
present invention, for example, a
3-[(5-(2,3-dimethoxy-6-methyl-1,4-benzoquinonyl-
)]-2-nonyl-2-propionic acid (which will be occasionally abbreviated
as E3330, hereinafter or derivative thereof) may be suitably
employed. Other examples of substances possessing physiological
activity useful in the microspheres of the present invention
include DM852, H-9, DQ2511 and KF49389.
[0035] A preparation method of a microsphere consisting of a
compound possessing physiological activities coupled to a
styrene-glycidyl methacrylate polymer through a spacer according to
the present invention is as follows. A particle composed of a
styrene-glycidyl methacrylate polymer (which will be occasionally
abbreviated as a SG-particle, hereinafter) is prepared according to
an ordinary method. However, for the purpose of the SG-particle
easily binding to a spacer, it is especially preferable to prepare
a particle with a functional glycidyl group projecting on its
surface and then, the glycidyl group on the SG-particle is
ring-opened with appropriate reagents, such as ammonium hydroxide,
followed by induction of a preferable functional group for binding
to a spacer, depending on necessity. Subsequently, a spacer is
bound to the SG-particle, followed by reaction with a substance
possessing physiological activities or its derivatives. Thus, a
microsphere of the present invention is prepared.
[0036] In these reactions, various solvents, such as dioxane, DMSO
and water, are suitably employed, depending on necessity.
[0037] In certain embodiments of the present invention, the
functional groups on the components of the microsphere of the
present invention, i.e., particle, spacer or physiologically active
substances, are converted to other types of groups having reactive
carbons. For example, FIG. 13 shows the conversion of epoxide
groups to other chemical groups useful for in the present
invention. For the purposes of illustration, conversion of epoxide
groups will be discussed. Epoxide groups on any of the spacer,
particle or physiologically active substances can be converted to
another type of functional group. For example, an epoxide group can
be covalently bound to a nucleophilic group such as hydroxy, amino
and thiol group (reaction 1 in FIG. 13). In another embodiment, the
epoxide group is treated with hydrochloric acid to introduce alkyl
chloride to the surface of the particle or the end of the spacer.
The chloride group can be substituted for a relatively strong
nucleophile, such as thiol group (FIG. 13, reaction 2). This
reaction is useful for selective incorporation of substances
containing free thiol group. The chloride group can be replaced by
a good leaving group, such as a p-toluenesulfonyl group, which
enables the reaction with weak nucleophilic groups.
[0038] In another example, the epoxide group is treated with
ammonium, which enables the introduction of an amino group on the
particle or on the spacer. This amino group covalently binds to
aldehyde groups via Schiff base formation, and following reduction
of the reaction site results in formation of a stable bond.
(Reaction 3, FIG. 13). In yet another example, the amino group
covalently binds to a carboxyl group by using a general coupling
reagent for amide bond formation (reaction 4, FIG. 13). In yet
another example, a carboxyl group is introduced by reacting
succinic anhydride with the amino group. The generated carboxyl
group reacts with a hydroxy group or amino group by using a
coupling reagent, such as N-hydroxysuccinimide, to form a stable
ester bond or amide bond respectively (reaction 5).
[0039] These methods are useful in converting at least one
functional group on the particle, spacer, or physiologically active
substances into other types of activated groups. These resulting
groups can then react with other components to form the
microspheres of the present invention. For example, the epoxide
group on glycidylmethacrylate, one of components of the preferred
particles, is converted into other types of activated groups.
Similarly, ethylenediglycidylether, one preferred spacer has an
epoxide group at both ends. Either one, or both of these epoxides
can be converted into other activated groups. These converted
groups are used to covalently bind to chemical groups, e.g.,
hydroxy, amino, thiol, aldehyde and/or carboxyl group contained in
physiologically activated substances.
[0040] FIG. 1 shows an example for the preparation of a microsphere
of the present invention. Appropriate compounds, such as styrene
and glycidyl methacrylate, are polymerized according to an ordinary
method, such as emulsion polymerization, to prepare a SG-particle
with a functional glycidyl group projecting on its surface. Sizes
of particles are selectively varied according to circumstances.
However, the sizes (lengths) are ordinarily about 0.05 to 0.5 .mu.m
and preferably they are about 0.1 to 0.3 .mu.m. The prepared
SG-particle is reacted with a compound employed as a spacer, such
as ethylene glycol diglycidyl ether (EDGE), to bind a spacer to the
SG-particle. Thus, a spacer-binding SG-particle (SG-EGDE particle)
is obtained. Then, the obtained particle is reacted with a
physiological active substance possessing a reactive functional
group, such as amino group, preferably in an organic solvent, such
as dioxane. Thereby, a microsphere of the present invention, that
is a physiologically active substance-immobilized latex particle,
is prepared.
[0041] As for the selection of a mixture containing an objective
substance for isolation according to the present invention, there
is no special restriction but the mixture should contain a
substance possessing an affinity and selective binding ability to a
physiologically active substance employed in the preparation of a
microsphere. It is ordinarily preferable that cell extracts,
especially the cell extracts from the concerned physiological
active substance-acting sites are employed as a mixture.
[0042] The isolation procedure in the present invention is
conducted as follows. Physiologically active substance-binding
microspheres and a mixture containing proteins, such as cell
extracts, are mixed and stirred, if necessary, for several minutes
to several hours. The microspheres to which proteins are adhering
are separated and rinsed with a buffer solution, if necessary.
Then, adhering proteins are eluted from the microspheres by using
an appropriate solution, such as a potassium chloride solution, to
be dissociated. Thus, the isolation procedure is conducted. There
is no special restriction on the states of adhering conditions of
an objective substance for isolation to a physiological active
substance employed in the preparation of a microsphere. Any kinds
of adhering, such as chemical bond (hydrogen bond, etc.) and
chemical or physical adsorption, may be suitably employed.
[0043] FIG. 2 shows an example for the isolation of a protein in
the present invention. In this example, E3330 is employed as a
physiologically active substance.
[0044] An obtained protein is detected by using SDS-PAGE or other
suitable method. In addition, an obtained protein is purified
according to an ordinary method, such as chromatography, if
necessary.
[0045] Proteins isolated according to a process of the present
invention are considered to be receptors to the physiologically
active substance of microspheres. However, proteins isolated
according to a process in the present invention are not limited to
the receptors to the physiological active substance employed in the
preparation of microspheres. Any kinds of substances possessing
chemical, physical or biological affinities to the physiological
active substance employed in the preparation of microspheres are
able to be isolated according to a process in the present
invention.
[0046] An obtained protein is purified, if necessary, and can be
subjected to determination of its amino acid sequence. In addition,
genes coding the concerned protein can be cloned according to an
ordinary biotechnological procedure, and their base sequences can
be determined. Furthermore, according to an ordinary genetechnology
procedure, proteins or peptides composed of partial amino acid
sequences of the concerned protein are expressed and an active
moiety of the receptor protein can be determined. These procedures
are also described in the working examples which follow, giving
examples in which E3330 is employed as a physiologically active
substance.
[0047] Structures of obtained receptors or domains composed of
active moieties of the receptors can be elucidated through NMR
analysis, x-ray crystal analysis or simulation analysis using
computers on the basis of their amino acid sequences. For example,
the protein, Ref-1, which is isolated according to a process of the
present invention in which E3330 is employed as a physiologically
active substance in the preparation of microspheres, is suggested
to possess such structures as
.beta.-sheet/.alpha.-helix/.beta.-sheet in the domain of 82 a.a. to
106 a.a. through the above structural analyses. The amino sequence
of Ref-1 (SEQ ID NO:4) is set forth in Example 9 which follows.
Regions of 72 to 88 amino acid residues (SEQ ID NO:13) of Ref-1 are
of particular interest and set forth in Example 14 which
follows.
[0048] Further, peptides of the invention which have a sequence
that is partially deleted, added or substituted with respect to SEQ
ID NO:4 (which sequence is set forth in Example 9 which follows),
and such peptides preferably comprise at least about 10 amino
acids, more preferably at least about 15 to 50 amino acids, still
more preferably at least about 40 to about 100 amino acids. Such
peptides preferably have at least about 70 percent homology
(sequence identity) to SEQ ID NO:4, more preferably at least about
80 or 90 percent sequence homology to SEQ ID NO:4. Also, such
preferred peptides preferably will contain a region that has
substantial sequence identity (e.g. about 80, 90 or 95 percent or
more sequence identity) to SEQ ID NO:13 (which sequence is set
forth in Example 14 which follows).
[0049] On the basis of the results of such stereochemical
structural analyses and genetic analyses, one can readily determine
which amino acid residue binds to a physiologically active
substance employed in the preparation of microspheres among amino
acids of the proteins or active moieties isolated according to a
process of the present invention. In addition, one can investigate
the interaction between the concerned physiologically active
substance employed in the preparation of microspheres and amino
acids of the isolated protein at molecular and/or atomic levels.
Furthermore, it will be practicable to analyze chemical kinetics of
the binding reactions. Many findings obtained from the above
studies will not only identify the protein that is the receptor to
the physiologically active substance employed in the preparation of
microspheres but also reveal the mechanism of action of the
concerned physiologically active substance in a living body.
Moreover, it will be practicable to conduct a novel drug design by
accurately controlling a new drug at an atomic level, of which
binding mechanism is different from that of the physiological
active substance employed in the preparation of microspheres
concerning the interaction with the protein of the receptor.
Various drugs designed according to the above method reasonably
possess different functions from those of the physiological active
substance employed in the preparation of microspheres. Therefore,
the drugs will be utilized more properly for various purposes.
Thus, a process in the present invention is extremely important for
a novel procedure of the drug designs.
[0050] In addition, the present invention provides a process for
isolation and detection of substances possessing affinities to a
receptor by employing a protein with an ability of the concerned
receptor as a substance possessing physiological activity coupled
with microspheres. As a substance with an ability of a receptor, a
whole protein of the receptor may be employed, but it is preferable
to employ a domain that is obtained by trimming the receptor
protein to an active domain of several tens (e.g. about 20 to 60)
of amino acid residues as an active moiety of the concerned
receptor.
[0051] Therefore, screening examinations on drugs specifically
binding to the concerned receptor or its active domain will be
practicably performed, according to the above methods. Thus,
chemical synthetic substances expected to be useful drugs are
easily isolated and detected among various drug libraries by
conducting the screening examinations. The substance isolated and
detected through the above screening examinations should possess
affinities to the protein with an ability of a receptor coupled
with microspheres. Therefore, the substance will be developed to be
an effective ingredient of a medicine for promotion or inhibition
of the activity of the concerned receptor.
[0052] According to the present invention, a microsphere composed
of styrene-glycidyl methacrylate polymer is provided, and
purification and identification of receptors to a specific compound
possessing physiological activities, located within cells or on
cellular membrane, are easily performed. Particles coupled with a
substance possessing physiological activities specified in the
present invention provide epoch-making and significant effects,
that is, isolation and purification of a receptor to a drug are
able to be conducted simultaneously with the evaluation on its
binding activity to the drug, time required for isolation and
purification of drugs is remarkably shortened and a recovery ratio
is extremely improved, and investigation on the assay method for
binding activity against a drug is not necessarily performed
anymore. In addition, the present invention provides that an
intracellular receptor to a drug or a compound can be isolated and
purified by using the drug- or the compound-immobilized particles
and then a structure and functions of the receptor can be
determined. Furthermore, the present invention is indicated to be
extremely useful for the development of novel drugs with superior
functions on the basis of many findings obtained from the
structural and functional analyses on receptors to drugs according
to a process in the present invention.
[0053] All documents mentioned herein are incorporated herein by
reference. The present invention is further illustrated by the
following Examples. These Examples are provided to aid in the
understanding of the invention and are not to be construed as
limitations thereof.
EXAMPLE 1
Preparation of Styrene-glycidyl Methacrylate Polymers
[0054] Styrene (St; Wako Pure Chemicals. It was used after
distillation under reduced pressure of 21.5 mmHg at 46.degree. C.),
glycidyl methacrylate (GMA; Wako 15 Pure Chemicals. It was used
after distillation under reduced pressure of 2 mmHg at 33.degree.
C.), divinyl-benzene (DVB; Tokyo Kasei), 2,2'-azobis
(2-amidinopropane dihydrochloride) (V-50; Wako Pure Chemicals) and
water were used in the following compositional formula:
St/GMA/DVB/V-50/H.sub.2O=1.2/1.8+0.3/0.04/0.06/110 (g)
[0055] After substituting a nitrogen gas in the mixture, reaction
of polymerization was conducted at 70.degree. C. for 24 hours. To
polymerize the mixture soap-free emulsion polymerization was
conducted according to the method developed by Inomata et al. (Y.
Inomata et al., Anal. Biochem., 206:109 (1992)).
[0056] Two hours after the initiation of polymerization, 0.3 g of
GMA was added to the mixture to thoroughly cover the whole surface
of the obtained polymers with GMA. The obtained polymers
(SG-particles) were settled by centrifugation (15,000 rpm for 15
minutes at 4.degree. C.), followed by decantation, and then
re-suspended in 200 ml of water. The above procedure was repeated
three times to wash the SG particles and finally suspended in
water.
[0057] In order to induce amino groups into the washed SG-particles
(0.25 g), NH.sub.4OH (55.3 mmol; corresponding to fifty times
larger amount of GMA unit) was added to the particles, followed by
adjustment of the pH value to 11 with 1N HCl. The mixture was
stirred using a stirrer at 70.degree. C. for 24 hours so that the
epoxy group of GMA was ring-opened.
EXAMPLE 2
Immobilization of a Spacer
[0058] Next, an example for immobilization of ethylene glycol
diglycidyl ether (EGDE; Wako Pure Chemicals), which was employed as
a spacer, onto SG-particles obtained in the working example 1 is
shown in the following.
[0059] An excess amount of EGDE, that was hundred times larger
amount (mol) of amino groups on the surface of about 62.5 mg of
SG-particles prepared in Example 1 above, was added to the
SG-particles and then, the mixture was stirred at 30.degree. C. for
24 hours at pH 11 (adjusted with 1N NaOH) so that an epoxy group of
EGDE was covalently bound to an amino group on the surface of
SG-particle. In order to avoid simultaneous immobilization of two
epoxy groups at the both ends of an EGDE molecule onto
SG-particles, such an excess amount of EGDE was added. Under these
reaction conditions about 1 mmol of EGDE was immobilized onto 1 g
of the particles. After the reaction was finished, the SG-particles
were washed three times with water through a centrifugation
procedure. Thus the obtained spacer-immobilized particles, that are
SG-EGDE particles, were used for the particles to which a
physiologically active compound is immobilized.
EXAMPLE 3
Immobilization of an Amino Derivative of E3330 With a Spacer
[0060] (a) (Induction of an amino group into E3330)
[0061] As E3330 does not possess an appropriate functional group,
it is difficult to immobilize E3330 onto SG-EGDE particles.
Therefore, NH.sub.2-E3330 was synthesized through the induction of
an amino group into E3330.
[0062] (b) (Confirmation of the functions of NH.sub.2-E3330)
[0063] The functions of NH.sub.2-E3330 were compared with those of
E3330 with respect to transcriptional activation abilities of
NF-.sub..kappa.B. In order to examine their functions transfection
experiments were conducted by inducing the recombinant plasmid DNA
possessing luciferase genes regulated by NF-.sub..kappa.B into
Jurkat cells. As a result, it was ascertained that NH.sub.2-E3330
reduced not so strongly as E3330 but certainly reduced the
transcriptional activation abilities of NF-.sub..kappa.B. Thus, it
was confirmed that the amino group induced into E3330 did not
inhibit the binding of E3330 to intracellular receptors.
[0064] (c) (Immobilization of NH.sub.2-E3330 to SG-EGDE
particles)
[0065] Ten mg of SG-EGDE particles obtained in the working Example
2 above was washed three times with 1 ml of 1,4-dioxane through a
centrifugation procedure. After washing, 500 .mu.l of 1,4-dioxane
solution containing 10 .mu.mol of NH.sub.2-E3330 was added to the
packed SG-EGDE particles to disperse the SG-EGDE particles in the
above solution, followed by reaction at 37.degree. C. for 24 hours,
in order to immobilize NH.sub.2-E3330 to epoxy groups of EGDE on
the surfaces of SG-EGDE particles. After the reaction was finished,
the particles were washed three times with 20 .mu.l of 1,4-dioxane
through a centrifugation procedure. Then, the particles were
dispersed in 1 ml of 1M Tris-HCl buffer solution (pH 7.4), allowed
to be standing still at 4.degree. C. for at least 24 hours and
used, in order to thoroughly mask the intact epoxy groups on the
surfaces of SG-EGDE particles. The drug-immobilized particles were
stored at 4.degree. C. in a dark place. The centrifugation
procedure for washing was conducted at 15,000.times.g for 5 minutes
at room temperature. Under these reaction conditions about 0.15
mmol of NH.sub.2-E3330 was immobilized onto 1 g of the SG-EGDE
particles. The above immobilized amount of NH.sub.2-E3330 was
obtained by subtracting the amount of NH.sub.2-E3330 not bound to
the SG-EGDE particles from the starting amount of NH.sub.2-E3330.
NH.sub.2-E3330 shows the maximum absorption at the wavelength of
254.5 nm, so that each amount of NH.sub.2-E3330 can be determined
by measuring an absorbance at the wavelength of 254.5 nm on each
sample, such as the starting solution, not-binding fraction and
washing fractions. The measurement on the absorbance was conducted
with DU-64 Spectrophotometer (BECKMAN).
EXAMPLE 4
Preparation of a Crude Nuclear Extract and a Cytoplasmic
Fraction
[0066] The culture medium suspension of Jurkat cells
(2.times.10.sup.10 cells), which were cultured in a suspension
scale of 8 liters, was centrifuged using 500-ml-centrifugation
tubes (NARGEN) at 500.times.g for 10 minutes at 4.degree. C. for
the purpose of collecting the cells. The collected cells were
washed two times with PBS(-). The washing procedure was conducted
using 50-ml-centrifugation tubes and the centrifugation conditions
were at 700.times.g for 5 minutes at 4.degree. C. Then, the final
packed cell volume (PCV) was measured. Buffer A (10 mM Hepes pH
7.9, 1.5 mM MgCl.sub.2, 10 mM KCl, 0.5 mM DTT), four times larger
volume of the PCV, was added to the packed cells to suspend the
cells. The cell suspension was allowed to stand still on ice for 20
minutes so that the cells were swollen. The cell membranes of the
swollen cells were broken by 20 strokes using a 40-ml-B-type Dounce
homogenizer (WHEATON), transferred to a 50-ml-centrifugation tube
(NARGEN) and centrifuged at 4,200.times.g for 6 minutes at
4.degree. C. for the purpose of separating a nuclear fraction
(pellet) from a cytoplasmic fraction (supernatant).
[0067] Buffer A, five times larger volume of the PCV, was added to
the isolated nuclear fraction to re-suspend the nuclei. The nuclear
suspension was centrifuged at 4,200.times.g for 6 minutes at
4.degree. C. for the purpose of removing the contaminated
cytoplasmic fraction. The obtained nuclear pellet was dispersed in
Buffer C (20 mM Hepes pH 7.9, 25% (v/v) glycerol, 0.42 M NaCl, 1.5
mM MgCl.sub.2, 0.2 mM EDTA, 0.5 mM PMSF, 1 mM DTT), the same volume
as the PCV, and thoroughly suspended by 10 strokes using a B-type
Dounce homogenizer. The suspension was slowly stirred for 30
minutes at 4.degree. C. for the purpose of extracting nuclear
components. The extract was transferred to a 50-ml-centrifugation
tube and centrifuged at 16,000.times.g for 30 minutes at 4.degree.
C. The obtained supernatant was dialyzed two times against one
liter of Buffer D (20 M Hepes pH 7.9, 20% (v/v) glycerol, 0.1 M
KCl, 0.2 mM EDTA, 0.5 mM PMSF, 1 mM DTT) for 2.5 hours at 4.degree.
C.
[0068] On the other hand, the cytoplasmic fraction was transferred
to another 50-ml-centrifugation tube and centrifuged again at
4,200.times.g for 6 minutes at 4.degree. C. The obtained
supernatant was transferred to an ultra-centrifugation tube
(BECKMAN: No. 355620) and ultracentrifuged at 35 Krpm for one hour
at 4.degree. C. (BECKMAN: Rotor Type 35). The obtained supernatant
was dialyzed in the same manner as the above procedure for the
nuclear extract.
[0069] After the completion of the dialyses, the nuclear extract
and the cytoplasmic fraction were centrifuged at 14,000.times.g for
30 minutes at 4.degree. C. The obtained supernatants were used as
the samples of a nuclear extract and a cytoplasmic fraction,
respectively. These samples were subdivided into appropriate
aliquots and stored at -80.degree. C. until the use of them.
[0070] In usual preparation, about 20 ml each of the nuclear
extract and the cytoplasmic fraction at the protein concentration
of 5 mg/ml and 10 mg/ml, respectively, were obtained in the scale
of this working example.
EXAMPLE 5
Fractionation of a Nuclear Fraction and Cytoplasmic Fraction Using
Phosphocellulose
[0071] Cationic-ion exchange phosphocellulose (P11: Whatman) was
employed for the fractionation of a cell extract. Procedures for
the fractionation were always conducted at 4.degree. C. Distilled
water was added to 10 g of dried phosphocellulose to be 500 ml of a
phosphocellulose suspension. The suspension was well stirred and
allowed to stand still for 30 minutes. To remove phosphocellulose
with smaller particle sizes the supernatant of the suspension was
removed and distilled water of the same volume as the removed
supernatant was added to the remaining phosphocellulose.
[0072] These procedures were repeated several times in order to
obtain the Phosphocellulose with a uniform particle size. Next, in
order to activate the Phosphocellulose, each one gram of the
phosphocellulose with a uniform particle size on the basis of the
dried weight was suspended in 50 ml of 0.5 N HCl solution and the
suspension was allowed to stand for 5 minutes. The phosphocellulose
was collected on two sheets of filter paper (Whatman: 3MM Chr)
placed in Buchner funnel and washed with an excess amount of
distilled water until the pH value recovered to a neutral range.
The pH value of the filtrate was measured using BTB pH test paper
to confirm the pH value. The phosphocellulose on the filter paper
was transferred into a beaker and resuspended in 0.5 N NaOH
solution. The suspension was allowed to stand for 5 minutes. The
phosphocellulose was washed in the same manner as described above.
Finally, the phosphocellulose was suspended in 0.5 N HCl solution
once more and washed again. As a result, activated phosphocellulose
was obtained.
[0073] The activated phosphocellulose was filled into a column
(BIORAD: 731-1550), so that the column volume became 10 ml. The
filled column was washed with 100 ml of Buffer D (20 mM HEPES (pH
7.9), 20% (v/v) glycerol, 1 M KCl, 1.2 mM EDTA, 0.5 mM PMSF, 1 mM
DTT) containing 1 N KCl and then equilibrated with 100 ml of Buffer
D containing 0.1 M KCl. Each 5 ml of a nuclear extract and a
cytoplasmic fraction from Jarkat cells was applied on the column.
The applied column was eluted stepwise with Buffer D at various
salt concentrations of KCl, that is, the elution was conducted
stepwise with Buffer D containing 0.1 M KCl, 0.32 M KCl, 0.35 M KCl
or 1 M KCl. Each eluted fraction was dialyzed against Buffer D,
subdivided into appropriate aliquots and stored at -80.degree. C.
until the use of them.
[0074] The flow rate was adjusted to be 8 ml/minute. To confirm the
completion of each step of protein-elution with each salt
concentration buffer, absorbance at the wave-length of 280 nm was
measured with UV detector (GILSON: MODEL 111B) during the
fractionation.
[0075] First, 5 ml of a cytoplasmic fraction (protein
concentration: 12 mg/ml) as applied on the above column. As a
result, 30 ml of 0.1 M fraction (P.1; protein concentration: 1.12
mg/ml), 39 ml of 0.3 M fraction (P.3; protein concentration: 0.23
mg/ml), 37 ml of 0.5 M fraction (P.5; protein concentration: 0.07
mg/ml), and 53 ml of 1.0 M fraction (P1.0; protein concentration:
0.02 mg/ml) were obtained.
[0076] Next, a nuclear extract fraction was also fractionated using
the phosphocellulose column in the same manner.
EXAMPLE 6
Isolation of Proteins Using Microspheres
[0077] A process of isolation and purification of E3330-binding
proteins using E3330-immobilized particles is illustrated in the
FIG. 2 and described as follows.
[0078] (a) Microspheres and a fraction obtained through the
fractionation using a phosphocellulose column in working Example 5
above were mixed and centrifuged to separate substances binding to
E3330 which was immobilized on particles from the mixture. The
centrifugation procedure for separation was conducted at
15,000.times.g for 5 minutes at 4.degree. C. All procedures in the
above were conducted at 4.degree. C.
[0079] (b) First, 1 mg each of E3330-not-immobilized SG-EGDE
particles and E3330-immobilized SG-EGDE particles were washed three
times with 400 .mu.l of Buffer D' (20 mM HEPES (pH 7.9), 10% (v/v)
glycerol, 0.1 M KCl, 0.2 mM EDTA, 1 mM DTT) in which glycerol
concentration was 10% instead of 20% in Buffer D. The
E3330-not-immobilized SG-EGDE particles were dispersed in 1 ml of 1
M Tris-HCl buffer solution (pH 7.4) and allowed to stand still at
4.degree. C. for at least 24 hours in order to mask epoxy groups of
EGDE. These particles were used as a reference control against
E3330-immobilized SG-EGDE particles. To these washed
E3330-not-immobilized SG-EGDE particles and E3330-immobilized
SG-EGDE particles, 200 .mu.l each of P.1, P.3, P.5 or P1.0, which
were obtained through the fractionation of a cytoplasmic fraction
using a phosphocellulose column, was added and mixed. These
mixtures were allowed to stand still for 30 minutes with
intermittently stirring at intervals of 10 minutes in order to bind
proteins possessing E3330-binding abilities to E3330 which was
immobilized on the particles. The mixture was centrifuged and the
supernatant was discarded. The pellet was washed three times with
500 .mu.l of Buffer D' to remove non-specific binding substances as
much as possible.
[0080] Subsequently, the washed pellet was eluted three times with
Buffer D' containing 50 .mu.l of 1 M KCl, so that the proteins
possessing E3330-binding abilities were dissociated and eluted from
E3330 immobilized on the particles. The wash solution and eluate
solution were stored at -80.degree. C.
[0081] (c) The detection of the proteins possessing E3330-binding
abilities was conducted by electrophoresis on a 10%
SDS-polyacrylamide gel (SDS-PAGE) using 25 .mu.l each of the first,
second or third eluate solution obtained from the E3330-immobilized
SG-EGDE particles and E3330-not-immobilized SG-EGDE particles used
as a reference control. The proteins possessing E3330-binding
abilities were collected with more than 70% yield in the first
elution and further collected with more than 90% yield in the first
and second elutions. In this experiment, 4.times.SDS sample dye
(200 mM Tris-HCl (pH 6.8), 500 mM .beta.-mercaptoethanol
(.beta.-ME), 8% SDS, 0.4% BPB) was used instead of 4.times.SDS
sample dye in order to prevent the electrophoresis from being
disordered due to such high concentration of the salts. The
electrophoresed gel was subjected to silver staining and the
proteins specifically binding to E3330 were identified in
comparison with the results of the reference control. As a result,
in the P.5 fraction a protein band with a molecular weight of about
38 kDa which was not observed in the reference control was clearly
observed, suggesting that the protein was specifically binding to
E3330. Concerning the other fractions, there were no significant
differences in the protein bands of the eluate solution with 1 M
KCl, compared with the results of the reference control.
[0082] The above procedure was repeated and finally 5 .mu.g of
E3330-binding protein was obtained.
EXAMPLE 7
Evaluation of Specific-binding Abilities Against E3330
[0083] Two kinds of experiments were conducted to confirm that the
protein with a molecular weight of about 38 kDa in the P.5
fractions from cytoplasmic fractions and nuclear extracts of Jurkat
cells was specifically bound to E3330.
[0084] The first one was a competitive binding-inhibitory
experiment. When in the step of a procedure for the addition of P.5
fraction of the cytoplasmic fraction fractionated using the
phosphocellulose (200 .mu.l) to SG-EGDE particles free E3330 at the
same moles of the NH.sub.2-E3330 immobilized on the particles or
free NH.sub.2-E3330 at ten times more moles than the immobilized
NH.sub.2-E3330 were added simultaneously, the protein possessing
specifically binding abilities to E3330 immobilized on the
particles would be bound to free E3330 or free NH.sub.2-E3330,
resulting in a lower yield in the isolation using the particles. As
E3330 was insoluble in water, E3330 was dissolved in EtOH, diluted
with Buffer D and then added to the particles (the final
concentration of EtOH was 2%). As a result, it was confirmed that
the yield of the protein with a molecular weight of about 38 kDa
was lowered, indicating that the protein was specifically bound to
E3330.
EXAMPLE 8
[0085] Next, the other experiment was conducted by varying the
amount of NH.sub.2-E3330 immobilized on the SG-EGDE particles. In
the present study the maximum amount of the immobilized E3330
derivatives is 0.4 .mu.mol per 1 mg of SG-EGDE particles. Under
these conditions, about 5 to 6 molecules of E3330 derivatives are
immobilized on the 1 mm.sup.2 of the surface of the particles. This
experimental study was conducted in case where the amount of the
immobilized E3330 derivatives was 0.2 .mu.mol or 0.4 .mu.mol per 1
mg of SG-EGDE particles. However, in the present invention, amounts
of compounds immobilized on the particles are varied depending on
the properties of the immobilized compounds, conditions of
immobilization and so on. The amounts are not defined and are
generally varied between a few molecules and hundred molecules. As
a result, it was confirmed that the yield of the protein with a
molecular weight of about 38 kDa increased as the immobilized
amount increased. The identification of the specific protein was
conducted by electrophoresis using SDS-PAGE.
EXAMPLE 9
Determination of Amino Acid Sequence of E3330-binding Protein
[0086] The obtained E3330-binding protein was dialyzed two times
against one liter of Buffer D for 2.5 hours at 4.degree. C. in
order to remove the contaminated KCl that was used as an eluent
solution of such as high concentration of 1.0 M of KCl. In order to
concentrate the sample, after the dialysis was completed, the
dialyzed sample was transferred into an ultra-centrifugation tube
(BECKMAN: No. 331372) to which trichloroacetic acid (TCA: MERCK)
and deoxycholic acid (DOC: Sigma) were added so that the final
concentrations would be 10% and 0.8 mg/ml, respectively. The
mixture was stirred well and allowed to stand still for 30 minutes
on ice. Then, the mixed sample was ultra-centrifuged at 28 krpm,
for 15 minutes at 4.degree. C. (BECKMAN: Rotor SW 41 Ti). The
obtained precipitation was dissolved in 10 ml of acetone. After
standing still for 10 minutes at room temperature, the solution was
ultra-centrifuged again. The obtained precipitation was allowed to
stand still for 10 minutes on ice to be dried. Thus, the sample was
concentrated.
[0087] Finally, the concentrated sample was dissolved in 50 .mu.l
of 1.times.SDS sample dye and transferred into a sample tube
(Eppendorf: No. 0030 102.002). In this procedure, the remaining
sample in the ultracentrifugation tube was rinsed with additional
10 .mu.l of 1.times.SDS sample dye and pooled in order to collect
the remaining sample.
[0088] As TCA and DOC were remaining in the sample, 3 .mu.l of 1 M
Tris-HCl (pH 7.9) was added for the purpose of neutralization.
Then, the sample was stored at -80.degree. C.
[0089] To analyze the amino acid sequence of E3330-binding protein,
the protein was subjected to peptide-fragmentation. First, the
sample was electrophoresed with pre-stained SDS-PAGE standard
(BIO-RAD) on a 10% SDS-polyacrylamide gel and the protein was
transferred into PVDF membrane (MILLIPORE: immobilon transfer
membrane) from the polyacrylamide gel using Mini trans blott module
kit (BIO-RAD). Prior to the blotting, the PVDF membrane was soaked
in methanol for 15 seconds and subsequently it was soaked in a
blotting buffer solution (10 mM CAPS-NaOH (pH 11), 10% methanol)
for more than 5 minutes. The blotting apparatus was placed on the
anode side down and two sheets of fiber pad, two sheets of 3 MM
paper, PVDF membrane, the gel, two sheets of 3 MM paper and two
sheets of fiber pad were laid in the blotting apparatus in that
order, avoiding bubbles. The apparatus was placed in an
electrophoretic bath filled with a blotting buffer solution. The
bath was being chilled with ice and 0.3 A of electric current was
turned on for 30 minutes to blot the protein into PVDF
membrane.
[0090] In case where the proteins blotted on the membrane were
enzymatically digested, Lysil Endopeptidase (Wako Pure Chemicals)
was employed as the digestive enzyme. As a buffer solution for the
digestive reaction 20 mM Tris-HCl (pH 8.8) with 8% acetonitrile was
used. The amount of the enzyme was one tenth of the protein for the
digestion (g/g). First, a half amount of the enzyme was added,
followed by stirring with shaking for several seconds. Then, the
other half of the enzyme was added to the above, followed by
stirring with shaking at 37.degree. C. for about 24 hours under
prevention of light-transmittance. After the completion of the
reaction, the digested fluid was carefully collected, paying
attention to the PVDF membrane not to be sucked up. The remaining
PVDF membrane was washed with 100 .mu.l of 8% acetonitrile. The
washing fluid was collected in the same manner as the above and
pooled. These fluids were centrifuged at 15,000.times.g for 2
minutes at room temperature in order to completely separate the
contaminated PVDF membrane pieces and remove them. In case where
the supernatant is directly applied on high performance liquid
chromatography (HPLC), highly hydrophilic peptides are eluted in a
passing through fraction. Therefore, the supernatant was
concentrated by decompression so that the concentration of
acetonitrile was reduced. To the concentrated supernatant 0.1%
trifluoroacetic acid (TFA) was added so that the volume became 205
.mu.l, which was applied on reversed phase HPLC (ABI: model 130A).
C8 column (PERKIN ELMER: 0711-0056) was employed. Flow rate was 50
.mu.l/min and column temperature was 35.degree. C. for development.
Elution was conducted as follows; mobile phase was 0.1% TFA and
concentration gradient of acetonitrile in the mobile phase was 0%
for the first 5 minutes, 0 to 35% for the next 30 minutes and 35 to
70% for the last 20 minutes. Monitoring protein was conducted using
ultraviolet absorption at the wave-length of 215 nm. Each eluted
peptide fraction was collected at each time and stored at
-80.degree. C.
[0091] Gas phase protein sequencer (ABI: model 477A protein
sequencer) was used for amino acid sequence analysis on the
peptides. Polybrene (ABI) was used as the carrier. As a result,
three amino acid sequences of peptides were determined. The
obtained sequences were GLDWVK (SEQ ID NO:1)/AAGEGPALYEDPPD (SEQ ID
NO:2)/GAVAEDGDEL (SEQ ID NO:3). These amino acid sequences were
analyzed using a computer and determined to be completely identical
with the amino acid sequences of N-terminal flanking region of
redox protein, Ref-1 which participates in oxidation-reduction
reaction. The Ref-1 has been reported to possess 318 amino acid
residues with a molecular weight of 38 kDa. The protein obtained
through the isolation and purification in this working example
possesses the same molecular weight. Therefore, E3330-binding
protein is probably identical with Ref-1. Amino acid sequence of
Ref-1 is as follows (SEQ ID NO:4 length of sequence 318 amino
acids):
1 MPKRGKKGAVAEDGDELRTEPEAKKSKTAA 1 10 20 30
KKNDKEAAGEGPALYEDPPDQKTSPSGKPA 31 40 50 60
TLKICSWNVDGLRAWIKKKGLDWVKEEAPD 61 70 80 90
ILCLQETKCSENKLPAELQELPGLSHQYWS 91 100 110 120
APSDKEGYSGVGLLSRQCPLKVSYGIGDEE 121 130 140 150
HDQEGRVIVAEFDSFVLVTAYVPNAGRGLV 151 160 170 180
RLEYRQRWDEAFRKFLKGLASRKPLVLC- GD 181 190 200 210
LNVAHEEIDLRNPKGNKKNAGFTPQERQGF 211 220 230 240
GELLQAVPLADSFRHLYPNTPYAYTFWTYM 241 250 280 270
MNARSKNVGWRLDYFLLSHSLLPALCDSKI 271 280 290 300 RSKALGSDHCPITLYLAL
301 310 318
EXAMPLE 10
Production of E3330-binding Protein by Gene Recombination
[0092] (a) The procedures for preparation of cDNA clones of
E3330-binding protein and analysis on the binding activity of the
protein produced through gene expression of recombinant cDNA clones
in Escherichia coli (E. coli) against E3330 were conducted as
follows.
[0093] On the basis of the determined amino acid sequences
E3330-binding factor is considered most probably to be Ref-1.
Therefore, cDNA clones of Ref-1 were prepared and the recombinant
cDNA clones were expressed in E. coli to obtain recombinant
proteins. Then, the binding activity of the protein against E3330
was investigated.
[0094] (b) First, RNA was prepared. When RNA was prepared,
ultra-centrifugation tubes (BECKMAN: 331372), bucket (BECKMAN: for
SW 41Ti) and bucket cap (BECKMAN: for SW 41Ti) were preliminarily
soaked in 2% absolve solution (DUPONT; 20 ml of absolve was diluted
with distilled water to be 1000 ml) on the day before the
preparation to remove contaminated RNase activities as much as
possible. They were thoroughly rinsed with distilled water just
before the use. Cultivation medium of Jurkat cells cultured up to
4.2 liter (7.6.times.10.sup.9 cells) was transferred to
500-ml-centrifugation tubes and centrifuged at 500.times.g for 5
minutes at 4.degree. C. to collect the cells. The collected cells
were washed two times with PBS(-). The centrifugation conditions
for washing were 700.times.g for 5 minutes at 4.degree. C. using
50-ml-centrifugation tubes. At that time packed cell volume (PCV)
was simultaneously measured.
[0095] These cells were thoroughly suspended in 10-fold PCV of
guanidium solution (4 M guanidium thiocyanate, 0.1 M Tris-HCl pH
7.5, 1% (v/v) .beta.-ME). The suspension was passed through an
injection needle of 18G (1.2 mm) (TERUMO: NN-1838R) twenty times
and further through an injection needle of 25G (0.5 mm) (TERUMO:
SS-20ES) to cut DNA strands into fragments. To the resultant
suspension 10% N-lauroylsarcosine was added and thoroughly stirred,
so that the final concentration of lauroylsarcosine became 0.5%.
Then, 3 ml of each aliquot of the mixture was carefully placed over
the phase of 9 ml of CsCl/EDTA solution (5.7 M CsCl, 0.01 M EDTA pH
7.5) which was preliminarily poured into an ultra-centrifugation
tube. The ultracentrifugation tubes were placed in the bucket and
bucket cap was fastened. Then, the bucket was fixed in a rotor (SW
41Ti) and ultracentrifuged at 32 kprm for 24 hours at 20.degree.
C.
[0096] The supernatant was carefully discarded thoroughly and the
upper part of the ultra-centrifugation tube was cut of f by a
cutter. The obtained precipitation was washed with 70% ethanol.
Then, the pellet was rinsed three times with 150 .mu.l of TE/SDS
solution (10 mM Tris-HCl pH 7.6, 1 mM EDTA, 0.1% SDS) to dissolve
the precipitation in TE/SDS solution. The solution was extracted
two times with phenol/chloroform, followed by addition of 900 .mu.l
of ethanol and 30 .mu.l of 3 M sodium acetate (pH 5.2). The mixture
was stored at -80.degree. C. until use. When the concentration was
measured, an aliquot of the above stock solution was taken out and
centrifuged (15,000.times.g for 5 minutes at 4.degree. C.). After
washing with 70% ethanol (15,000.times.g for 5 minutes at 4.degree.
C.), the precipitation was dissolved in water that was pretreated
with diethyl pyrocarbonate (DEPC) (DEPC was added to distilled
water so that the final concentration of DEPC became 0.1%, followed
by stirring, standing still for about 24 hours and autoclaving. The
pretreated water was stored at room temperature.). Absorbance of
the solution was determined at the wave-length of 260 nm using
DU-64 Spectrophotometer and the amount of RNA was estimated.
[0097] (c) Next, complementary single-stranded cDNA was prepared by
reverse transcription. An aliquot of RNA (10 .mu.g) obtained in the
above procedure was taken out and centrifuged (15,000.times.g for 5
minutes at 4.degree. C.). The obtained precipitation was washed
with 70% ethanol (15,000.times.g for 5 minutes at 4.degree. C.) and
dissolved in 9.8 .mu.l of DEPC-treated water. To the solution 160
ng of 0.5 .mu.g/.mu.l Oligo(dT).sup.15 primer (Promega:
5'-TTTTTTTTTTTTTTT-3') was added and heated at 70.degree. C. for 5
minutes. After the heating for 5 minutes, the sample was promptly
placed on ice and Preliminarily ice-chilled 28 .mu.l of reaction
buffer (a mixture of Reverse Transcriptase attachments, that is, 8
.mu.l of 5.times.RT Buffer, 4 .mu.l of 0.1 M DTT, 2 .mu.l of 10 mM
dNTPs, and 13 .mu.l of distilled water), 1 .mu.l of Ribonuclease
inhibitor (TaKaRa: Ribonuclease inhibitor) and 2 .mu.l of Reverse
transcriptase (GIBCO BRL: Super ScriptTM RNase H-Reverse
Transcriptase) were added to the sample in this order. Then, the
mixed sample was promptly subjected to one-hour reaction at 37 C to
elongate the complementary single-stranded cDNA by reverse
transcription. At the end of the reaction, the sample was heated at
95.degree. C. for 5 minutes to stop the reaction by heat block. The
obtained complementary single-stranded cDNA was stored at
-30.degree. C. until use.
[0098] (d) Subsequently, oligonucleotides were synthesized for the
purpose of amplification of Ref-1 translational region by Long-PCR
method. Each base sequence of the synthesized oligonucleotides is
shown in the following. Each oligonucleotide possesses individual
digestive region by the restriction enzyme from which each
oligonucleotides takes its name.
2 5'Ref-1XhoI primer: 5'-GTCTCTCGAGATGCCGAAGCGTGGGAAAAAG-3' (SEQ ID
NO: 5) 3'Ref-1 BamHI primer: 5'-ATGCGGATCCTTACAGTGCTAGGTATAGGGT-3'
(SEQ ID NO: 6)
[0099] The synthesized oligonucleotides were heated at 55.degree.
C. for 8 hours to be deprotected. The deprotected oligonucleotides
were subdivided into aliquots, dried under vacuum and dissolved in
diluted (1 in 10) buffer of TE (10 mM Tris-HCl pH 7.9, 1 mM EDTE).
PCR was conducted with the above two kinds of oligonucleotides,
employing the prepared single-stranded cDNA as templates. PCR kit
(XL PCR kit: PERKIN ELMER) was employed for the PCR procedures.
There are two kinds of reaction solutions (Lower Layer and Upper
Layer). The Lower Layer contains 40 pmol each of S'-terminal primer
and 3'-terminal primer, dNTPs of final concentration of 0.8 mM,
Mg(OAc)2 of final concentration of 1.4 mM and 12 .mu.l of
3.3.times.XL Buffer II. The final volume was made to be 40 .mu.l.
On the other hand, the Upper Layer contains 1 .mu.l of the
single-stranded CDNA templates, rTth DNA Polymerase, XL 4U and 18
.mu.l of 3.3.times.XL Buffer II. The final volume was made to be 60
.mu.l.
[0100] First, GEM 100 WAX (PERKIN ELMER) was placed on the Lower
Layer of a sample tube and heated at 80.degree. C. for 5 minutes
using a gene amplification apparatus, followed by cooling at
25.degree. C. for one minute, so that the WAX was solidified on the
Lower Layer. Thereon Upper Layer was placed and subjected to the
reaction using a gene amplification apparatus according to the
following scheme; at 94.degree. C. for one minute, 16 cycles of (at
94.degree. C. for 15 seconds, at 60.degree. C. for 10 minutes), 12
cycles of (at 94.degree. C. for 15 seconds, at 600.degree. C. for
10 minutes (elongated by 15 seconds in every cycle)), and at
72.degree. C. for 10 minutes. After the completion of the reaction,
the WAX which was solidified on the Upper Layer was holed through
and the reaction solution was transferred, followed by chloroform
extraction and ethanol precipitation. The amplified DNA fragments
were digested by XhoI and BamHI (TOYOBO) and directly subjected to
agarose gel electrophoresis. A part of the agarose gel containing
the DNA fragments was isolated, followed by phenol/chloroform
extraction and ethanol precipitation to purify the DNA
fragments.
[0101] (e) As the E. coli expression vector, pET14b (Novagen) was
employed. The DNA fragments purified in the above procedure were
ligated with the isolated and purified pET14b XhoI/BamHI-digested
fragments in order to construct the E. coli expression plasmids
(pET/Ref) which would express the recombinant protein of Ref-1 wild
type.
[0102] The E. coli possessing pET14b-derived E. coli expression
plasmids expresses His-Tag fused recombinant protein of which
N-terminal region is a peptide consisting of six histidines.
EXAMPLE 11
Confirmation of the Binding Ability of Ref-1 Against E3330
[0103] (a) The binding ability of the recombinant protein obtained
in the above procedure against E3330 was investigated using
E3330-immobilized particles. As a result, it was certainly
confirmed that the recombinant protein of Ref-1 specifically bound
to E3330. Furthermore, it was confirmed that E3330 bound to Ref-1
in Far Western method using .sup.14C-labeled E3330. Therefore,
Ref-1 is regarded as intracellular receptor to E3330.
[0104] (b) Ref-1 consists of a domain possessing redox activity in
its N-terminal region and consists of another domain possessing AP
nuclease activity, that severs apurinic/apyrimidinic
single-stranded DNA and inserts nick, in its C-terminal region.
Therefore, it was investigated whether E3330 would inhibit these
activities or not in the next experiment.
[0105] First, concerning AP nuclease activity, the plasmid
pBluescript SK+DNA (50 .mu.g) was treated with 50 mM sodium citrate
(pH 3.5) at 60.degree. C. for 15 minutes, followed by dialysis in
50 mM Tris-HCl (pH 7.4) at 4.degree. C. for about 24 hours. This AP
plasmid DNA possesses supercoiled circular DNA structure. This DNA
was suspended in nuclease buffer solution (10 mM Tris-HCl (pH 8.0),
5 mM MgCl.sub.2, 1 mM EDTA, 0.01% NP-40), to which the recombinant
Ref-1 was added, resulting in insertion of nick and open circular
DNA structure. However, as shown in FIG. 3, the AP nuclease
activity of the Ref-1 was not inhibited by E3330.
[0106] (c) Next, effects of Ref-1 on a redox activity were
investigated.
[0107] The obtained results are shown in FIG. 4. Prior to the
conduction of the investigation, there are some considerations.
Transcription factor NF-.sub..kappa.B possesses plural cystine
residues in its amino acid sequence. There are two cases; one is an
oxidized condition where these cystine residues are bound to each
other through an S--S bond; and the other one is a reduced
condition where they are individually existing with an SH-group.
Therefore, NF-.sub..kappa.B was treated with dithiothreitol (DTT)
that is known as a reductant to make the state of NF-.sub..kappa.B
to be reduction. As a result, DNA-binding ability of the reduced
NF-.sub..kappa.B was increased, that was confirmed by a gel-shift
assay. Ref-1 possessing a redox activity was added to
NF-.sub..kappa.B which was partially purified from Jurkat cells,
resulting in increase in DNA-binding ability, that was confirmed by
a gel-shift assay. Furthermore, the enhancement of the DNA-binding
activity of NF-.sub..kappa.B by Ref-1 was reduced by the addition
of E3330 to the reaction mixture. However, E3330 did not inhibit
the increase in the DNA-binding activity of NF-.sub..kappa.B by
DTT. Therefore, it was revealed that E3330 specifically inhibits
the DNA-binding activity of NF-.sub..kappa.B.
[0108] (d) NF-.sub..kappa.B is a hetero-dimer consisting of two
subunits (p65 and p50). The molecular weights of those two subunits
p65 and p50 are 65 kDa and 50 kDa, respectively. The His-tag
recombinant proteins of those p65 and p50 subunits were prepared
using baculovirus expression system. Then, it was investigated by
gel-shift assay whether E3330 had effects on p65 or on p50. The
obtained results are shown in FIG. 5. DNA-binding ability of
p65/p65 homo-dimer under reduced conditions by the addition of DTT
was significantly enhanced, but the enhancement was not observed by
the addition of Ref-1. On the other hand, DNA-binding ability of
p50/p50 homo-dimer and p65/p50 hetero-dimer was enhanced by the
addition of either DTT or recombinant Ref-1. Therefore, it was
revealed that Ref-1 had effects on p50, one of the subunits
NF-.sub..kappa.B. The enhancement of DNA-binding ability of p50/p50
homo-dimer or p65/p50 hetero-dimer by the addition of Ref-1 was
reduced by the addition of E3330. As NF-.sub..kappa.B recognizes a
specific base sequence and binds to the specific DNA sequence,
binding to DNA is the minimum requirement for NF-.sub..kappa.B to
function as a transcriptional factor. This binding step is
regulated by Ref-1, indicating that Ref-1 is at least an
intracellular factor activating transcription factor,
NF-.sub..kappa.B with respect to DNA-binding step. Moreover, it was
revealed that E3330 inhibits the activation induced by Ref-1.
[0109] (e) In addition, GST pull down assay was conducted to
confirm that Ref-1 specifically bound to p50 subunit of
NF-.sub..kappa.B. The obtained results show that Ref-1 really binds
to p50 of GST-tag (GST-p50), as indicated in FIG. 6.
EXAMPLE 12
Preparation of Mutational Recombinant Proteins of Ref-1
[0110] (a) In order to confirm that Ref-1 bound to E3330, a series
of different quantities of N-terminal and C-terminal flanking
regions of Ref-1 deletion mutant strains were prepared using
pET/Ref, as described in the following. Then, these recombinant
proteins were expressed in E. coli and purified using a nickel
column and a glutathione column to investigate whether they bound
to E3330-immobilized particles or not. These mutational recombinant
proteins of Ref-1 including a wild type are schematically shown in
FIG. 7.
[0111] (b) Preparation of pET/RefdC76, pET/RefdC91, pET/RefdC163
and pET/RefdC 182
[0112] The prepared pET/Ref, 10 .mu.g, was digested with BamHI and
AatII (TOYOBO), extracted with phenol/chloroform and precipitated
with ethanol. These pET/Ref BamHI/AatII digested fragments were
dissolved in 100 .mu.l of the buffer solution which was prepared
through dilution (1 in 10) of 10.times.ExoIII Buffer (500 mM
Tris-HCl (pH 8), 50 mM MgCl.sub.2, 100 mM .beta.-ME) attached to
Exonuclease III (ExoIII: TaKaRa). Subsequently, 180 U of ExoIII was
added to the above solution, followed by incubation at 25.degree.
C. for 5, 10, 15, 20, 25, 30, 40, 50, or 60 minutes, for the
purpose of degradation of the pET/Ref BamHI/AatII digested
fragments in the direction of 3 to 5'. Since ExoI is inhibited by
the addition of Zn+, 100 .mu.l of the buffer solution which was
prepared through dilution (1 in 10) of 10.times.Mung Been Buffer
(300 mM CH.sub.3COONa (pH 4.6), 1 M NaCl, 10 mM
(CH.sub.3COO).sub.2Zn, 50% Glycerol) attached to Mung Been Nuclease
(TaKaRa) was added to each of the reaction mixtures to stop the
degradation. The resultant reaction mixtures were incubated at
65.degree. C. for 5 minutes to inactivate the enzyme completely.
Subsequently, 50 U of Mung Been Nuclease was added to the above
solutions, followed by incubation at 37.degree. C. for 30 minutes,
for the purpose of degradation of the portions of single-stranded
DNA through the degradation by ExoIII. Then, the resultant
solutions were subjected to extraction with phenol/chloroform and
precipitation with ethanol. The DNA termini were repaired with
Klenow Fragment (terminal smoothing of DNA) to make the DNA termini
completely smooth. Then, the resultant solutions were subjected to
extraction with phenol/chloroform and precipitation with ethanol,
followed by digestion with XhoI. Through the above procedures,
translational regions of Ref-1 with various length-deletion in its
C-terminal region, with which the N-terminus was the XhoI-digested
terminus and the C-terminus was the smooth terminus, were
obtained.
[0113] Three fragments, that is, one of these various DNA
fragments, isolated and purified pET14b XhoI/BamHI-digested
fragment and BamHI Linker, were ligated to each other in order to
construct plasmids expressing recombinant Ref-1 deletion mutants in
E. coli. The base sequences of BamHI Linker are shown in the
following. Every frame of the Linker was designed to contain
termination codon. The preparation method for the Linker is the
same as the above method by which various kinds of double-stranded
DNA with ligation sequence for each transcriptional factor were
prepared in the above.
3 BamHI Linker :5'-TAACTAACTAG-3' (SEQ ID NO: 7)
:3'-ATTGATTGATCCTAG-5' (SEQ ID NO: 8)
[0114] Names for plasmids expressing recombinant Ref-1 deletion
mutants in E. coli were taken from the number of deleted amino acid
residues from their C-termini after the translation. The names are
described in the following in order of the number: pET/RefdC76 (76
amino acid residues from the C-terminus were deleted), pET/RefdC91
(91 amino acid residues from the C-terminus were deleted),
pET/RefdC163 (163 amino acid residues from the C-terminus were
deleted) and pET/RefdC182 (182 amino acid residues from the
C-terminus were deleted).
[0115] (c) Preparation of pET/RefdC230, pET/RefdC247 and
pET/RefdC278
[0116] Through the same method as described in the above,
pET/RefdC230 (230 amino acid residues from the C-terminus were
deleted), pET/RefdC247 (247 amino acid residues from the C-terminus
were deleted) and pET/RefdC278 (278 amino acid residues from the
C-terminus were deleted) were constructed.
[0117] (d) Preparation of pET/RefdN41, pET/RefdN81, pET/RefdN121
and pET/RefdN161
[0118] A series of these recombinant Ref-1 N-terminal deletion
mutants expressing in E. coli were amplified by Long-PCR method
using synthesized oligonucleotides. Each base sequence of the
synthesized oligonucleotides is shown in the following. Each
oligonucleotide possesses individual digestive region by the
restriction enzyme from which each oligonucleotide takes its
name.
4 5'RefdN41 XhoI primer: 5'-ATGCCTCGAGATGCCAGCCCTGTATGAGGA- CC-3'
(SEQ ID NO: 9) 5'RefdN81 XhoI primer:
5'-ATGCCTCGAGATGGATTGGGTAAAGGAAGAAGCC-3' (SEQ ID NO: 10) 5'RefdN121
XhoI primer: 5'-ATGCCTCGAGATGCCTTCGGACAAGGAAGGGT-3' (SEQ ID NO: 11)
5'RefdN161 XhoI primer: 5'-ATGCCTCGAGATGTTTGACTCGTTTGTGCTGGTA-3'
(SEQ ID NO: 12)
[0119] The synthesized oligonucleotides were heated at 55.degree.
C. for 8 hours to be deprotected. The deprotected oligonucleotides
were subdivided into aliquots, dried under vacuum and dissolved in
diluted (1 in 10) buffer of TE (10 mM Tris-HCl (pH 7.9), 1 mM
EDTA).
[0120] One of the above four kinds of oligonucleotides and 3'Ref-1
BamHI primer were combined and subsequent procedures were the same
as previously described to conduct PCR. The amplified DNA fragments
were individually digested by Xhoi and BamHI (TOYOBO) and directly
subjected to agarose gel electrophoresis. A part of the agarose gel
containing the DNA fragments was isolated, followed by
phenol/chloroform extraction and ethanol precipitation to purify
the DNA fragments. One of these various DNA fragments, isolated and
purified pET14b XhoI/BaHI-digested fragment and BamHI Linker, were
ligated to each other in order tb construct pET/RefdN41 (41 amino
acid residues from the N-terminus were deleted), pET/RefdN81 (81
amino acid residues from the N-terminus were deleted), pET/RefdN121
(121 amino acid residues from the N-terminus were deleted) and
pET/RefdN161 (161 amino acid residues from the N-terminus were
deleted), respectively.
[0121] (e) Preparation of pET/RefdN41dC163, pET/RefdN41dC182 and
pET/RefdN41dC213
[0122] First, pET/RefdN41 was digested with PvuII and XhoI, and
subjected to agarose gel electrophoresis. A part of the agarose gel
containing only translational region was isolated. On the other
hand, pET/RefdC163, pET/RefdC182 and pET/RefdC213 were digested
with PvuII and BamHI, and subjected to agarose gel electrophoresis.
Each part of the agarose gel containing only translational region
was individually isolated and prepared. The same procedures, as
described in the above, were conducted to ligate to each other in
order to construct pET/RefdN41dC163 (41 amino acid residues from
the N-terminus were deleted and 163 amino acid residues from the
C-terminus were deleted), pET/RefdN841dC182 (41 amino acid residues
from the N-terminus were deleted and 182 amino acid residues from
the C-terminus were deleted) and pET/RefdN41dC213 (41 amino acid
residues from the N-terminus were deleted and 213 amino acid
residues from the C-terminus were deleted), respectively.
[0123] (f) Preparation of pET/ RefdN51dC182, pET/RefdN61dC182,
pET/RefdN71dC182, pET/RefdN81dC163 and pET/RefdN81dC182
[0124] The same procedures, as described in the above, were
conducted to construct each deletion mutant.
EXAMPLE 13
Binding Assay of Mutational Recombinant Proteins of Ref-1 Expressed
in E. coli Against E3330
[0125] First, wild-type recombinant proteins of Ref-1 and
mutational recombinant proteins of Ref-1 were expressed in E. coli
and purified using His Bind Resin or Glutathione Sepharose 4B.
Then, each purified protein was subjected to SDS-PAGE and stained
using Rapid Stain CBB. The obtained results are shown in FIGS. 8
and 9. A series of C-terminal deletion mutants are shown in FIG. 8.
A series of N-terminal deletion mutants and a series of both-sided
C-terminal and N-terminal deletion mutants are shown in FIG. 9. In
the FIG. 8, Lanes from Lane 1 to Lane 9 were wild-type (WT), dC50,
dC76, dC91, dC157, dC163, dC182, dC213 and GST-dC213 in this order,
when electrophoresis was conducted. Their molecular weights were
about 40 kDa, 37 kDa, 36 kDa, 35 kDa, 28 kDa, 26 kDa, 23 kDa, 19
kDa and 42 kDa, respectively. In the FIG. 9, Lanes from Lane 1 to
Lane 9 were wild-type (WT), dN41, dN81, dN 121, dN 161,
GST-dN81dc182, GSTdN41dC213, GST-dN81dC213 and GST in this order,
when electrophoresis was conducted. Their molecular weights are
about 40 kDa, 36 kDa, 32 kDa, 28 kDa, 22 kDa, 36 kDa (a band
appearing just left side of Lane 7), 37 kDa, 33 kDa and 28 kDa,
respectively.
EXAMPLE 14
Identification of E3330-binding Domain Using Mutational Recombinant
Proteins of Ref-1
[0126] Which kinds of Ref-1 deletion mutant proteins were bound to
E3330 was investigated to identify E3330-binding domain. Therefore,
binding assays were performed using E3330-immobilized SG particles.
The experimental scheme was the same as illustrated in the FIG. 2.
Concerning the elution procedure, two kinds of processes were
conducted in this experiment. One is that 2 .mu.g of each purified
Ref-1 deletion mutant protein was mixed with E3330-immobilized SG
particles, followed by standing still for 30 minutes in an
ice-water bath; the protein binding to the particles was eluted
with an elution buffer containing 1 M KCl; and then, each eluate
was subjected to 12.5% SDS-PAGE and existence of proteins was
detected by silver staining. The other one is that 2 .mu.g of each
purified Ref-1 deletion mutant protein was mixed with
E3330-immobilized SG particles, followed by standing still for 30
minutes in an ice-water bath; 1.times.SDS sample dye was added to
the particles to which each kind of proteins was bound; and the
resultant suspension was directly boiled so that the protein
binding to the particles was eluted; and then, each eluate was
subjected to 12.5% SDS-PAGE and existence of proteins was detected
by CBB staining. As a result, it was suggested that the following
recombinant deletion mutant proteins of Ref-1 were bound to
E3330-immobilized SG particles. In a process using an elution
buffer containing 1 M KCl, the binding proteins were wild-type
(about 40 kDa), dC76 (about 36 kDa), dC91 (about 35 kDa), dC163
(about 26 kDa), dC182 (about 23 kDa), dC213 (about 19 kDa) and
GST-dC213 (about 42 kDa). In the other process using a direct
boiling method, the binding proteins were wild-type (about 40 kDa),
dN41 (about 36 kDa), dN81 (about 32 kDa), GST-dN81dC182 (about 36
kDa) and GST-dN81dC213 (about 33 kDa). These obtained results are
shown in FIGS. 10 and 11.
[0127] From the above results, Ref-1, that is a protein consisting
of 318 amino acid residues in its whole length, does not bind to
E3330 in case where 231 or more amino acid residues from its
C-terminus are deleted or in case where 72 or more amino acid
residues from its N-terminus are deleted. Therefore, it was
revealed that the amino acid sequence of at least 72 a.a. to 88
a.a. participated in the binding activity of Ref-1 against E3330,
as shown in FIG. 12. Actually, recombinant protein possessing only
the concerned amino acid sequence (72 a.a. to 88 a.a.) was
synthesized and investigated on its binding properties using
E3330-immobilized particles, resulting in confirmation of its
binding ability against E3330. The amino acid sequence of 72 a.a.
to 88 a.a. is as follows SEQ ID NO:13; length of sequence: 17 amino
acids): LRAWIKKKGLDWVKEEA.
[0128] These results indicated that the intracellular receptor to
E3330 was isolated and purified using E3330-immobilized particles
and it is clear that the present invention is extremely useful for
isolation and purification of proteins.
EXAMPLE 15
Immobilization of DM852 to SG-EGDE Particles
[0129] Five mg of SG-EGDE particles, were prepared as described
above, was washed three times with 1 ml of DH.sub.2O. After
washing, 500 .mu.l of DH.sub.2O solution containing 5 .mu.mol of
DM852 was added to the packed SG-EDGE, followed by reaction at
37.degree. C. for 24 hours, in order to immobilize DM852 to epoxy
groups of EGDE on the surfaces of SG-EGDE particles. After the
reaction was finished, the particles were washed three times with
500 .mu.l of H.sub.2). The drug-immobilized particles were stored
at 4.degree. C. in a dark place with 500 .mu.l of H.sub.2O. The
centrifugation procedure for washing was conducted at
12,000.times.g for 3 minutes at room temperature. Under these
reaction conditions about 0.1 mmol of DM852 was immobilized onto 1
g of the SG-EGDE particles. The above immobilized amount of DM852
was obtained by subtracting the amount of DM852 not bound to the
SG-EGDE particles frown the starting amount of DM852. DM852 shows
the maximum absorption at the wave-length of 265.0 nm, so that each
amount of DM852 can be determined by measuring an absorbance at the
wave-length of 265.0 nm on each sample; such as the starting
solution, not binding fraction and washing fractions. The
measurement on the absorbance was conducted with DU-64
Spectrophotometer (BECKMAN).
Preparation of a Crude Nuclear Extract, Cytoplasmic and Membrane
Fractions
[0130] The culture of LP101 stroma cells, (5.times.10.sup.8 cells),
which were cultured in a 150 mm dishes, was scraped and the
collected cells was conducted using 15-ml-centrifugation tubes and
washed two times with PBS(-) at 300.times.g; for 5 minutes at
4.degree. C. Then, the final packed cell volume (PCV) was measured.
Buffer A (10 mM Tris-HCl pH 7.4, 1 mM MgCl.sub.2 1 mM EDTA, 0.5 mM
DTT, 1 mM PMSF, 1 .mu.gl/ml pepstain A, 1 .mu.gl/ml leupeptin),
four times larger volume of the PCV, was added to the packed cells
to suspend the cells. The cell suspension was allowed to stand
still on ice for 10 minutes so that the cells were swollen. The
cell membranes of the swollen cells were broken by 20 strokes using
a 15-ml-B-type Dounce homogenizer (IWAKI), transferred to
15-ml-centrifugation tubes (IWAKI) and add NaCl (final
concentration 0.15M). Then, it was centrifuged at 840.times.g for
10 minutes at 4.degree. C. for the purpose of separating a nuclear
fraction (pellet) from a membrane and cytoplasmic fraction
(supernatant).
[0131] Buffer A, five times more volume of the PCV, was added to
the isolated nuclear fraction to re-suspend the nuclei. The nuclear
suspension was centrifuged at 4,000.times.g for 5 minutes at
4.degree. C. for the purpose of removing the contaminated
cytoplasmic fraction. The obtained nuclear pellet was dispersed In
Buffer C (20 mM Tris-HCl pH 7.4, 420mM NaCI.sub.2 1 mM MgGl.sub.2,
0.2 mM EDTA, 10% (v/v)glycerol, 0.5 mM DTT, 1 mM PMSF, 1 .mu.g/ml
pepstatin A, 1 .mu.g/ml leupeptin), the same volume as the PCV, and
thoroughly suspended by 10 strokes using a B-type Dounce
homogenizer. The suspension was slowly stirred for 30 minutes at
4.degree. C. for the purpose of extracting nuclear components. The
extract was transferred to a 15-ml-centrifugation tube and
centrifuged at 12,000.times.g for 30 minutes at 4.degree. C. The
obtained supernatant was dialyzed two times against 500 ml of
Buffer E (10 mM Tris-HCl pH 7.4, 100 mM NaCl.sub.2 1 mM MgCl.sub.2,
1 mM CaCI.sub.2, 0.2 mM EDTA, 10% (v/v)) glycerol, 0.1% NP-40, 0.5
mM DTT, 1 mM PMSF, 1 .mu.g/ml pepstatin A, 1 .mu.gl/ml leupeptm)
for 6 hours at 4.degree. C.
[0132] On the other hand, the cytoplasmic fraction was, transferred
to an ultra-centrifugation tube (BECKMAN NO: 344057) and
ultra-centrifuged at 100,000.times.g for one hour at 4.degree. C.
(BECKMAN: Rotor Type SW50.1) for the purpose of separating a
membrane (pellet) from a cytoplasmic fraction (supenatant).
[0133] The obtained cytoplasmic fraction was dialyzed in the same
manner as the above procedure for the nuclear extract.
[0134] Buffer A, two times more volume of the PCV, was added to
re-suspend the obtained membrane fraction and Octylglucoside (final
concentration 3%) was added for the purpose of solubilizing the
membrane fraction. The suspension was slowly stirred for four hours
at 4.degree. C., and ultra-centrifuged at 100,000.times.g for one
hour at 4.degree. C. (BECKMAN: Rotor Type SW50.1). Then, the
solubilized membrane fraction was dialyzed in the same manner as
the above procedure for the nuclear extract.
[0135] After the completion of the dialyses, the nuclear extract,
the cytoplasmic fraction and the membrane fraction even subdivided
into appropriate aliquots and stored at -80.degree. C. until the
use of them.
[0136] In usual preparation, about 5 ml (5 mg/ml) of the nuclear
extract 15 ml (3 mg/ml) of the cytoplasmic fraction and 15 ml (2
mg/ml) of the membrane fraction, respectively were obtained in the
scale of this working example.
Isolation of Proteins Using Microspheres
[0137] Microspheres and the extract and each fraction were mixed
and centrifuged to separate substances binding to DM852 which was
immobilized on particles from the mixture. The centrifiugation
procedure for separation was conducted at 12,000.times.g for 3
minutes at 4.degree. C. All procedures in the above were conducted
at 4.degree. C.
[0138] First, 1 mg of each DM852-not-immobilized SG-EGDE particles
and DM-852-immobilized SG-EGDE particles mixture, which include
0.03 mg of DM852-immobilized SG EGDE particles, were washed three
times with 400 .mu.l of Buffer E. These particles were used as a
reference control against DM852 immobilized SG EGDE particles. To
these washed particles DM852-not immobilized SG EGDE and
DM852-immobilized SG-EGDE particles mixture, 500 .mu.l each of the
extract and fractions, were added and mixed. These mixtures were
allowed to be standing still for 4 hours with intermittently
rotating in order to bind proteins possessing DM852-binding
abilities to DM852 which was immobilized on the particles. The
mixture was centrifuged and the supernatant was discarded. The
pellet was washed three times with 500 .mu.l of Buffer E to remove
non-specific binding substances as much as possible. Subsequently
the washed pellet was eluted with 50 .mu.l of Buffer E+ which
contained 10 mM DM852 in Buffer E, so that the proteins possessing
DM852-binding abilities were dissociated and eluted from DM852
immobilized on the particles. The washed solution and eluted
solution were stored at -80.degree. C.
[0139] The detection of the proteins possessing DM852-biinding
abilities was conducted by electrophoresis on a 10%
SDS-polyacrylamide gel (SDS-PAGE) using 5 .mu.l obtained from the
DM852-immobilized SG-EGDE particles mixture and
DM852-not-immobilized SG-EGDE particles used as a reference
control. In this experiment, 4.times.SDS special dye (200 mM
Tns-HCl(pH 6.8), 500 mM .beta.-mercaptoethanol (.beta.-ME), 8% SOS,
0.4% BPB) was used instead of 4.times.SDS sample dye in order to
prevent the electrochoresis from being disordered due to such high
concentration of the salts. The electrophoresed gel was subjected
to silver staining and the proteins specifically binding to DM852
were identified in comparison with the results of the reference
control. As a result, in the membrane fraction, two protein bands
with molecular weights of about 70 kDa aloud 80 kDa which were not
observed in the reference control were clearly observed, suggesting
that the proteins were specifically binding to DM852. The
DM852-binding proteins were obtained about 10 ng each in the above
procedure. In the nuclear extract and cytoplasmic fractions any
specific bands were not detected.
Evaluation of Specific-binding Abilities Against DM852
[0140] To confirm that the protein was specifically bound to DM852
a competitive binding-inhibitory experiment was conducted.
[0141] In the step of the above procedure for the addition of the
membrane fraction to SG-EGDF particles, free DM852 at 100 times and
400 times more moles of the DM852 immobilized on the particles were
added simultaneously. Then, the protein possessing specifically
binding abilities to DM852 immobilized on the particles would be
bound to free DM852, resulting in a lower yield in the isolation
using the particles. As a result, it was confirmed that the yield
of the protein with a molecular weight of about 70 kDa and 80 kDa
were lowered, indicating that the proteins were specifically bound
to DM852.
EXAMPLE 16
Immobilization of H-9 With a Spacer
[0142] The spacer-immobilized particles, that are SG-EGDE,
particles, were prepared as described above. Five mg of SG-EGDE
particles were washed with 200 .mu.l of H.sub.2O three times and
then 500 .mu.l of H.sub.2O containing H-9 (final conc. 30 mM) was
added to the particles in order to immobilize H-9 to epoxy group of
EGDE on the surface of SG-EGDE particles. After 12 hours incubation
at 37.degree. C. in a dark room, the particles were washed three
times with 400 .mu.l of H.sub.2O through a centrifugation manner.
Then, the particles were dispersed in 0.5 M Tris-HCL buffer (pH
8.5), allowed to be standing still 4.degree. C. for at least 24
hours and used in order to thoroughly mask the intact epoxy groups,
on the surface of SG-EGDE particles. The drug-immobilized particles
were stored at 4.degree. C. in a dark place. The centrifugation
procedure for washing was conducted at 15,000.times.g for 5 minutes
at room temperature. Under these reaction conditions about 0.14
mmol of H-9 was immobilized onto 1 g of the SG-EGDE) particles.
Isolation of Proteins Using Microspheres
[0143] HeLa cell nuclear extracts (NE) were prepared according to
the method as described previously (Dignam, J. D., Lebovitz, R. M.
and Roeder, R. G. (1983). Accurate transcription by RNA pol II in a
soluble extracts from isolated mammalian nucleic. Nucleic Acids Res
11. 1475-1489). Three hundred micrometer of NE was incubated for 30
minutes at 4.degree. C. with 1.0 mg of H-9-not-immobilized SG-EGDE
particles and H-9-immobilized SG-EGDE particles which have been
washed three times with 200 .mu.l of HGKEDN (20 mM HEPES (pH 7.9),
10% (V/V) glycerol, 0.1M KCL, 0.2 mM EDTA, 1 mM DTT, 0.1% Nonidet
P-40(NP-40)). The H9-not-immobilized SG.EGDE particles were
dispersed in 1 ml of 1 M Tris HCl buffer solution (pH 7.4) and
allowed to be standing still at 4.degree. C. for at least 24 hours
in order to mask epoxy groups of EGDE. These particles were used as
a reference control against H-9-immobilized SG EGDE particles. The
mixture was centrifuged and the supernatant was discarded. The
pellet was washed three times with 500 .mu.l of HGKEDN to remove
non-specific binding substances as much as possible.
[0144] Subsequently, the washed pellet was eluted three times with
HGKEDN containing 1 M KCl or 3 mM H-9 or 3 mM H-9, so that the
proteins possessing H-9-binding abilities were dissociated and
eluted from H-9 is immobilized on the particles. The wash solution
and eluate solution were stored at -80.degree. C.
[0145] The detection of the proteins possessing H9-binding
abilities was conducted by electrophoresis on a 10%
SDS-polyacrylamide gel (SDS-PAGE) using 20 .mu.l each of the first,
second or third eluate solution obtained from the H-9-immobilized
SG-EGDE particles and H9-not-immobilized SG EGDE particles used as
a reference control. In this experiment, 4.times.SDS special dye
(200 mM Tns-HCl pH 6.8), 500 mM b-mercaptoethanol (b-ME), 8% SDS,
0.4% BPB) was need instead of 4.times.SDS special dye in order to
prevent the electrophoresis from being disordered due to such high
concentration of the salts. The electrophoresed gel was subjected
to silver staining and the protein specifically binding to H-9 were
identified in comparison with the results of the reference control.
As a result, a protein band with a molecular weight of about 30 kDa
which was not observed in the reference control was clearly
observed, suggesting that the protein was specifically binding to
H-9. The same protein band was obtained by elution using H-8 or
H-9, suggesting that the 30 kDa protein was bound to the
H-9-immobilized SG-EGDE particles in a specific manner.
Evaluation of Specific Binding Abilities Against H-9
[0146] A competition experiment was conducted to confirm that the
protein with a molecular weight of about 30 kDa in HeLa cell
nuclear extract was specifically bound to H-9. In the step of a
procedure for the addition of HeLa cell nuclear extracts to SG-EGDE
particles, when free H-9 or H-8 were added simultaneously to
H-9-immobilized SG-EGDE particles with indicated concentrations,
the addition of the drugs resulted in a lower yield of the 30 kDa
protein in the isolation using the particles. Thus, it was
confirmed that the yield of the protein with a molecular weight of
About 30 kDa was lowered, indicating that the protein was
specifically bound to H-9 or H.8.
EXAMPLE 17
Immobilization of an Amino Derivative of DQ2511 (Ecabapide) With a
Spacer
[0147] (a) (Induction of an amino derivative of DQ2511)
[0148] As DQ2511 does not possess an appropriate functional group,
it is difficult to immobilize DQ2511 onto SG-EGDE particles.
Therefore, NH.sub.2-DQ2511 was synthesized through the induction of
an amino group into DQ2511.
[0149] (b) (Immobilization of NH.sub.2-DQ2511 to SG-EGDE
particles)
[0150] Ten mg of SG-EGDE particles described above was washed three
times with 500 .mu.l of H.sub.2O through a centrifugation
procedure. After washing, 500 .mu.l of H.sub.2O solution containing
4 .mu.mol of NH.sub.2-DQ2511 was added to the packed SG-EGDE
particles to disperse the SG-EGDE particles in the above solution,
followed by reaction at 37.degree. C. for 24 hours, in order to
immobilize NH.sub.2-DQ2511 to epoxy groups of EGDE on the surfaces
of SG-EGDE particles. After the reaction was finished, the
particles were washed three times with 400 .mu.l of H.sub.2O
through a centrifugation procedure. Then, the particles were
dispersed in 500 .mu.l of 0.5 M Tris-HCl buffer solution (pH 8.5),
allowed to be standing still at 4.C for at least 24 hours and used,
in order to thoroughly mask the intact epoxy groups on the surfaces
of SG-EGDE particles. The drug-immobilized particles were stored at
4.degree. C. in a dark place. The centrifugation procedure for
washing was conducted at 15,000.times.g for 5 minutes at room
temperature. Under these reaction conditions about 0.06 mmol of
NH.sub.2-DQ2511 was immobilized onto 1 g of the SG-EGDE particles.
The above immobilized amount of NH.sub.2-DQ2511 was obtained by
subtracting the amount of NH.sub.2-DQ2511 not bound to the SG-EGDE
particles from the starting amount of NH.sub.2-DQ2511 NH2-DQ2511
shows the maximum absorption at the wave-length of 275.0 nm, so
that each amount of NH.sub.2-DQ2511 can be determined by measuring
an absorbance at the wave-length of 275.0 nm on each sample, such
as the starting solution, not-binding fraction and washing
fractions. The measurement on the absorbance was conducted with
DU-64 Spectrophotometer (BECKMAN).
Preparation of a Crude Cytoplasmic Fraction From HeLa Cell
[0151] The culture medium suspension of HeLa cells
(3.times.10.sup.9 cells), which were cultured in a suspension scale
of 8 liters, was centrifuged using 500-ml-centrifugation tubes
(NARGEN) at 500.times.g for 10 minutes at 4.degree. C. for the
purpose of collecting the cells. The collected cells were washed
two times with PBS(-). The washing procedure was conducted using
50-ml-centrifugation tubes and the centrifugation conditions were
At 700.times.g for 5 minutes at 4.degree. C. Then, the final packed
cell volume (PCV) was measured. Buffer A (10 mM Hepes pH 7.9, 1.5
mM MgCl.sub.2, 10 mM KCl, 0.5 mM DTT), four times larger volume of
the PCV, was added to the packed cells to suspend the cells. The
cell suspension was allowed to stand still on ice for 20 minutes 90
that the cells were swollen. The cell membranes of the swollen
cells were broken by 20 strokes using a 40-ml-B-type Dounce
homogenizer (WHEATON), transferred to a 50-ml--centrifugation tube
(NARGEN) and centrifuged at 4,200.times.g for 6 minutes at
4.degree. C. for the purpose of separating a nuclear fraction
(pellet) and a cytoplasmic fraction (supernatant).
[0152] The cytoplasmic fraction was transferred to a
50-ml-centrifugation tube and centrifuged at 20,000.times.g for 1
hour at 4.degree. C. The obtained supernatant was dialyzed three
times against 500 ml of Buffer 0.05 HKMGED (20 mM Hepes pH 7.9, 10%
(V/V) glycerol, 0.05 M KCl, 1 mM MgCl.sub.2, 0.2 mM EDTA, 0.4 mM
PMSF, 1 mM DTT) for 2 hours at 4.degree. C. After the completion of
the dialyses, the cytoplasmic fraction of HeLa cell was centrifuged
at 20,000.times.g for 1 hour at 4.degree. C. The obtained
supernatants was used as the sample of cytoplasmic fraction of HeLa
cell. This sample was subdivided into appropriate aliquots and
stored at -80.degree. C. until the use of them. In usual
preparation, about 20 ml of the cytoplasmic fraction at the protein
concentration of 10 mg/ml, was obtained in the scale of this
working example,
Preparation of a Crude Lysate From Rat Dorsal Root Ganglia (DRG)
Cell
[0153] Dorsal root ganglia cells isolated from rats were washed two
tines with PBS(-). The washing procedure was conducted using
15-ml-centrifugation tubes and the centrifugation conditions were
at 700.times.g for 5 minutes at 4.degree. C. Then, the final packed
cell volume (PCV) was measured, PBS(-), four times larger volume of
the PCV, was added to the packed cells to suspend the cells. The
cells were broken completely by homogenize, transferred to 1.5 ml
tubes (eppendorf) and centrifuged at 136,000.times.g for 1 hour at
4.degree. C. In usual preparation, the supernatant of lysate
including 1 mg/ml of protein was obtained.
[0154] To concentrate the crude lysate of DRG cell, the proteins
contained in it were salted out with saturated ammonium sulfate.
After centrifugation at 20,000.times.g for 1 hour at 4.degree. C.,
the supernatant was removed. The pellet was dissolved with 0.05
HKMGED (20 mM Hepes pH 7.9, 10% (V/V) glycerol, 0.05 M KCl, 1 mM
MgCl.sub.2, 0.2 mM EDTA, 0.4 mM PMSF, 1 mM DTT) to be one fourth
volume of starting lysate. The concentrated lysate was dialyzed
three times against 500 ml of Buffer 0.05 HKMGED (20 mM Hepes pH
7.9, 10% v/v) glycerol, 0.05 M ACT, 1 me MgClz, 0.2 mM EDTA, 0.4 MU
PMSF, 1 EM DTT) for 2 hours at 4.degree. C.
[0155] After the completion of the dialyses, the concentrated
lysate of DRG cell was centrifuged at 20,000.times.g for 1 hour at
4.degree. C. The obtained supernatant was used as the sample of
lysate of DRG cell. This sample was subdivided into appropriate
aliquotd and stored at -80.degree. C. until the use of them. In
usual preparation, the concentrated lysate including 3 mg/ml of
protein was obtained
Isolation of Proteins From a Cytoplasmic Fraction of HeLa Cell
Using Microspheres
[0156] A process of isolation and purification of DQ2511-binding
proteins using DQ2511-immobilized particles is illustrated above.
Before using, cytoplasmic fraction of HeLa cell was diluted to ten
third volume with Buffer 0.05 HKMGEDN (20 mM Hepes pH 7.9, 10% v/v
glycerol, 0.05 M KCl, 1 mM MgCl:, 0.2 mM EDTA, 0.4 mM PMSF, 1 mM
DTT, 0.01% NP-40).
[0157] (a) microspheres and the diluted cytoplasmic fraction were
mixed and centrifuged to separate substances binding to DQ2511
which was immobilized on particles from the mixture. The
centrifugation procedure for separation was conducted at
15,000.times.g for 5 minutes at 44.degree. C. All procedures in the
above were conducted at 4.degree. C.
[0158] (b) First, 1 mg each of DQ2511-not-immobilized SG-EGDE
particles and DQ2511-immobilized SG-EGDB particles were washed
three times with 400 .mu.l of Buffer 0.05 HKMGEDN (20 mM Hepes pH
7.9, 10% (V/V) glycerol, 0.05 M KCl, 1 mM MgCl.sub.2, 0.2 mM EDTA,
0.4 mM PMSF, 1 mM DTT, 0.01% NP-40). The DQ2511-not-immobilized
SG-EGDE particles were dispersed in 1 ml of 0.5 M Tris-HCl buffer
solution (pH 8.5) and allowed to be standing still at 4.degree. C.
for at least 24 hours in order to mask epoxy groups of EGDE. These
particles were used as a reference control against DQ2511
-immoblllzed SG-EGDE particles. To these washed
DQ2511-not-immobilized SG-EGDE particles and
DQ2511-immobilized-SG-EGDE particles, 1 ml of the diluted
cytoplasmic fraction was added and mixed. These mixtures were
rotated for 1 hour at 4.degree. C. in order to bind proteins
possessing DQ2511-binding abilities to DQ2511 which was immobilized
on the particles. The mixture was centrifuged and the supernatant
was discarded. The pellet was washed seven times with 200 .mu.l
0.05 HKMGEDN to remove non-specific binding substances as much as
possible. Subsequently, the washed pellet was eluted two times with
20 .mu.l of Buffer 1.0 HKMGEDN (20 mM Hepes pH 7.9, 10% (v/v)
glycerol, 1.0 M KCl, 1 mM MgCl.sub.2, 0.2 mM EDTA, 0.4 mM PMSF, 1
mM DTT, 0.01% NP-40), so that the proteins possessing
DQ2511-hinding abilities were dissociated and eluted from DQ2511
immobilized on the particles. The wash solution and eluate
solutions were stored at -80.degree. C.
[0159] (c) The detection of the proteins possessing DQ2511-binding
abilities were conducted by electrophoresis on a 8%
SDS-polyacrylamide gel (SDS-PAGE) using 5 .mu.l each of the first,
second or third eluate solution obtained from the
DQ2511-immobilized SG-EGDE particles and DQ2511-not-immobilized
SG-EGDE particles used as a reference control. The electrophoresed
gel was subjected to silver staining and the proteins specifically
binding to DQ2511 were identified in comparison with the results of
the reference control. As a result, in the cytoplasmic fraction a
protein band with a molecular weight of about 110 kDa which was not
observed in the reference control was clearly observed, suggesting
that the protein was specifically binding to DQ2511.
[0160] In the above procedure, about 20 ng of 110 kDa
DQ2511-binding protein was obtained from 1 mg of the
DQ2511-immobilized SG-EGDE particles.
Isolation of Proteins From a Lysate of Rat DRG Cell Using
Microsphere
[0161] Microspheres and the concentrated crude lysate of rat DRG
cell were mixed and centrifuged to separate substances binding to
DQ2511 which was immobilized on particles from the mixture. The
procedures of binding, washing and detection of protein were
performed as described above. As a result, a protein with a
molecular weight about 170 kDa was obtained as the protein
possessing DQ2511-binding ability. In the above procedure, about 10
ng of 170 kDa DQ2511-binding protein was obtained from 1 mg of the
DQ2511-immobilized SG-EGDE particles.
Evaluation of Specific-binding Abilities Against DQ2511
[0162] The following competitive binding-inhibitory experiment was
conducted to confirm that the 110 kDa protein in the cytoplasmic
fraction of HeLa cell and 170 kDa protein in the lysate of rat DRG
cell bound to DQ2511 specifically.
[0163] When in the step of a procedure for the addition of either
the cytoplasmic fraction or crude lysate of rat DRG cell to SG-EGDE
particles, free NH.sub.2-DQ2511 at 50 times, 150 times or 500 times
more moles than the immobilized NH.sub.2-DO2511 were added
simultaneously. The protein possessing specifically binding
abilities to DQ2511 immobilized on the particles would be bound to
free NH.sub.2-DQ2511, resulting in a lower yield in the isolation
using the particles. As a result, the purifications of the protein
with a molecular weight of about 110 kDa and the protein with a
molecular weight of about 170 kDa from the DQ2511-immobilized
particles were inhibited with dose dependence of free
NH.sub.2-DQ2511, indicating that the proteins were specifically
bound to NH.sub.2-DQ2511.
EXAMPLE 18
Immobilization of KF43389 to SG-EGDE Particles
[0164] Five mg of SG-EGDE particles was washed three times with 1
ml of 1.4-dioxane through a centrifugation procedure. After
washing, 500 .mu.l of 1.4-dioxane solution containing 15 .mu.mol of
KF49389 was added to the packed SG-EGDE particles to disperse the
SG-EGDE particles in the above solution, followed by reaction at
37.degree. C. for 48 hours, in order to immobilize KF49389 to epoxy
groups of EGDE on the surfface of SG-EGDE particles. After the
reaction was finished, the particles were washed three times with
500 .mu.l of 1.4-dioxane and three times with water through a
centrifugation procedure. The drug-immobilized particles were
stored at 4.degree. C. in a dark place with 500 .mu.l of water. The
centrifugation procedure for washing was conducted at
15,000.times.g for 5 minutes at room temperature.under these
reaction conditions about 0.15 mmol of KF49389 was immobilized onto
1 g of the SG-EGDE particles. The above immobilized amount of
KF49389 was obtained by subtracting the amount of KF49389 not bound
to the SG-EGDE particles from the starting amount of KF49389.
KF49399 shows the maximum absorption at the wave-length of 282.0 nm
so that each amount of KF49389 can be determined by measuring an
absorbance at the wave-length of 282.0 nm on each sample, such as
the starting solution, not-binding fraction and washing fractions.
The measurement on the absorbance was conducted with DU-64
Spectrophotometer (BECKMAN).
Preparation of a Crude Nuclear Extract and a Cytoplasmic
Fraction
[0165] The culture of MG63 cells (1.times.10.sup.9 cells), which
were cultured in a 150 mm dishes, was scraped and the collected
cells was conducted using 50-ml-centrifugation tubes and washed two
times with PBS(-) at 3000.times.g for 10 minutes at 4.degree. C.
Then, the final packed cell volume (PCV) was measured. Buffer A (10
mM Hepes pH 7.9, 1.5 mM MgCl.sub.2, 10 mM KCl, 0.5 mM DTT), two
times larger volume of the PCV, was added to the packed cells to
suspend the cells. The cell suspension was allowed to stand still
on ice for 10 minutes so that the cells were swollen. The cell
membranes of the swollen cells were broken by 20 strokes using a
40-ml-B-type Dounce homogenizer (WHEATON), transferred to a
50-mil-centrifugation tube (NARGEN) and centrifuged at 2000.times.g
for 10 minutes at 4.degree. C. for the purpose of separating a
nuclear fraction (pellet) from a cytoplasmic fraction
(supernatant). Buffer A, five times larger volume of the PCV, was
added to the isolated nuclear fraction to re-suspend the nuclei.
The nuclear suspension was centrifuged at 4,200.times.g for 6
minutes at 4.degree. C. for the purpose of removing the
contaminated cytoplasmic fraction. The obtained nuclear pellet was
dispersed in Buffer C (20 mM Hepes pH 7.9, 25% v/v glycerol, 0.42 M
NaCl, 1.5 mM MgCl.sub.2, 0.2 mM EDTA, 0.5 mM PMSF, 1 mM DTT), the
same volume as the PCV, and thoroughly suspended by 10 strokes
using a B-type Dounce homogenizer. The suspension was slowly
stirred for 30 minutes at 4.degree. C. for the purpose of
extracting nuclear components. The extract was transferred to a
50-ml-centrifugation tube and centrifuged at 3,000.times.g for 10
minutes at 4.degree. C. The obtained supernatant was dialyzed two
times against one liter of Buffer D (20 mM Hepes pH 7.9, 10% (V/V)
glycerol, 0.05 M KCl, 0.2 mM EDTA, 1 mM MgCl.sub.2, 0.1 mM PMSF, 1
mM DTT) for 4 hours at 4.degree. C.
[0166] On the other hand, the cytoplasmic fraction was transferred
to an ultra-centrifugation tube and ultra-centrifuged at 35 Krpm
for one hour at 4.degree. C. (BECKMAN: Rotor Type SW: 50.1). The
obtained supernatant was dialyzed in the same manner as the above
procedure for the nuclear extract.
[0167] After the completion of the dialyses, the nuclear extract
and the cytoplasmic fraction were subdivided into appropriate
aliquots and stored at -80.degree. C. until the use of them.
Isolation of Proteins Using Microspheres
[0168] (a) Microspheres and the cytoplasmic were mixed and
centrifuged to separate substances binding to KF49389 which was
immobilized on particles from the mixture. The centrifugation
procedure for separation was conducted at 15,000.times.g for 5
minutes at 4.degree. C. All procedures in the above were conducted
at 4.degree. C.
[0169] (b) First, 0.5 mg each of KF49389-not-immobilized SG-EGDE
particles and KF49309-immobilized SG-EGDE particles were washed
three times with 400 .mu.l of Buffer D. These particles were used
as a reference control against KF49389-immobilized SG-EGDE
particles. To these washed KF49389-not-immobilized SG-EGDE
particles and KF49389-immobilized SG-EGDE particles, 3 mg per 1 ml
of the cytoplasmic fractionation, was added and mixed. These
mixtures were allowed to be standing still for 4 hours with
rotating in order to bind proteins possessing KF49389-binding
abilities to KF49389 which was immobilized on the particles. The
mixture was centrifuged and the supernatant was discarded. The
pellet was washed four times with 500 .mu.l of Buffer D to remove
non-specific binding substances as much as possible.
[0170] Subsequently, the washed pellet was eluted with 30 .mu.l of
Buffer E (20 mM Hepes pH 7.9, 10% (V/V) glycerol, 1 mM DTT, 0.2 mM
EDTIA, 1 mM MgCl.sub.2, 0.1 mM PMSF 1 mM DTT), so that the proteins
possessing KF49389-binding abilities were dissociated and eluted
from KF49389 immobilized on the particles. The wash solution and
eluate solution were stored at -80.degree. C.
[0171] (c) The detection of the proteins possessing KF49389-binding
abilities was conducted by electrophoresis on a 10%
SDS-polyacrylamide gel (SDS-PAGE) using 10 .mu.l obtained from the
KF49389-immobilized SG-EGDE particles and KF49389-not-immobilized
SG-EGDE particles used an a reference control. In this experiment,
4.times.SDS special dye (200 mM Tris-HCl (pH 6.8), 500 mM
.beta.-mercaptoethanol (.beta.-ME), at SDS, 0.4% BPB) was used
instead of 4.times.SDS sample dye in order to prevent the
electrophoresis from being disordered due to such high
concentration of the salts. The electrophoresed gel was subjected
to silver staining and the proteins specifically binding to KF49389
were identified in comparison with the results of the reference
control. As a result, in the cytoplasmic fraction a protein band
with a molecular weight of about 55 kDa which was not observed in
the reference control was clearly observed, suggesting that the
protein was specifically binding to KF49389. This binding protein
was obtained about 10 ng from each tubes.
Confirmation of the Binding Ability of KF49389-binding Protein
[0172] (a) The above procedure was repeated and finally 5 .mu.g of
KF49389-binding protein was obtained. N-terminal amino acid
sequence of the obtained protein was analyzed and three different
sequences was detected. These amino acid sequences were analyzed
using a computer and determined to be identical with the amino acid
sequences of N-terminal region of three different proteins. These
proteins are conditionally named as protein A, B. C, respectively,
These proteins were cloned using PCR method from HeLa cells cDNA
library, and subcloned into E. coli expression plasmids pGEX4T-2
(Pharmacia) which would express the GST-Tag fused recombinant
protein of A, B, C wild type. The expression plasmids were
introduced into E. coli BL21 (DE3) and protein expression was
induced by addition of 0.4 mM IPTG. Purification of the GST-tagged
proteins was performed according co the manufacturer's instructions
(Pharmacia}.
[0173] (b) The binding ability of the recombinant protein obtained
in the above procedure against KF49389 was investigated using
KF49389 immobilized particles 400 ng per 500 .mu.l of the
recombinant protein, GST alone or GST-Tagged protein A, B, C, was
incubated with KF49389 immobilized particles and performed as
above, As a result, GST alone was not recovered from
KF49389-immobilized particles, entirely. In contrast, recombinant
proteins of GST-Tagged protein A, B, C were recovered from
KF49389-immobilized particles and especially GST-Tagged A was
obtained high efficiently against input recombinant protein (about
80%). These results indicates that the protein A, B, C can bind
with KF49389 specifically and the protein A has a high affinity
with KF49389.
EXAMPLE 19
Isolation of Proteins Using Microspheres
[0174] A process of isolation and purification of E3330-binding
proteins using E3330-immobilized particles is illustrated in FIGS.
14 an 15.
[0175] (a) Microspheres and the crude nuclear extract or each
fraction obtained through the fractionation use a phosphocellulose
column in the working example 5 were mixed and centrifuged to
separate substances binding to E3330 which was immobilized on
particles from the mixture. The centrifugation procedure for
separation was conducted at 15,000.times.g for 5 minutes at
4.degree. C. All processes in the above were conducted at 4.degree.
C.
[0176] (b) First, 1 mg each of E3330-not-immobilized SG-EGDE
particles and E3330-immobilized SG-EGDE particles were washed three
times until 250 .mu.l of Buffer D2 (20 mM HEPES (pH 7.9), 10% (V/V)
glycerol, 0.125 M KCL 0 2 mM EDTA, 1 mM DTT) in Which KCl and
glycerol concentrations were 0.125 M and 10% instead of 0.1 M and
20%, respectively, in Buffer D. The E3330-not-immobilized SG-EGDE
particles were dispersed in 1 ml of 1 M Tris-HCl buffer solution
(pH 7.4) and allowed to be standing sell at 4.degree. C. for at
least 24 hours in order to mask epoxy groups of EGDE. These
particles were used as a reference control against
E3330-immobilized SG-EGDE particles To these washed
E3330-not-immobilized SG-EGDE particles and E3330-immobilized
SG-EGDE particles, 100 .mu.l each of each of the nuclear extract,
P.1, P.3 P.5, or P1.0 which were diluted with buffer D2 to a
concentration of 0.16 mg/ml was added and mixed These mixtures were
allowed to be standing still for 30 minutes with intermittenly
stirring at intervals of 10 minutes in order to bind proteins
possessing E3330-binding abilities to E3330 which was immobilized
on the particles. The mixture was centrifuged and the supernatant
was discarded. The pellet was washed five times With 250 .mu.l of
Buffer D2 to remove non-specific binding substances as much as
possible. Subsequently, the washed pellet was eluted with 20 .mu.l
of Buffer D containing 1M KCl, so that the proteins possess
E3330-binding abilities were disassociated and eluted from E3330
immobilized on the particles. The wash solution and eluate solution
were stored at -80.degree. C.
[0177] (c) The detection of the protein possessing E3330-binding
abilities was conducted by electrophoresis on a 10%
SDS-polyacrylamide gel (SDS-PAGE) using 10 .mu.l of the eluate
solution obtained from the E3330-mobilized SG EGDE particles and
E3330-not-immobilized SG-EGDE particles used as a reference
control. In this experiment, 4.times.SDS Special dye (200 mM
Tris-HCl (pH 6.8), 500 mM .beta.-mercaptoethanol (.beta.-ME), 8%
SDS, 0.4% BPB) was used instead of 4.times.SDS sample dye in order
to prevent the electrophoresis from being disordered due to such
high concentration of the salts. The electrophoresed gel was
subjected to silver staining and the proteins specifically binding
to E3330 were identified in comparison with the results of the
reference control. As a result, from the purification using nuclear
extract, three protein bands with a molecular weight of about 60,
38, and 27 kDa which were not observed in the reference control
were clearly observed, suggesting that the proteins revere
specifically binding to E3330. From the purification using P.1,
there was not observed any specific protein band specifically
eluted from E3330-immobilized particles.
[0178] The above procedure was repeated and finally 5 .mu.g of
E3330-binding protein with a molecular weight of about 38 kDa was
obtained. From the purification using P.3, a protein band with a
molecular weight of about 60 kDa which were not observed in the
reference control were clearly observed. From the purification
using P.5, a protein hand with a molecular weight of about 38 kDa
which were not observed in the reference control were clearly
observed. From the purification using P.1.0, a protein band with a
molecular weight of about 27 kDa which were not observed in the
reference control were clearly observed.
EXAMPLE 20
Evaluation of Specific-binding Abilities Against E3330
[0179] Two kinds of experiments were conducted to confirm that the
proteins with a molecular weight of about 60, 38, and 27 kDa in the
nuclear extracts of Jurkat cells were specifically bound to
E3330.
[0180] The first one was a competitive binding-inhibitory
experiment. When in the step of a procedure for the addition of the
nuclear extracts to SG-EGDE particles free NH.sub.2-E3330 at the
same moles of the NH.sub.2-E3330 immobilized on the particles or
free NH.sub.2-E3330 at ten times more moles than the immobilized
NH.sub.2-E3330 were added simultaneously, the protein possessing
specifically binding abilities to E3330 immobilized on the
particles would be bound to free NH.sub.2-E3330, resulting in a
lower yield in the isolation using the particles. As a result, it
was confirmed that the yield of the proteins with a molecular
weight of about 60, 38, and 27 kDa was lowered, indicating that the
proteins were specifically bound to E3330.
[0181] Next, the other experiment was conducted by varying the
amount of NH.sub.2-E3330 Mobilized on the SG-EGDE particles. In the
present study the maximum amount of the immobilized E3330
derivatives is 0.4 .mu.mol per 1 mg of SG-EGDE particles. Under
these conditions, about 5 to 6 molecules of E3330 derivatives are
immobilized on the 1 mm.sup.2 of the surface of the particles. This
experimental study was conducted in case where the amount of the
immobilized E3330' derivatives was 0.2 .mu.mol or 0,4 .mu.mol per 1
mg of SG-EGDE particles. However, in the present invention, amounts
of compound immobilized on the particles are varied depending on
the properties of the immobilized compounds, conditions of
immobilization and so on. The amounts are not defined and are
generally varied between a few molecules and hundred molecules. As
a result, it was confirmed that the yield of the proteins with a
molecular weight of about 60, 38, and 27 kDa increased as the
immobilized amount increased. The identification of the specific
proteins were conducted by electrophoresis using SDS-PAGE.
[0182] The invention has been described in detail with reference to
preferred embodiments thereof. However, it will be appreciated that
those skilled in the art, upon consideration of this disclosure,
may make modifications and improvements within the spirit and scope
of the invention as set forth in the following claims.
Sequence CWU 0
0
* * * * *