SBHWSB2: a new member of the WD40 SOCS box family

Abstract

SBHWSB2 polypeptides and polynucleotides and methods for producing such polypeptides by recombinant techniques are disclosed. Also disclosed are methods for utilizing SBHWSB2 polypeptides and polynucleotides in therapy, and diagnostic assays for such.

Description

FIELD OF THE INVENTION

[0001] This invention relates to newly identified polypeptides and polynucleotides encoding such polypeptides, to their use in therapy and in identifying compounds which may be agonists, antagonists and/or inhibitors which are potentially useful in therapy, and to production of such polypeptides and polynucleotides.

BACKGROUND OF THE INVENTION

[0002] The drug discovery process is currently undergoing a fundamental revolution as it embraces `functional genomics`, that is, high throughput genome- or gene-based biology. This approach as a means to identify genes and gene products as therapeutic targets is rapidly superceding earlier approaches based on `positional cloning`. A phenotype, that is a biological function or genetic disease, would be identified and this would then be tracked back to the responsible gene, based on its genetic map position.

[0003] Functional genomics relies heavily on high-throughput DNA sequencing and the various tools of bioinformatics to identify gene sequences of potential interest from the many molecular biology databases now available. There is a continuing need to identify and characterise further genes and their related polypeptides/proteins, as targets for drug discovery.

SUMMARY OF THE INVENTION

[0004] The present invention relates to SBHWSB2, in particular SBHWSB2 polypeptides and SBHWSB2 polynucleotides, recombinant materials and methods for their production. In another aspect, the invention relates to methods for using such polypeptides and polynucleotides, including the treatment of cancer, obesity, inflammatory disorders, heart disease, Crohn's diseases, neuropathies and immune disorders, hereinafter referred to as "the Diseases", amongst others. In a further aspect, the invention relates to methods for identifying agonists and antagonists/inhibitors using the materials provided by the invention, and treating conditions associated with SBHWSB2 imbalance with the identified compounds. In a still further aspect, the invention relates to diagnostic assays for detecting diseases associated with inappropriate SBHWSB2 activity or levels.

DESCRIPTION OF THE INVENTION

[0005] In a first aspect, the present invention relates to SBHWSB2 polypeptides. Such peptides include isolated polypetides comprising an amino acid sequence which has at least 97% identity, preferably at least 98-99% identity, to that of SEQ ID NO:2 over the entire length of SEQ ID NO:2. Such polypeptides include those comprising the amino acid of SEQ ID NO:2.

[0006] Further peptides of the present invention include isolated polypeptides in which the amino acid sequence has at least 97% identity, most preferably at least 98-99% identity, to the amino acid sequence of SEQ ID NO:2 over the entire length of SEQ ID NO:2. Such polypeptides include the polypeptide of SEQ ID NO:2.

[0007] Further peptides of the present invention include isolated polypeptides encoded by a polynucleotide comprising the sequence contained in SEQ ID NO: 1.

[0008] Polypeptides of the present invention are believed to be members of the WD40 SOCS box family of polypeptides. They are therefore of interest because SOCS box containing proteins are implicated in acting as a negative regulators of cytokine signaling. Cytokines initiate a signal transduction pathway via the Janus kinase (JAK) family of kinase and STAT transcription factors. Recently a family of proteins have been identified which are induced by cytokine signaling and which then negatively regulate the function of JAK kinases, forming a negative feedback control loop for the cytoline signaling pathway (A. Yoshimura et al., EMBO J. 14:2816-2826,1995; R. Starr et al., Nature 387:917-921,1997; T. Endo et al., Nature 387:921-924,1997; T. Naka et al, Nature 387:924-929,1997; C. Bjorbaek et al., Mol. Cell 1:619-625,1998; D. J. Hilton et al., PNAS 95:114-119, 1998). Identification of novel human SOCS box proteins should aid the understanding of cytokine signaling pathways and provide regulatory targets for those pathways. These properties are hereinafter referred to as SBHWSB2 activity "or SBHWSB2 polypeptide activity" or "biological activity of SBHWSB2". Also included amongst these activities are antigenic and immunogenic activities of said SBHWSB2 polypeptides, in particular the antigenic and immunogenic activities of the polypeptide of SEQ ID NO:2. Preferably, a polypeptide of the present invention exhibits at least one biological activity of SBHWSB2.

[0009] The polypeptides of the present invention may be in the form of the "mature" protein or may be a part of a larger protein such as a precursor or a fusion protein. It is often advantageous to include an additional amino acid sequence which contains secretory or leader sequences, pro-sequences, sequences which aid in purification such as multiple histidine residues, or an additional sequence for stability during recombinant production.

[0010] The present invention also includes variants of the aforementioned polypeptides, that is polypeptides that vary from the referents by conservative amino acid substitutions, whereby a residue is substituted by another with like characteristics. Typical such substitutions are among Ala, Val, Leu and Ile; among Ser and Thr; among the acidic residues Asp and Glu; among Asn and Gln; and among the basic residues Lys and Arg; or aromatic residues Phe and Tyr. Particularly preferred are variants in which several, 5-10, 1-5, 1-3, 1-2 or 1 amino acids are substituted, deleted, or added in any combination.

[0011] Polypeptides of the present invention can be prepared in any suitable manner. Such polypeptides include isolated naturally occurring polypeptides, recombinantly produced polypeptides, synthetically produced polypeptides, or polypeptides produced by a combination of these methods. Means for preparing such polypeptides are well understood in the art.

[0012] In a further aspect, the present invention relates to SBHWSB2 polynucleotides. Such polynucleotides include isolated polynucleotides comprising a nucleotide sequence encoding a polypeptide which has at least 97% identity, to the amino acid sequence of SEQ ID NO:2, over the entire length of SEQ ID NO:2. In this regard, polypeptides which have at least 98% identity are highly preferred, whilst those with at least 99% identity are most highly preferred. Such polynucleotides include a polynucleotide comprising the nucleotide sequence contained in SEQ ID NO: 1 encoding the polypeptide of SEQ ID NO:2.

[0013] Further polynucleotides of the present invention include isolated polynucleotides comprising a nucleotide sequence that has at least 90% identity, preferably at least 95% identity, to a nucleotide sequence encoding a polypeptide of SEQ ID NO:2, over the entire coding region. In this regard, polynucleotides which have at least 97% identity are highly preferred, whilst those with at least 98-99% identity are more highly preferred, and those with at least 99% identity are most highly preferred.

[0014] Further polynucleotides of the present invention include isolated polynucleotides comprising a nucleotide sequence which has at least 90% identity, preferably at least 95% identity, to SEQ ID NO: 1 over the entire length of SEQ ID NO: 1. In this regard, polynucleotides which have at least 97% identity are highly preferred, whilst those with at least 98-99% identiy are more highly preferred, and those with at least 99% identity are most highly preferred. Such polynucleotides include a polynucleotide comprising the polynucleotide of SEQ ID NO: 1 as well as the polynucleotide of SEQ ID NO: 1.

[0015] The invention also provides polynucleotides which are complementary to all the above described polynucleotides.

[0016] The nucleotide sequence of SEQ ID NO: 1 shows homology with mouse WD40 SOCS box cDNA WSB2 (D. J. Hilton et al., PNAS 95:114-119, 1998). The nucleotide sequence of SEQ ID NO: 1 is a cDNA sequence and comprises a polypeptide encoding sequence (nucleotide 95 to 1306) encoding a polypeptide of 404 amino acids, the polypeptide of SEQ ID NO:2. The nucleotide sequence encoding the polypeptide of SEQ ID NO:2 may be identical to the polypeptide encoding sequence contained in SEQ ID NO: 1 or it may be a sequence other than the one contained in SEQ ID NO: 1, which, as a result of the redundancy (degeneracy) of the genetic code, also encodes the polypeptide of SEQ ID NO:2. The polypeptide of the SEQ ID NO:2 is structurally related to other proteins of the WD40 SOCS box family, having homology and/or structural similarity with mouse WD40 SOCS protein WSB2 (D. J Hilton et al., PNAS 95:114-119, 1998).

[0017] Preferred polypeptides and polynucleotides of the present invention are expected to have, inter alia, similar biological functions/properties to their homologous polypeptides and polynucleotides. Furthermore, preferred polypeptides and polynucleotides of the present invention have at least one SBHWSB2 activity.

[0018] The present invention also relates to partial or other polynucleotide and polypeptide sequences which were first identified prior to the determination of the corresponding full length sequences of SEQ ID NO:1 and SEQ ID NO:2.

[0019] Accordingly, in a further aspect, the present invention provides for an isolated polynucleotide which:

[0020] (a) comprises a nucleotide sequence which has at least 90% identity, preferably at least 95% identity, more preferably at least 97-99% identity to SEQ ID NO:3 over the entire length of SEQ ID NO:3;

[0021] (b) has a nucleotide sequence which has at least 90% identity, preferably at least 95% identity, more preferably at least 97-99% identity, to SEQ ID NO:3 over the entire length of SEQ ID NO:3;

[0022] (c) the polynucleotide of SEQ ID NO:3; or

[0023] (d) a nucleotide sequence encoding a polypeptide which has at least 95% identity, preferably at least 97-99% identity, to the amino acid sequence of SEQ ID NO:4, over the entire length of SEQ ID NO:4;

[0024] as well as the polynucleotide of SEQ ID NO:3.

[0025] The present invention further provides for a polypeptide which:

[0026] (a) comprises an amino acid sequence which has at least 95% identity, preferably at least 97-99% identity, to that of SEQ ID NO:4 over the entire length of SEQ ID NO:4;

[0027] (b) has an amino acid sequence which has at least 95% identity, preferably at least 97-99% identity, to the amino acid sequence of SEQ ID NO:4 over the entire length of SEQ ID NO:4;

[0028] (c) comprises the amino acid of SEQ ID NO:4; and

[0029] (d) is the polypeptide of SEQ ID NO:4; as well as polypeptides encoded by a polynucleotide comprising the sequence contained in SEQ ID NO:3.

[0030] The nucleotide sequence of SEQ ID NO:3 and the peptide sequence encoded thereby are derived from EST (Expressed Sequence Tag) sequences. It is recognised by those skilled in the art that there will inevitably be some nucleotide sequence reading errors in EST sequences (see Adams, M. D. et al, Nature 377 (supp) 3, 1995). Accordingly, the nucleotide sequence of SEQ ID NO:3 and the peptide sequence encoded therefrom are therefore subjec to the same inherent limitations in sequence accuracy. Furthermore, the peptide sequence encoded by SEQ ID NO:3 comprises a region of identity or close homology and/or close structural similarity (for example a conservative amino acid difference) with the closest homologous or structurally similar protein.

[0031] Polynucleotides of the present invention may be obtained, using standard cloning and screening techniques, from a cDNA library derived from mRNA in cells of human brain, skeletal muscle, pancreatic islets, retina, fetal heart, ovary, pregnant uterus and endothelial cells , using the expressed sequence tag (EST) analysis (Adams, M. D., et al. Science (1991) 252:1651-1656; Adams, M. D. et al., Nature, (1992) 355:632-634; Adams, M.D., et al., Nature (1995) 377 Supp:3-174). Polynucleotides of the invention can also be obtained from natural sources such as genomic DNA libraries or can be synthesized using well known and commercially available techniques.

[0032] When polynucleotides of the present invention are used for the recombinant production of polypeptides of the present invention, the polynucleotide may include the coding sequence for the mature polypeptide, by itself; or the coding sequence for the mature polypeptide in reading frame with other coding sequences, such as those encoding a leader or secretory sequence, a pre-, or pro- or prepro- protein sequence, or other fusion peptide portions. For example, a marker sequence which facilitates purification of the fused polypeptide can be encoded. In certain preferred embodiments of this aspect of the invention, the marker sequence is a hexa-histidine peptide, as provided in the pQE vector (Qiagen, Inc.) and described in Gentz et al., Proc Natl Acad Sci USA (1989) 86:821-824, or is an HA tag. The polynucleotide may also contain non-coding 5' and 3' sequences, such as transcribed, non-translated sequences, splicing and polyadenylation signals, ribosome binding sites and sequences that stabilize mRNA.

[0033] Further embodiments of the present invention include polynucleotides encoding polypeptide variants which comprise the amino acid sequence of SEQ ID NO:2 and in which several, for instance from 5 to 10, 1 to 5, 1 to 3, 1 to 2 or 1, amino acid residues are substituted, deleted or added, in any combination.

[0034] Polynucleotides which are identical or sufficiently identical to a nucleotide sequence contained in SEQ ID NO: 1, may be used as hybridization probes for cDNA and genomic DNA or as primers for a nucleic acid amplification (PCR) reaction, to isolate full-length cDNAs and genomic clones encoding polypeptides of the present invention and to isolate cDNA and genomic clones of other genes (including genes encoding paralogs from human sources and orthologs and paralogs from species other than human) that have a high sequence similarity to SEQ ID NO: 1. Typically these nucleotide sequences are 70% identical, preferably 80% identical, more preferably 90% identical, most preferably 95% identical to that of the referent. The probes or primers will generally comprise at least 15 nucleotides, preferably, at least 30 nucleotides and may have at least 50 nucleotides. Particularly preferred probes will have between 30 and 50 nucleotides. Particularly preferred primers will have between 20 and 25 nucleotides.

[0035] A polynucleotide encoding a polypeptide of the present invention, including homologs from species other than human, may be obtained by a process which comprises the steps of screening an appropriate library under stringent hybridization conditions with a labeled probe having the sequence of SEQ ID NO: 1 or a fragment thereof; and isolating full-length cDNA and genomic clones containing said polynucleotide sequence. Such hybridization techniques are well known to the skilled artisan. Preferred stringent hybridization conditions include overnight incubation at 42.degree. C. in a solution comprising: 50% formamide, 5.times.SSC (150 mM NaCl, 15 mM trisodium citrate), 50 mM sodium phosphate (pH7.6), 5x Denhardt's solution, 10% dextran sulfate, and 20 microgram/ml denatured, sheared salmon sperm DNA; followed by washing the filters in 0.1.times.SSC at about 65.degree. C. Thus the present invention also includes polynucleotides obtainable by screening an appropriate library under stingent hybridization conditions with a labeled probe having the sequence of SEQ ID NO: 1 or a fragment thereof.

[0036] The skilled artisan will appreciate that, in many cases, an isolated cDNA sequence will be incomplete, in that the region coding for the polypeptide is short at the 5' end of the cDNA. This is a consequence of reverse transcriptase, an enzyme with inherently low `processivity` (a measure of the ability of the enzyme to remain attached to the template during the polymerisation reaction), failing to complete a DNA copy of the mRNA template during 1st strand cDNA synthesis.

[0037] There are several methods available and well known to those skilled in the art to obtain full-length cDNAs, or extend short cDNAs, for example those based on the method of Rapid Amplification of cDNA ends ACE) (see, for example, Frohman et al., PNAS USA 85, 8998-9002, 1988). Recent modifications of the technique, exemplified by the Marathon.TM. technology (Clontech Laboratories Inc.) for example, have significantly simplified the search for longer cDNAs. In the Marathon.TM. technology, cDNAs have been prepared from MRNA extracted from a chosen tissue and an `adaptor` sequence ligated onto each end. Nucleic acid amplification (PCR) is then carried out to amplify the `missing` 5' end of the cDNA using a combination of gene specific and adaptor specific oligonucleotide primers. The PCR reaction is then repeated using `nested` primers, that is, primers designed to anneal within the amplified product (typically an adaptor specific primer that anneals further 3' in the adaptor sequence and a gene specific primer that anneals further 5' in the known gene sequence). The products of this reaction can then be analysed by DNA sequencing and a full-length cDNA constructed either by joining the product directly to the existing cDNA to give a complete sequence, or carrying out a separate full-length PCR using the new sequence information for the design of the 5' primer.

[0038] Recombinant polypeptides of the present invention may be prepared by processes well known in the art from genetically engineered host cells comprising expression systems. Accordingly, in a further aspect, the present invention relates to expression systems which comprise a polynucleotide or polynucleotides of the present invention, to host cells which are genetically engineered with such expression sytems and to the production of polypeptides of the invention by recombinant techniques. Cell-free translation systems can also be employed to produce such proteins using RNAs derived from the DNA constructs of the present invention.

[0039] For recombinant production, host cells can be genetically engineered to incorporate expression systems or portions thereof for polynucleotides of the present invention. Introduction of polynucleotides into host cells can be effected by methods described in many standard laboratory manuals, such as Davis et al., Basic Methods in Molecular Biology (1986) and Sambrook et al., Molecular Cloning: A Laboratory Manual, 2nd Ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (1989). Preferred such methods include, for instance, calcium phosphate transfection, DEAE-dextran mediated transfection, transvection, microinjection, cationic lipid-mediated transfection, electroporation, transduction, scrape loading, ballistic introduction or infection.

[0040] Representative examples of appropriate hosts include bacterial cells, such as Streptococci, Staphylococci, E. coli, Streptomyces and Bacillus subtilis cells; fungal cells, such as yeast cells and Aspergillus cells; insect cells such as Drosophila S2 and Spodoptera Sf9 cells; animal cells such as CHO, COS, HeLa, C127, 3T3, BHK, HEK 293 and Bowes melanoma cells; and plant cells.

[0041] A great variety of expression systems can be used, for instance, chromosomal, episomal and virus-derived systems, e.g., vectors derived from bacterial plasmids, from bacteriophage, from transposons, from yeast episomes, from insertion elements, from yeast chromosomal elements, from viruses such as baculoviruses, papova viruses, such as SV40, vaccinia viruses, adenoviruses, fowl pox viruses, pseudorabies viruses and retroviruses, and vectors derived from combinations thereof, such as those derived from plasmid and bacteriophage genetic elements, such as cosmids and phagemids. The expression systems may contain control regions that regulate as well as engender expression. Generally, any system or vector which is able to maintain, propagate or express a polynucleotide to produce a polypeptide in a host may be used. The appropriate nucleotide sequence may be inserted into an expression system by any of a variety of well-known and routine techniques, such as, for example, those set forth in Sambrook et al., Molecular Cloning, A Laboratory Manual (supra). Appropriate secretion signals may be incorporated into the desired polypeptide to allow secretion of the translated protein into the lumen of the endoplasmic reticulum, the periplasmic space or the extracellular environment. These signals may be endogenous to the polypeptide or they may be heterologous signals.

[0042] If a polypeptide of the present invention is to be expressed for use in screening assays, it is generally preferred that the polypeptide be produced at the surface of the cell. In this event, the cells may be harvested prior to use in the screening assay. If the polypeptide is secreted into the medium, the medium can be recovered in order to recover and purify the polypeptide. If produced intracellularly, the cells must first be lysed before the polypeptide is recovered.

[0043] Polypeptides of the present invention can be recovered and purified from recombinant cell cultures by well-known methods including ammonium sulfate or ethanol precipitation, acid extraction, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, affinity chromatography, hydroxylapatite chromatography and lectin chromatography. Most preferably, high performance liquid chromatography is employed for purification. Well known techniques for refolding proteins may be employed to regenerate active conformation when the polypeptide is denatured during intracellular synthesis, isolation and or purification.

[0044] This invention also relates to the use of polynucleotides of the present invention as diagnostic reagents. Detection of a mutated form of the gene characterised by the polynucleotide of SEQ ID NO: 1 which is associated with a dysfunction will provide a diagnostic tool that can add to, or define, a diagnosis of a disease, or susceptibility to a disease, which results from under-expression, over-expression or altered spatial or temporal expression of the gene. Individuals carrying mutations in the gene may be detected at the DNA level by a variety of techniques.

[0045] Nucleic acids for diagnosis may be obtained from a subject's cells, such as from blood, urine, saliva, tissue biopsy or autopsy material. The genomic DNA may be used directly for detection or may be amplified enzymatically by using PCR or other amplification techniques prior to analysis. RNA or cDNA may also be used in similar fashion. Deletions and insertions can be detected by a change in size of the amplified product in comparison to the normal genotype. Point mutations can be identified by hybridizing amplified DNA to labeled SBHWSB2 nucleotide sequences. Perfectly matched sequences can be distinguished from mismatched duplexes by RNase digestion or by differences in melting temperatures. DNA sequence differences may also be detected by alterations in electrophoretic mobility of DNA fragments in gels, with or without denaturing agents, or by direct DNA sequencing (ee, e.g., Myers et al, Science (1985) 230:1242). Sequence changes at specific locations may also be revealed by nuclease protection assays, such as RNase and S1 protection or the chemical cleavage method (see Cotton et al, Proc Natl Acad Sci USA (1985) 85: 4397-4401). In another embodiment, an array of oligonucleotides probes comprising SBHWSB2 nucleotide sequence or fragments thereof can be constructed to conduct efficient screening of e.g., genetic mutations. Array technology methods are well known and have general applicability and can be used to address a variety of questions in molecular genetics including gene expression, genetic linkage, and genetic variability (see for example: M.Chee et al., Science, Vol 274, pp 610-613 (1996)).

[0046] The diagnostic assays offer a process for diagnosing or determining a susceptibility to the Diseases through detection of mutation in the SBHWSB2 gene by the methods described. In addition, such diseases may be diagnosed by methods comprising determining from a sample derived from a subject an abnormally decreased or increased level of polypeptide or MRNA. Decreased or increased expression can be measured at the RNA level using any of the methods well known in the art for the quantitation of polynucleotides, such as, for example, nucleic acid amplification, for instance PCR, RT-PCR, RNase protection, Northern blotting and other hybridization methods. Assay techniques that can be used to determine levels of a protein, such as a polypeptide of the present invention, in a sample derived from a host are well-known to those of skill in the art. Such assay methods include radioimmunoassays, competitive-binding assays, Western Blot analysis and ELISA assays.

[0047] Thus in another aspect, the present invention relates to a diagonostic kit which comprises:

[0048] (a) a polynucleotide of the present invention, preferably the nucleotide sequence of SEQ ID NO: 1, or a fragment thereof;

[0049] (b) a nucleotide sequence complementary to that of (a);

[0050] (c) a polypeptide of the present invention, preferably the polypeptide of SEQ ID NO:2 or a fragment thereof; or

[0051] (d) an antibody to a polypeptide of the present invention, preferably to the polypeptide of SEQ ID NO:2.

[0052] It will be appreciated that in any such kit, (a), (b), (c) or (d) may comprise a substantial component. Such a kit will be of use in diagnosing a disease or suspectability to a disease, particularly cancer, obesity, inflammatory disorders, heart disease, Crohn's diseases, neuropathies and immune disorders, amongst others.

[0053] The nucleotide sequences of the present invention are also valuable for chromosome localisation. The sequence is specifically targeted to, and can hybridize with, a particular location on an individual human chromosome. The mapping of relevant sequences to chromosomes according to the present invention is an important first step in correlating those sequences with gene associated disease. Once a sequence has been mapped to a precise chromosomal location, the physical position of the sequence on the chromosome can be correlated with genetic map data. Such data are found in, for example, V. McKusick, Mendelian Inheritance in Man (available on-line through Johns Hopkins University Welch Medical Library). The relationship between genes and diseases that have been mapped to the same chromosomal region are then identified through linkage analysis (coinheritance of physically adjacent genes).

[0054] The differences in the cDNA or genomic sequence between affected and unaffected individuals can also be determined. If a mutation is observed in some or all of the affected individuals but not in any normal individuals, then the mutation is likely to be the causative agent of the disease.

[0055] The gene of the present invention maps to human chromosome 12 between markers D12S369-D12S366.

[0056] The nucleotide sequences of the present invention are also valuable for tissue localisation. Such techniques allow the determination of expression patterns of the human SBHWSB2 polypeptides in tissues by detection of the mRNAs that encode them. These techniques include in situ hybridziation techniques and nucleotide amplification techniques, for example PCR. Such techniques are well known in the art. Results from these studies provide an indication of the normal finctions of the polypeptides in the organism. In addition, comparative studies of the normal expression pattern of human SBHWSB2 mRNAs with that of mRNAs encoded by a human SBHWSB2 gene provide valuable insights into the role of mutant human SBHWSB2 polypeptides, or that of inappropriate expression of normal human SBHWSB2 polypeptides, in disease. Such inappropriate expression may be of a temporal, spatial or simply quantitative nature.

[0057] The polypeptides of the invention or their fragments or analogs thereof, or cells expressing them, can also be used as immunogens to produce antibodies immunospecific for polypeptides of the present invention. The term "immunospecific" means that the antibodies have substantially greater affinity for the polypeptides of the invention than their affinity for other related polypeptides in the prior art.

[0058] Antibodies generated against polypeptides of the present invention may be obtained by administering the polypeptides or epitope-bearing fragments, analogs or cells to an animal, preferably a non-human animal, using routine protocols. For preparation of monoclonal antibodies, any technique which provides antibodies produced by continuous cell line cultures can be used. Examples include the hybridoma technique (Kohler, G. and Milstein, C., Nature (1975) 256:495-497), the trioma technique, the human B-cell hybridoma technique (Kozbor et al., Immunology Today (1983) 4:72) and the EBV-hybridoma technique (Cole et al., Monoclonal Antibodies and Cancer Therapy, 77-96, Alan R. Liss, Inc., 1985).

[0059] Techniques for the production of single chain antibodies, such as those described in U.S. Pat. No. 4,946,778, can also be adapted to produce single chain antibodies to polypeptides of this invention. Also, transgenic mice, or other organisms, including other mammals, may be used to express humanized antibodies.

[0060] The above-described antibodies may be employed to isolate or to identify clones expressing the polypeptide or to purify the polypeptides by affinity chromatography.

[0061] Antibodies against polypeptides of the present invention may also be employed to treat the Diseases, amongst others.

[0062] In a further aspect, the present invention relates to genetically engineered soluble fusion proteins comprising a polypeptide of the present invention, or a fragment thereof, and various portions of the constant regions of heavy or light chains of immunoglobulins of various subclasses (IgG, IgM, IgA, IgE). Preferred as an immunoglobulin is the constant part of the heavy chain of human IgG, particularly IgGl, where fusion takes place at the hinge region. In a particular embodiment, the Fc part can be removed simply by incorporation of a cleavage sequence which can be cleaved with blood clotting factor Xa. Furthermore, this invention relates to processes for the preparation of these fusion proteins by genetic engineering, and to the use thereof for drug screening, diagnosis and therapy. A further aspect of the invention also relates to polynucleotides encoding such fusion proteins. Examples of fusion protein technology can be found in International Patent Application Nos. WO 94/29458 and WO 94/22914.

[0063] Another aspect of the invention relates to a method for inducing an immunological response in a mammal which comprises inoculating the mammal with a polypeptide of the present invention, adequate to produce antibody and/or T cell immune response to protect said animal from the Diseases hereinbefore mentioned, amongst others. Yet another aspect of the invention relates to a method of inducing immunological response in a mammal which comprises, delivering a polypeptide of the present invention via a vector directing expression of the polynucleotide and coding for the polypeptide in vivo in order to induce such an immunological response to produce antibody to protect said animal from diseases.

[0064] A further aspect of the invention relates to an immunological/vaccine formulation (composition) which, when introduced into a mammalian host, induces an immunological response in that mammal to a polypeptide of the present invention wherein the composition comprises a polypeptide or polynucleotide of the present invention. The vaccine formulation may further comprise a suitable carrier. Since a polypeptide may be broken down in the stomach, it is preferably administered parenterally (for instance, subcutaneous, intramuscular, intravenous, or intradermal injection). Formulations suitable for parenteral administration include aqueous and non-aqueous sterile injection solutions which may contain anti-oxidants, buffers, bacteriostats and solutes which render the formulation instonic with the blood of the recipient; and aqueous and non-aqueous sterile suspensions which may include suspending agents or thickening agents. The formulations may be presented in unit-dose or multi-dose containers, for example, sealed ampoules and vials and may be stored in a freeze-dried condition requiring only the addition of the sterile liquid carrier immediately prior to use. The vaccine formulation may also include adjuvant systems for enhancing the immunogenicity of the formulation, such as oil-in water systems and other systems known in the art. The dosage will depend on the specific activity of the vaccine and can be readily determined by routine experimentation.

[0065] Polypeptides of the present invention are responsible for one or more biological functions, including one or more disease states, in particular the Diseases hereinbefore mentioned. It is therefore desirous to devise screening methods to identify compounds which stimulate or which inhibit the function of the polypeptide. Accordingly, in a further aspect, the present invention provides for a method of screening compounds to identify those which stimulate or which inhibit the function of the polypeptide. In general, agonists or antagonists may be employed for therapeutic and prophylactic purposes for such Diseases as hereinbefore mentioned. Compounds may be identified from a variety of sources, for example, cells, cell-free preparations, chemical libraries, and natural product mixtures. Such agonists, antagonists or inhibitors so-identified may be natural or modified substrates, ligands, receptors, enzymes, etc., as the case may be, of the polypeptide; or may be structural or functional mimetics thereof (see Coligan et al., Current Protocols in Immunology 1(2):Chapter 5 (1991)).

[0066] The screening method may simply measure the binding of a candidate compound to the polypeptide, or to cells or membranes bearing the polypeptide, or a fusion protein thereof by means of a label directly or indirectly associated with the candidate compound. Alternatively, the screening method may involve competition with a labeled competitor. Further, these screening methods may test whether the candidate compound results in a signal generated by activation or inhibition of the polypeptide, using detection systems appropriate to the cells bearing the polypeptide. Inhibitors of activation are generally assayed in the presence of a known agonist and the effect on activation by the agonist by the presence of the candidate compound is observed. Constitutively active polypeptides may be employed in screening methods for inverse agonists or inhibitors, in the absence of an agonist or inhibitor, by testing whether the candidate compound results in inhibition of activation of the polypeptide. Further, the screening methods may simply comprise the steps of mixing a candidate compound with a solution containing a polypeptide of the present invention, to form a mixture, measuring SBHWSB2 activity in the mixture, and comparing the SBHWSB2 activity of the mixture to a standard. Fusion proteins, such as those made from Fc portion and SBHWSB2 polypeptide, as hereinbefore described, can also be used for high-throughput screening assays to identify antagonists for the polypeptide of the present invention (see D. Bennett et al., J Mol Recognition, 8:52-58 (1995); and K. Johanson et al., J Biol Chem, 270(16):9459-9471 (1995)).

[0067] The polynucleotides, polypeptides and antibodies to the polypeptide of the present invention may also be used to configure screening methods for detecting the effect of added compounds on the production of MRNA and polypeptide in cells. For example, an ELISA assay may be constructed for measuring secreted or cell associated levels of polypeptide using monoclonal and polyclonal antibodies by standard methods known in the art. This can be used to discover agents which may inhibit or enhance the production of polypeptide (also called antagonist or agonist, respectively) from suitably manipulated cells or tissues.

[0068] The polypeptide may be used to identify membrane bound or soluble receptors, if any, through standard receptor binding techniques known in the art. These include, but are not limited to, ligand binding and crosslinking assays in which the polypeptide is labeled with a radioactive isotope (for instance, .sup.125I), chemically modified (for instance, biotinylated), or fused to a peptide sequence suitable for detection or purification, and incubated with a source of the putative receptor (cells, cell membranes, cell supernatants, tissue extracts, bodily fluids). Other methods include biophysical techniques such as surface plasmon resonance and spectroscopy. These screening methods may also be used to identify agonists and antagonists of the polypeptide which compete with the binding of the polypeptide to its receptors, if any. Standard methods for conducting such assays are well understood in the art.

[0069] Examples of potential polypeptide antagonists include antibodies or, in some cases, oligonucleotides or proteins which are closely related to the ligands, substrates, receptors, enzymes, etc., as the case may be, of the polypeptide, e.g., a fragment of the ligands, substrates, receptors, enzymes, etc.; or small molecules which bind to the polypeptide of the present invention but do not elicit a response, so that the activity of the polypeptide is prevented.

[0070] Thus, in another aspect, the present invention relates to a screening kit for identifying agonists, antagonists, ligands, receptors, substrates, enzymes, etc. for polypeptides of the present invention; or compounds which decrease or enhance the production of such polypeptides, which comprises:

[0071] (a) a polypeptide of the present invention;

[0072] (b) a recombinant cell expressing a polypeptide of the present invention;

[0073] (c) a cell membrane expressing a polypeptide of the present invention; or

[0074] (d) antibody to a polypeptide of the present invention; which polypeptide is preferably that of SEQ ID NO:2.

[0075] It will be appreciated that in any such kit, (a), (b), (c) or (d) may comprise a substantial component.

[0076] It will be readily appreciated by the skilled artisan that a polypeptide of the present invention may also be used in a method for the structure-based design of an agonist, antagonist or inhibitor of the polypeptide, by:

[0077] (a) determining in the first instance the three-dimensional structure of the polypeptide;

[0078] (b) deducing the three-dimensional structure for the likely reactive or binding site(s) of an agonist, antagonist or inhibitor;

[0079] (c) synthesing candidate compounds that are predicted to bind to or react with the deduced binding or reactive site; and

[0080] (d) testing whether the candidate compounds are indeed agonists, antagonists or inhibitors. It will be further appreciated that this will normally be an iterative process.

[0081] In a further aspect, the present invention provides methods of treating abnormal conditions such as, for instance, cancer, obesity, inflammatory disorders, heart disease, Crohn's diseases, neuropathies and immune disorders, related to either an excess of, or an under-expression of, SBHWSB2 polypeptide activity.

[0082] If the activity of the polypeptide is in excess, several approaches are available. One approach comprises administering to a subject in need thereof an inhibitor compound (antagonist) as hereinabove described, optionally in combination with a pharmaceutically acceptable carrier, in an amount effective to inhibit the function of the polypeptide, such as, for example, by blocking the binding of ligands, substrates, receptors, enzymes, etc., or by inhibiting a second signal, and thereby alleviating the abnormal condition. In another approach, soluble forms of the polypeptides still capable of binding the ligand, substrate, enzymes, receptors, etc. in competition with endogenous polypeptide may be administered. Typical examples of such competitors include fragments of the SBHWSB2 polypeptide.

[0083] In still another approach, expression of the gene encoding endogenous SBHWSB2 polypeptide can be inhibited using expression blocking techniques. Known such techniques involve the use of antisense sequences, either internally generated or externally administered (see, for example, O'Connor, J Neurochem (1991) 56:560 in Oligodeoxynucleotides as Antisense Inhibitors of Gene Expression, CRC Press, Boca Raton, Fla. (1988)). Alternatively, oligonucleotides which form triple helices ("triplexes") with the gene can be supplied (see, for example, Lee et al., Nucleic Acids Res (1979) 6:3073; Cooney et al., Science (1988) 241:456; Dervan et al., Science (1991) 251:1360). These oligomers can be administeredper se or the relevant oligomers can be expressed in vivo. Synthetic antisense or triplex oligonucleotides may comprise modified bases or modified backbones. Examples of the latter include methylphosphonate, phosphorothioate or peptide nucleic acid backbones. Such backbones are incorporated in the antisense or triplex oligonucleotide in order to provide protection from degradation by nucleases and are well known in the art. Antisense and triplex molecules synthesised with these or other modified backbones also form part of the present invention.

[0084] In addition, expression of the human SBHWSB2 polypeptide may be prevented by using ribozymes specific to the human SBHWSB2 MRNA sequence. Ribozymes are catalytically active RNAs that can be natural or synthetic (see for example Usman, N, et al., Curr. Opin. Struct. Biol (1996) 6(4), 527-33.) Synthetic ribozymes can be designed to specifically cleave human SBHWSB2 mRNAs at selected positions thereby preventing translation of the human SBHWSB2 mRNAs into functional polypeptide. Ribozymes may be synthesised with a natural ribose phosphate backbone and natural bases, as normally found in RNA molecules. Alternatively the ribosymes may be synthesised with non-natural backbones to provide protection from ribonuclease degradation, for example, 2'-O-methyl RNA, and may contain modified bases.

[0085] For treating abnormal conditions related to an under-expression of SBHWSB2 and its activity, several approaches are also available. One approach comprises administering to a subject a therapeutically effective amount of a compound which activates a polypeptide of the present invention, i.e., an agonist as described above, in combination with a pharmaceutically acceptable carrier, to thereby alleviate the abnormal condition. Alternatively, gene therapy may be employed to effect the endogenous production of SBHWSB2 by the relevant cells in the subject. For example, a polynucleotide of the invention may be engineered for expression in a replication defective retroviral vector, as discussed above. The retroviral expression construct may then be isolated and introduced into a packaging cell transduced with a retroviral plasmid vector containing RNA encoding a polypeptide of the present invention such that the packaging cell now produces infectious viral particles containing the gene of interest. These producer cells may be administered to a subject for engineering cells in vivo and expression of the polypeptide in vivo. For an overview of gene therapy, see Chapter 20, Gene Therapy and other Molecular Genetic-based Therapeutic Approaches, (and references cited therein) in Human Molecular Genetics, T Strachan and A P Read, BIOS Scientific Publishers Ltd (1996). Another approach is to administer a therapeutic amount of a polypeptide of the present invention in combination with a suitable pharmaceutical carrier.

[0086] In a further aspect, the present invention provides for pharmaceutical compositions comprising a therapeutically effective amount of a polypeptide, such as the soluble form of a polypeptide of the present invention, agonist/antagonist peptide or small molecule compound, in combination with a pharmaceutically acceptable carrier or excipient. Such carriers include, but are not limited to, saline, buffered saline, dextrose, water, glycerol, ethanol, and combinations thereof. The invention further relates to pharmaceutical packs and kits comprising one or more containers filled with one or more of the ingredients of the aforementioned compositions of the invention. Polypeptides and other compounds of the present invention may be employed alone or in conjunction with other compounds, such as therapeutic compounds.

[0087] The composition will be adapted to the route of administration, for instance by a systemic or an oral route. Preferred forms of systemic administration include injection, typically by intravenous injection. Other injection routes, such as subcutaneous, intramuscular, or intraperitoneal, can be used. Alternative means for systemic administration include transmucosal and transdermal administration using penetrants such as bile salts or fusidic acids or other detergents. In addition, if a polypeptide or other compounds of the present invention can be formulated in an enteric or an encapsulated formulation, oral administration may also be possible. Administration of these compounds may also be topical and/or localized, in the form of salves, pastes, gels, and the like.

[0088] The dosage range required depends on the choice of peptide or other compounds of the present invention, the route of administration, the nature of the formulation, the nature of the subject's condition, and the judgment of the attending practitioner. Suitable dosages, however, are in the range of 0.1-100 .mu.g/kg of subject. Wide variations in the needed dosage, however, are to be expected in view of the variety of compounds available and the differing efficiencies of various routes of administration. For example, oral administration would be expected to require higher dosages than administration by intravenous injection. Variations in these dosage levels can be adjusted using standard empirical routines for optimization, as is well understood in the art.

[0089] Polypeptides used in treatment can also be generated endogenously in the subject, in treatment modalities often referred to as "gene therapy" as described above. Thus, for example, cells from a subject may be engineered with a polynucleotide, such as a DNA or RNA, to encode a polypeptide ex vivo, and for example, by the use of a retroviral plasmid vector. The cells are then introduced into the subject.

[0090] Polynucleotide and polypeptide sequences form a valuable information resource with 30 which to identify further sequences of similar homology. This is most easily facilitated by storing the sequence in a computer readable medium and then using the stored data to search a sequence database using well known searching tools, such as GCC. Accordingly, in a further aspect, the present invention provides for a computer readable medium having stored thereon a polynucleotide comprising the sequence of SEQ ID NO: 1 and/or a polypeptide sequence encoded thereby.

[0091] The following definitions are provided to facilitate understanding of certain terms used frequently hereinbefore.

[0092] "Antibodies" as used herein includes polyclonal and monoclonal antibodies, chimeric, single chain, and humanized antibodies, as well as Fab fragments, including the products of an Fab or other immunoglobulin expression library.

[0093] "Isolated" means altered "by the hand of man" from the natural state. If an "isolated" composition or substance occurs in nature, it has been changed or removed from its original environment, or both. For example, a polynucleotide or a polypeptide naturally present in a living animal is not "isolated," but the same polynucleotide or polypeptide separated from the coexisting materials of its natural state is "isolated", as the term is employed herein.

[0094] "Polynucleotide" generally refers to any polyribonucleotide or polydeoxribonucleotide, which may be unmodified RNA or DNA or modified RNA or DNA. "Polynucleotides" include, without limitation, single- and double-stranded DNA, DNA that is a mixture of single- and double-stranded regions, single- and double-stranded RNA, and RNA that is mixture of single- and double-stranded regions, hybrid molecules comprising DNA and RNA that may be single-stranded or, more typically, double-stranded or a mixture of single- and double-stranded regions. In addition, "polynucleotide" refers to triple-stranded regions comprising RNA or DNA or both RNA and DNA. The term "polynucleotide" also includes DNAs or RNAs containing one or more modified bases and DNAs or RNAs with backbones modified for stability or for other reasons. "Modified" bases include, for example, tritylated bases and unusual bases such as inosine. A variety of modifications may be made to DNA and RNA; thus, "polynucleotide" embraces chemically, enzymatically or metabolically modified forms of polynucleotides as typically found in nature, as well as the chemical forms of DNA and RNA characteristic of viruses and cells. "Polynucleotide" also embraces relatively short polynucleotides, often referred to as oligonucleotides.

[0095] "Polypeptide" refers to any peptide or protein comprising two or more amino acids joined to each other by peptide bonds or modified peptide bonds, i.e., peptide isosteres. "Polypeptide" refers to both short chains, commonly referred to as peptides, oligopeptides or oligomers, and to longer chains, generally referred to as proteins. Polypeptides may contain amino acids other than the 20 gene-encoded amino acids. "Polypeptides" include amino acid sequences modified either by natural processes, such as post-translational processing, or by chemical modification techniques which are well known in the art. Such modifications are well described in basic texts and in more detailed monographs, as well as in a voluminous research literature. Modifications may occur anywhere in a polypeptide, including the peptide backbone, the amino acid side-chains and the amino or carboxyl termini. It will be appreciated that the same type of modification may be present to the same or varying degrees at several sites in a given polypeptide. Also, a given polypeptide may contain many types of modifications. Polypeptides may be branched as a result of ubiquitination, and they may be cyclic, with or without branching. Cyclic, branched and branched cyclic polypeptides may result from post-translation natural processes or may be made by synthetic methods. Modifications include acetylation, acylation, ADP-ribosylation, amidation, biotinylation, covalent attachment of flavin, covalent attachment of a heme moiety, covalent attachment of a nucleotide or nucleotide derivative, covalent attachment of a lipid or lipid derivative, covalent attachment of phosphotidylinositol, cross-linking, cyclization, disulfide bond formation, demethylation, formation of covalent cross-links, formation of cystine, formation of pyroglutamate, formylation, gamma-carboxylation, glycosylation, GPI anchor formation, hydroxylation, iodination, methylation, myristoylation, oxidation, proteolytic processing, phosphorylation, prenylation, racemization, selenoylation, sulfation, transfer-RNA mediated addition of amino acids to proteins such as arginylation, and ubiquitination (see, for instance, Proteins--Structure and Molecular Properties, 2nd Ed., T. E. Creighton, W. H. Freeman and Company, New York, 1993; Wold, F., Post-translational Protein Modifications: Perspectives and Prospects, pgs. 1- 12 in Post-translational Covalent Modification of Proteins, B. C. Johnson, Ed., Academic Press, New York, 1983; Seifter et al., "Analysis for protein modifications and nonprotein cofactors", Meth Enzymol (1990) 182:626-646 and Rattan et al., "Protein Synthesis: Post-translational Modifications and Aging", Ann NY Acad Sci (1992) 663:48-62).

[0096] "Variant" refers to a polynucleotide or polypeptide that differs from a reference polynucleotide or polypeptide, but retains essential properties. A typical variant of a polynucleotide differs in nucleotide sequence from another, reference polynucleotide. Changes in the nucleotide sequence of the variant may or may not alter the amino acid sequence of a polypeptide encoded by the reference polynucleotide. Nucleotide changes may result in amino acid substitutions, additions, deletions, fusions and truncations in the polypeptide encoded by the reference sequence, as discussed below. A typical variant of a polypeptide differs in amino acid sequence from another, reference polypeptide. Generally, differences are limited so that the sequences of the reference polypeptide and the variant are closely similar overall and, in many regions, identical. A variant and reference polypeptide may differ in amino acid sequence by one or more substitutions, additions, deletions in any combination. A substituted or inserted amino acid residue may or may not be one encoded by the genetic code. A variant of a polynucleotide or polypeptide may be a naturally occurring such as an allelic variant, or it may be a variant that is not known to occur naturally. Non-naturally occurring variants of polynucleotides and polypeptides may be made by mutagenesis techniques or by direct synthesis.

[0097] "Identity," as known in the art, is a relationship between two or more polypeptide sequences or two or more polynucleotide sequences, as determined by comparing the sequences. In the art, "identity" also means the degree of sequence relatedness between polypeptide or polynucleotide sequences, as the case may be, as determined by the match between strings of such sequences. "Identity" and "similarity" can be readily calculated by known methods, including but not limited to those described in (Computational Molecular Biology, Lesk, A. M., ed., Oxford University Press, New York, 1988; Biocomputing: Informatics and Genome Projects, Smith, D. W., ed., Academic Press, New York, 1993; Computer Analysis of Sequence Data, Part I, Griffin, A. M., and Griffin, H. G., eds., Humana Press, New Jersey, 1994; Sequence Analysis in Molecular Biology, von Heinje, G., Academic Press, 1987; and Sequence Analysis Primer, Gribskov, M. and Devereux, J., eds., M Stockton Press, New York, 1991; and Carillo, H., and Lipman, D., SIAM J. Applied Math., 48: 1073 (1988). Preferred methods to determine identity are designed to give the largest match between the sequences tested. Methods to determine identity and similarity are codified in publicly available computer programs. Preferred computer program methods to determine identity and similarity between two sequences include, but are not limited to, the GCG program package (Devereux, J., et al., Nucleic Acids Research 12(1): 387 (1984)), BLASTP, BLASTN, and FASTA (Atschul, S. F. et al., J. Molec. Biol. 215: 403-410 (1990). The BLAST X program is publicly available from NCBI and other sources (BLAST Manual, Altschul, S., et al., NCBI NLM NIH Bethesda, MD 20894; Altschul, S., et al., J. Mol. Biol. 215: 403-410 (1990). The well known Smith Waterman algorithm may also be used to determine identity.

[0098] Preferred parameters for polypeptide sequence comparison include the following:

[0099] 1) Algorithm: Needleman and Wunsch, J. Mol Biol. 48: 443-453 (1970) Comparison matrix: BLOSSUM62 from Hentikoff and Hentikoff, Proc. Natl. Acad. Sci. USA. 89:10915-10919 (1992)

[0100] Gap Penalty: 12

[0101] Gap Length Penalty: 4

[0102] A program useful with these parameters is publicly available as the "gap" program from Genetics Computer Group, Madison Wis. The aforementioned parameters are the default parameters for peptide comparisons (along with no penalty for end gaps).

[0103] Preferred parameters for polynucleotide comparison include the following:

[0104] 1) Algorithm: Needleman and Wunsch, J. Mol Biol. 48: 443-453 (1970)

[0105] Comparison matrix: matches =+10, mismatch =0

[0106] Gap Penalty: 50

[0107] Gap Length Penalty: 3

[0108] Available as: The "gap" program from Genetics Computer Group, Madison Wis. These are the default parameters for nucleic acid comparisons.

[0109] By way of example, a polynucleotide sequence of the present invention may be identical to the reference sequence of SEQ ID NO: 1, that is be 100% identical, or it may include up to a certain integer number of nucleotide alterations as compared to the reference sequence. Such alterations are selected from the group consisting of at least one nucleotide deletion, substitution, including transition and transversion, or insertion, and wherein said alterations may occur at the 5' or 3' terminal positions of the reference nucleotide sequence or anywhere between those terminal positions, interspersed either individually among the nucleotides in the reference sequence or in one or more contiguous groups within the reference sequence. The number of nucleotide alterations is determined by multiplying the total number of nucleotides in SEQ ID NO: 1 by the numerical percent of the respective percent identity(divided by 100) and subtracting that product from said total number of nucleotides in SEQ ID NO: 1, or:

n.sub.n.ltoreq.x.sub.n-(x.sub.n.multidot.y)

[0110] wherein n.sub.n is the number of nucleotide alterations, x.sub.n is the total number of nucleotides in SEQ ID NO: 1, and y is, for instance, 0.70 for 70%, 0.80 for 80%, 0.85 for 85%, 0.90 for 90%, 0.95 for 95%,etc., and wherein any non-integer product of x.sub.n and y is rounded down to the nearest integer prior to subtracting it from x.sub.n. Alterations of a polynucleotide sequence encoding the polypeptide of SEQ ID NO:2 may create nonsense, missense or frameshift mutations in this coding sequence and thereby alter the polypeptide encoded by the polynucleotide following such alterations.

[0111] Similarly, a polypeptide sequence of the present invention may be identical to the reference sequence of SEQ ID NO:2, that is be 100% identical, or it may include up to a certain integer number of amino acid alterations as compared to the reference sequence such that the % identity is less than 100%. Such alterations are selected from the group consisting of at least one amino acid deletion, substitution, including conservative and non-conservative substitution, or insertion, and wherein said alterations may occur at the amino- or carboxy-terminal positions of the reference polypeptide sequence or anywhere between those terminal positions, interspersed either individually among the amino acids in the reference sequence or in one or more contiguous groups within the reference sequence. The number of amino acid alterations for a given % identity is determined by multiplying the total number of amino acids in SEQ ID NO:2 by the numerical percent of the respective percent identity(divided by 100) and then subtracting that product from said total number of amino acids in SEQ ID NO:2, or:

n.sub.a.ltoreq.x.sub.a-(x.sub.a.multidot.y),

[0112] wherein n.sub.a is the number of amino acid alterations, x.sub.a is the total number of amino acids in SEQ ID NO:2, and y is, for instance 0.70 for 70%, 0.80 for 80%, 0.85 for 85% etc., and wherein any non-integer product of x.sub.a and y is rounded down to the nearest integer prior to subtracting it from x.sub.a.

[0113] "Homolog" is a generic term used in the art to indicate a polynucleotide or polypeptide sequence possessing a high degree of sequence relatedness to a subject sequence. Such relatedness may be quantified by determining the degree of identity and/or similarity between the sequences being compared as hereinbefore described. Falling within this generic term are the terms "ortholog", meaning a polynucleotide or polypeptide that is the functional equivalent of a polynucleotide or polypeptide in another species, and "paralog" meaning a functionally similar sequence when considered within the same species.

[0114] "Fusion protein" refers to a protein encoded by two, often unrelated, fused genes or fragments thereof. In one example, EP-A-0 464 discloses fusion proteins comprising various portions of constant region of immunoglobulin molecules together with another human protein or part thereof. In many cases, employing an immunoglobulin Fc region as a part of a fusion protein is advantageous for use in therapy and diagnosis resulting in, for example, improved pharmacokinetic properties [see, e.g., EP-A 0232 262]. On the other hand, for some uses it would be desirable to be able to delete the Fc part after the fusion protein has been expressed, detected and purified.

[0115] All publications, including but not limited to patents and patent applications, cited in this specification are herein incorporated by reference as if each individual publication were specifically and individually indicated to be incorporated by reference herein as though fully set forth.

1 SEQUENCE INFORMATION SEQ ID NO: 1 CTTGGCACGAGGCCTCGTGCCAGGCGGCATGAGGGCCCGCGGCCCGGGGGGCTGAGGCGCCCGCCG- CCT GCCGCGGGGGCCGCTCGCGTCCTCCATGGAGGCCGGAGAGGAACCGCTGCTGCT- GGCCGAACTCAAGCC CGGGCGCCCCCACCAGTTTGATTGGAAGTCCAGCTGTGAAAC- CTGGAGCGTCGCCTTCTCCCCAGATGG CTCCTGGTTTGCTTGGTCTCAAGGACACTG- CATCGTCAAACTGATCCCCTGGCCGTTGGAGGAGCAGTT CATCCCTAAAGGGTTTGAAGCCAAAAGCCGAAGTAGCAAAAATGAGACGAAAGGGCGGGGCAGCCCAAA AGAGAAGACGCTGGACTGTGGTCAGATTGTCTGGGGGCTGGCCTTCAGCCCGTGGCCTTCC- CCACCCAG CAGGAAGCTCTGGGCACGCCACCACCCCCAAGTGCCCGATGTCTCTTGC- CTGGTTCTTGCTACGGGACT CAACGATGGGCAGATCAAGATCTGGGAGGTGCAGACA- GGGCTCCTGCTTTTGAATCTTTCCGGCCACCA AGATGTCGTGAGAGATCTGAGCTTC- ACACCCAGTGGCAGTTTGATTTTGGTCTCCGCGTCACGGGATAA GACTCTTCGCATCTGGGACCTGAATAAACACGGTAAACAGATTCAAGTGTTATCGGGCCACCTGCAGTG GGTTTACTGCTGTTCCATCTCCCCAGACTGCAGCATGCTGTGCTCTGCAGCTGGAGAGAAG- TCGGTCTT TCTATGGAGCATGAGGTCCTACACGTTAATTCGGAAGCTAGAGGGCCAT- CAAAGCAGTGTTGTCTCTTG TGACTTCTCCCCCGACTCTGCCCTGCTTGTCACGGCT- TCTTACGATACCAATGTGATTATGTGGGACCC CTACACCGGCGAAAGGCTGAGGTCA- CTCCACCACACCCAGGTTGACCCCGCTATGGATGACAGTGACGT CCACATTAGCTCACTGAGATCTGTGTGCTTCTCTCCAGAAGGCTTGTACCTTGCCACGGTGGCAGATGA CAGACTCCTCAGGATCTGGGCCCTGGAACTGAAAACTCCCATTGCATTTGCTCCTATGACC- AATGGGCT TTGCTGCACATTTTTTCCACATGGTGGAGTCATTGCCACAGGGACAAGA- GATGGCCACGTCCAGTTCTG GACAGCTCCTAGGGTCCTGTCCTCACTGAAGCACTTA- TGCCGGAAAGCCCTTCGAAGTTTCCTAACAAC TTACCAAGTCCTAGCACTGCCAATC- CCCAAGAAAATGAAAGAGTTCCTCACATACAGGACTTTTTAAGC AACACCACATCTTGTGCTTCTTTGTAGCAGGGTAAATCGTCCTGTCAAAGGGAGTTGCTGGAATAATGG GCCAAACATCTGGTCTTGCATTGAAATAGCATTTCTTTGGGATTGTGAATAGAATGTAGCA- AAACCAGA TTCCAGTGTACTAGTCATGGATCTTTCTCTCCCTGGCATGTGAAAGTCA- GTCTTAGAGGAAGAGATTCC ACTTGCACGGCAACAGAGCCTTACGTTAAATTTTCAG- TCCAGTTATGAACAGCAAGTGTTGAACTCTTT CTGCTTGTTTTGATTCAAAGTGCAG- TTACTGATGTTGTTTTGATTATGCAACTAAGTAGGCCTCCAGAG CCTCTCTAGTGGCAGAGCAGCTCACACTCCCTCCGCTGGGAACGATGGCTTCTGCCTAGTACCTATCCT TGTGTTTCTGATGCAGTGGTAGCATTGGTTCAAGTTCTCTCCTGCTGTGGTCAGAGTTGCT- TCGATGTT GGCCAAGTGCTTTTCTTCTTGGGCTCCCTTCTGACCTGCAGGACAGTTT- TCCTGGAGCCATTTGGTATG AGGTATTAATTTAGCTTAACTAAATTACAGGGGACTC- AGAGGCCGTGCTCCTGACCGATCCAGACACTA TTACTGGCTTTTTTTTTTTTTTTTT- TAACAATGGTGTGCATGTGCAGGAAATGACAAATTTGTATGTCA GATTATACAAGGATGTATTCTTAAACCGCATGACTATTCAGATGGCTACTGAGTTATCAGTGGCCATTT ATTAGCATCATATTTATTTGTATTTTCTCAACAGATGTTAAGGTACAACTGTGTTTTTCTC- GATTATCT AAAAACCATAGTACTTAAATTGAAAAAAAAAAAAAAAAAAAAAAAAA SEQ ID NO: 2 MEAGEEPLLLAELKPGRPHQFDWKSSCETWSVAFSPDGS- WFAWSQGHCIVKLIPWPLEEQFIPKGFEAK SRSSKNETKGRGSPKEKTLDCGQIVWG- LAFSPWPSPPSRKLWARHHPQVPDVSCLVLATGLNDGQIKIW EVQTGLLLLNLSGHQDVVRDLSFTPSGSLILVSASRDKTLRIWDLNKHGKQIQVLSGHLQWVYCCSISP DCSMLCSAAGEKSVFLWSMRSYTLIRKLEGHQSSVVSCDFSPDSALLVTASYDTNVIMWDP- YTGERLRS LHHTQVDPAMDDSDVHISSLRSVCFSPEGLYLATVADDRLLRIWALELK- TPIAFAPMTNGLCCTFFPHG GVIATGTRDGHVQFWTAPRVLSSLKHLCRKALRSFLT- TYQVLALPIPKKMKEFLTYRTF SEQ ID NO: 3 GAAAGGAACCGCTGCTGCTGGCCGAACTCAAGCCCGGGCGCCCCCACCAGTTTGATTGGAAGTCCAGCT GTGAAACCTGGAGCGTCGCCTTCTCCCCAGATGGCTCCTGGTTTGCTTGGTCTCAAGGACA- CTGCATCG TCAAACTNATCCCCTGGCCGTTNGAGGAGCAGTTCATCCNTAAAGGGTT- TGAAGCCAAAAGCCGAAGTA GCAAAAATGAGACGAAAGGGCGGGGNAGTCCAAAAGA- GAAGACGCTNGACTGTGGTCAGATTGTCTGGG GGCTGGCCTTCAGCCTGTGNCTTTC- CCCACCCAGCAGGAAGCTCTGGGCACGCCACCACCCCCAAGTGC CCGATGTCTCTTGCCTGGTTCTTGCTACGGGACTCCACGATGGGCAGATCAAGATCTGGGAGGTGCAGA CAGGGCTCCTGCTTTTGAATCTTTCCGGCCACCAAGATGTCGTGAGAGATCTGAGCTTCAC- ACCCAGTG GCAGTTTGATTTTGGTCTCCGCGTCACGGGATAAGACTCTTCGCATCTG- GGACCTGAATAAACACGGTA AACAGATTCAAGTGTTATCGGGCCACCTGCAGTGGGT- TTACTGCTGTTCCATCTCCCCAGACTGCAGCA TGCTGTGCTCTGCAGCTGGAGAGAA- GTCGGTCTTTCTATGGAGCATGAGGTCCTACACGTTAATTCGGA AGCTAGAGGGCCATCAAAGCAGTGTTGTCTCTTGTGACTTCTCCCCCGACTCTGCCCTGCTTGTCACGG CTTCTTACGATACCAATGTGATTATGTGGGACCCCTACACCGGCGAAAGGCTGAGGTCACT- CCACCACA CCCAGGTTGACCCCGCCATGGATGACAGTGACGTCCACATTAGCTCACT- GAGATCTGTGTGCTTCTCTC CAGAAGGCTTGTACCTTGCCACGGTGGCAGATGACAG- ACTCCTCAGGATCTGGGCCCTGGAACTGAAAA CTCCCATTGCATTTGCTCCTATGAC- CAATGGGCTTTGCTGCACATTTTTTCCACATGGTGGAGTCATTG CCACAGGGACAAGAGATGGCCACGTCCAGTTCTGGACAGCTCCTAGGGTCCTGTCCTCACTGAAGCACT TATGCCGGAAAGCCCTTCGAAGTTTCCTAACAACTTACCAAGTCCTAGCACTGCCAATCCC- CAAGAAAA TGAAAGAGTTCCTCACATACAGGACTTTTTAAGCAACACCACATCTTGT- GCTTCTTTGTAGCAGGGTAA ATCGTCCTGTCAAAGGGAGTTGCTGGAATAATGGGCC- AAACATCTGGTCTTGCATTGAAATAGCATTTC TTTGGGATTGTGAATAGAATGTAGC- AAAACCAGATTCCAGTGTACTAGTCATGGATCTTTCTCTCCCTG GCATGTGAAAGTCAGTCTTAGAGGAAGAGATTCCACTTGCACGGCAACAGAGCCTTACGTTAAATTTTC AGTCCAGTTATGAACAGCAAGTGTTGAACTCTTTCTGCTTGTTTTGATTCAAAGTGCAGTT- ACTGATGT TGTTTTGATTATGCAACTAAGTAGGCCTCCAGAGCCTCTCTAGTGGCAG- AGCAGCTCACACTCCCTCCG CTGGGAACGATGGCTTCTGCCTAGTACCTATCCTTGT- GTTTCTGATGCAGTGGTAGCATTGGTTCAAGT TCTCTCCTGCTGTGGTCAGAGTTGC- TTCGATGTTGGCCAAGTGCTTTTCTTCTTGGGCTCCCTTCTGAC CTGCAGGACAGTTTTCCTGGAGCCATTTGGTATGAGGTATTAATTTAGCTTAACTAAATTACAGGGGAC TCAGAGGCCGTGCTCCTGACCGATCCAGACACTATTACTGGCTTTTTTTTTTTTTTTTTAA- CAATGGTG TGCATGTGCAGGAAATGACAAATTTGTATGTCAGATTATACAAGGATGT- ATTCTTAAACCGCATGACTA TTCAGATGGCTACTGAGTTATCAGTGGCCATTTATTA- GCATCATATTTATTTGTATTTTCTCAACAGAT GTTAAGGTACAACTGTGTTTTTCTC- GATTATCTAAAAACCATAGTACTTAAATTGAACAGTTGCAAAGA TGTCTTAATTGTGTAAAGAATTGGTGTAGTCATGACTTTAGCTGATACTCTTATGTACGAGATCTGTCT CTGCTGTTTAACTTCATTGGATTAATCAGCTGGTTTCAACTCTACTGCGAAACAAAAATAG- CTCCTTAA AGGAAAATTTAATATATTTTAAATTATTTTAAAAGAAATACAACATCTT- ATTCTTTAGCTTTCTTAATC GGTGCTTTATGGAGGCCAGTGTAACGTTACATGACTC- GTTGAGAAAGTTGAGGAATTTCCTCTACCACC TTTGTTGCTTGAAGAAAAACATGTC- TTTTCAAAATGAGAGGCTTTCATTGAAGAAAAGAAAAAAACAAC AGTTAAAAGCTATTGGCTCTCTGTTTCATTTTTTTCCATTAAGAAAAAAAAAAGTCCCCTTTTAAAACA AGCAG SEQ ID NO: 4 KEPLLLAELKPGRPHQFDWKSSCETWSVAFSPDGSWFAWSQGHCIVKLIPWPXEEQFIXKGFEAKSRSS KNETKGRGSPKEKTLDCGQIVWGLAFSLXLSPPSRKLWARHHPQVPDVSCLVLATGLHDGQ- IKIWEVQT GLLLLNLSGHQDVVRDLSFTPSGSLILVSASRDKTLRIWDLNKHGKQIQ- VLSGHLQWVYCCSISPDCSM LCSAAGEKSVFLWSMRSYTLIRKLEGHQSSVVSCDFS- PDSALLVTASYDTNVIMWDPYTGERLRSLHHT QVDPAMDDSDVHISSLRSVCFSPEG- LYLATVADDRLLRIWALELKTPIAFAPMTNGLCCTFFPHGGVIA TGTRDGHVQFWTAPRVLSSLKHLCRKALRSFLTTYQVLALPIPKKMKEFLTYRTF

[0116]

Sequence CWU 1

1

4 1 2186 DNA HOMO SAPIENS 1 cttggcacga ggcctcgtgc caggcggcat gagggcccgc ggcccggggg gctgaggcgc 60 ccgccgcctg ccgcgggggc cgctcgcgtc ctccatggag gccggagagg aaccgctgct 120 gctggccgaa ctcaagcccg ggcgccccca ccagtttgat tggaagtcca gctgtgaaac 180 ctggagcgtc gccttctccc cagatggctc ctggtttgct tggtctcaag gacactgcat 240 cgtcaaactg atcccctggc cgttggagga gcagttcatc cctaaagggt ttgaagccaa 300 aagccgaagt agcaaaaatg agacgaaagg gcggggcagc ccaaaagaga agacgctgga 360 ctgtggtcag attgtctggg ggctggcctt cagcccgtgg ccttccccac ccagcaggaa 420 gctctgggca cgccaccacc cccaagtgcc cgatgtctct tgcctggttc ttgctacggg 480 actcaacgat gggcagatca agatctggga ggtgcagaca gggctcctgc ttttgaatct 540 ttccggccac caagatgtcg tgagagatct gagcttcaca cccagtggca gtttgatttt 600 ggtctccgcg tcacgggata agactcttcg catctgggac ctgaataaac acggtaaaca 660 gattcaagtg ttatcgggcc acctgcagtg ggtttactgc tgttccatct ccccagactg 720 cagcatgctg tgctctgcag ctggagagaa gtcggtcttt ctatggagca tgaggtccta 780 cacgttaatt cggaagctag agggccatca aagcagtgtt gtctcttgtg acttctcccc 840 cgactctgcc ctgcttgtca cggcttctta cgataccaat gtgattatgt gggaccccta 900 caccggcgaa aggctgaggt cactccacca cacccaggtt gaccccgcta tggatgacag 960 tgacgtccac attagctcac tgagatctgt gtgcttctct ccagaaggct tgtaccttgc 1020 cacggtggca gatgacagac tcctcaggat ctgggccctg gaactgaaaa ctcccattgc 1080 atttgctcct atgaccaatg ggctttgctg cacatttttt ccacatggtg gagtcattgc 1140 cacagggaca agagatggcc acgtccagtt ctggacagct cctagggtcc tgtcctcact 1200 gaagcactta tgccggaaag cccttcgaag tttcctaaca acttaccaag tcctagcact 1260 gccaatcccc aagaaaatga aagagttcct cacatacagg actttttaag caacaccaca 1320 tcttgtgctt ctttgtagca gggtaaatcg tcctgtcaaa gggagttgct ggaataatgg 1380 gccaaacatc tggtcttgca ttgaaatagc atttctttgg gattgtgaat agaatgtagc 1440 aaaaccagat tccagtgtac tagtcatgga tctttctctc cctggcatgt gaaagtcagt 1500 cttagaggaa gagattccac ttgcacggca acagagcctt acgttaaatt ttcagtccag 1560 ttatgaacag caagtgttga actctttctg cttgttttga ttcaaagtgc agttactgat 1620 gttgttttga ttatgcaact aagtaggcct ccagagcctc tctagtggca gagcagctca 1680 cactccctcc gctgggaacg atggcttctg cctagtacct atccttgtgt ttctgatgca 1740 gtggtagcat tggttcaagt tctctcctgc tgtggtcaga gttgcttcga tgttggccaa 1800 gtgcttttct tcttgggctc ccttctgacc tgcaggacag ttttcctgga gccatttggt 1860 atgaggtatt aatttagctt aactaaatta caggggactc agaggccgtg ctcctgaccg 1920 atccagacac tattactggc tttttttttt ttttttttaa caatggtgtg catgtgcagg 1980 aaatgacaaa tttgtatgtc agattataca aggatgtatt cttaaaccgc atgactattc 2040 agatggctac tgagttatca gtggccattt attagcatca tatttatttg tattttctca 2100 acagatgtta aggtacaact gtgtttttct cgattatcta aaaaccatag tacttaaatt 2160 gaaaaaaaaa aaaaaaaaaa aaaaaa 2186 2 404 PRT HOMO SAPIENS 2 Met Glu Ala Gly Glu Glu Pro Leu Leu Leu Ala Glu Leu Lys Pro Gly 1 5 10 15 Arg Pro His Gln Phe Asp Trp Lys Ser Ser Cys Glu Thr Trp Ser Val 20 25 30 Ala Phe Ser Pro Asp Gly Ser Trp Phe Ala Trp Ser Gln Gly His Cys 35 40 45 Ile Val Lys Leu Ile Pro Trp Pro Leu Glu Glu Gln Phe Ile Pro Lys 50 55 60 Gly Phe Glu Ala Lys Ser Arg Ser Ser Lys Asn Glu Thr Lys Gly Arg 65 70 75 80 Gly Ser Pro Lys Glu Lys Thr Leu Asp Cys Gly Gln Ile Val Trp Gly 85 90 95 Leu Ala Phe Ser Pro Trp Pro Ser Pro Pro Ser Arg Lys Leu Trp Ala 100 105 110 Arg His His Pro Gln Val Pro Asp Val Ser Cys Leu Val Leu Ala Thr 115 120 125 Gly Leu Asn Asp Gly Gln Ile Lys Ile Trp Glu Val Gln Thr Gly Leu 130 135 140 Leu Leu Leu Asn Leu Ser Gly His Gln Asp Val Val Arg Asp Leu Ser 145 150 155 160 Phe Thr Pro Ser Gly Ser Leu Ile Leu Val Ser Ala Ser Arg Asp Lys 165 170 175 Thr Leu Arg Ile Trp Asp Leu Asn Lys His Gly Lys Gln Ile Gln Val 180 185 190 Leu Ser Gly His Leu Gln Trp Val Tyr Cys Cys Ser Ile Ser Pro Asp 195 200 205 Cys Ser Met Leu Cys Ser Ala Ala Gly Glu Lys Ser Val Phe Leu Trp 210 215 220 Ser Met Arg Ser Tyr Thr Leu Ile Arg Lys Leu Glu Gly His Gln Ser 225 230 235 240 Ser Val Val Ser Cys Asp Phe Ser Pro Asp Ser Ala Leu Leu Val Thr 245 250 255 Ala Ser Tyr Asp Thr Asn Val Ile Met Trp Asp Pro Tyr Thr Gly Glu 260 265 270 Arg Leu Arg Ser Leu His His Thr Gln Val Asp Pro Ala Met Asp Asp 275 280 285 Ser Asp Val His Ile Ser Ser Leu Arg Ser Val Cys Phe Ser Pro Glu 290 295 300 Gly Leu Tyr Leu Ala Thr Val Ala Asp Asp Arg Leu Leu Arg Ile Trp 305 310 315 320 Ala Leu Glu Leu Lys Thr Pro Ile Ala Phe Ala Pro Met Thr Asn Gly 325 330 335 Leu Cys Cys Thr Phe Phe Pro His Gly Gly Val Ile Ala Thr Gly Thr 340 345 350 Arg Asp Gly His Val Gln Phe Trp Thr Ala Pro Arg Val Leu Ser Ser 355 360 365 Leu Lys His Leu Cys Arg Lys Ala Leu Arg Ser Phe Leu Thr Thr Tyr 370 375 380 Gln Val Leu Ala Leu Pro Ile Pro Lys Lys Met Lys Glu Phe Leu Thr 385 390 395 400 Tyr Arg Thr Phe 3 2558 DNA HOMO SAPIENS UNSURE (146)(161)(178)(233)(254)(296) 3 gaaaggaacc gctgctgctg gccgaactca agcccgggcg cccccaccag tttgattgga 60 agtccagctg tgaaacctgg agcgtcgcct tctccccaga tggctcctgg tttgcttggt 120 ctcaaggaca ctgcatcgtc aaactnatcc cctggccgtt ngaggagcag ttcatccnta 180 aagggtttga agccaaaagc cgaagtagca aaaatgagac gaaagggcgg ggnagtccaa 240 aagagaagac gctngactgt ggtcagattg tctgggggct ggccttcagc ctgtgncttt 300 ccccacccag caggaagctc tgggcacgcc accaccccca agtgcccgat gtctcttgcc 360 tggttcttgc tacgggactc cacgatgggc agatcaagat ctgggaggtg cagacagggc 420 tcctgctttt gaatctttcc ggccaccaag atgtcgtgag agatctgagc ttcacaccca 480 gtggcagttt gattttggtc tccgcgtcac gggataagac tcttcgcatc tgggacctga 540 ataaacacgg taaacagatt caagtgttat cgggccacct gcagtgggtt tactgctgtt 600 ccatctcccc agactgcagc atgctgtgct ctgcagctgg agagaagtcg gtctttctat 660 ggagcatgag gtcctacacg ttaattcgga agctagaggg ccatcaaagc agtgttgtct 720 cttgtgactt ctcccccgac tctgccctgc ttgtcacggc ttcttacgat accaatgtga 780 ttatgtggga cccctacacc ggcgaaaggc tgaggtcact ccaccacacc caggttgacc 840 ccgccatgga tgacagtgac gtccacatta gctcactgag atctgtgtgc ttctctccag 900 aaggcttgta ccttgccacg gtggcagatg acagactcct caggatctgg gccctggaac 960 tgaaaactcc cattgcattt gctcctatga ccaatgggct ttgctgcaca ttttttccac 1020 atggtggagt cattgccaca gggacaagag atggccacgt ccagttctgg acagctccta 1080 gggtcctgtc ctcactgaag cacttatgcc ggaaagccct tcgaagtttc ctaacaactt 1140 accaagtcct agcactgcca atccccaaga aaatgaaaga gttcctcaca tacaggactt 1200 tttaagcaac accacatctt gtgcttcttt gtagcagggt aaatcgtcct gtcaaaggga 1260 gttgctggaa taatgggcca aacatctggt cttgcattga aatagcattt ctttgggatt 1320 gtgaatagaa tgtagcaaaa ccagattcca gtgtactagt catggatctt tctctccctg 1380 gcatgtgaaa gtcagtctta gaggaagaga ttccacttgc acggcaacag agccttacgt 1440 taaattttca gtccagttat gaacagcaag tgttgaactc tttctgcttg ttttgattca 1500 aagtgcagtt actgatgttg ttttgattat gcaactaagt aggcctccag agcctctcta 1560 gtggcagagc agctcacact ccctccgctg ggaacgatgg cttctgccta gtacctatcc 1620 ttgtgtttct gatgcagtgg tagcattggt tcaagttctc tcctgctgtg gtcagagttg 1680 cttcgatgtt ggccaagtgc ttttcttctt gggctccctt ctgacctgca ggacagtttt 1740 cctggagcca tttggtatga ggtattaatt tagcttaact aaattacagg ggactcagag 1800 gccgtgctcc tgaccgatcc agacactatt actggctttt tttttttttt tttaacaatg 1860 gtgtgcatgt gcaggaaatg acaaatttgt atgtcagatt atacaaggat gtattcttaa 1920 accgcatgac tattcagatg gctactgagt tatcagtggc catttattag catcatattt 1980 atttgtattt tctcaacaga tgttaaggta caactgtgtt tttctcgatt atctaaaaac 2040 catagtactt aaattgaaca gttgcaaaga tgtcttaatt gtgtaaagaa ttggtgtagt 2100 catgacttta gctgatactc ttatgtacga gatctgtctc tgctgtttaa cttcattgga 2160 ttaatcagct ggtttcaact ctactgcgaa acaaaaatag ctccttaaaa gtactgttct 2220 ccttcagtgg catgtagtta tctaatcaag acacctcatt caaacaaaac ctgccttagg 2280 aaaatttaat atattttaaa ttattttaaa agaaatacaa catcttattc tttagctttc 2340 ttaatcggtg ctttatggag gccagtgtaa cgttacatga ctcgttgaga aagttgagga 2400 atttcctcta ccacctttgt tgcttgaaga aaaacatgtc ttttcaaaat gagaggcttt 2460 cattgaagaa aagaaaaaaa caacagttaa aagctattgg ctctctgttt catttttttc 2520 cattaagaaa aaaaaaagtc cccttttaaa acaagcag 2558 4 400 PRT HOMO SAPIENS UNSURE (53)(59)(98) 4 Lys Glu Pro Leu Leu Leu Ala Glu Leu Lys Pro Gly Arg Pro His Gln 1 5 10 15 Phe Asp Trp Lys Ser Ser Cys Glu Thr Trp Ser Val Ala Phe Ser Pro 20 25 30 Asp Gly Ser Trp Phe Ala Trp Ser Gln Gly His Cys Ile Val Lys Leu 35 40 45 Ile Pro Trp Pro Xaa Glu Glu Gln Phe Ile Xaa Lys Gly Phe Glu Ala 50 55 60 Lys Ser Arg Ser Ser Lys Asn Glu Thr Lys Gly Arg Gly Ser Pro Lys 65 70 75 80 Glu Lys Thr Leu Asp Cys Gly Gln Ile Val Trp Gly Leu Ala Phe Ser 85 90 95 Leu Xaa Leu Ser Pro Pro Ser Arg Lys Leu Trp Ala Arg His His Pro 100 105 110 Gln Val Pro Asp Val Ser Cys Leu Val Leu Ala Thr Gly Leu His Asp 115 120 125 Gly Gln Ile Lys Ile Trp Glu Val Gln Thr Gly Leu Leu Leu Leu Asn 130 135 140 Leu Ser Gly His Gln Asp Val Val Arg Asp Leu Ser Phe Thr Pro Ser 145 150 155 160 Gly Ser Leu Ile Leu Val Ser Ala Ser Arg Asp Lys Thr Leu Arg Ile 165 170 175 Trp Asp Leu Asn Lys His Gly Lys Gln Ile Gln Val Leu Ser Gly His 180 185 190 Leu Gln Trp Val Tyr Cys Cys Ser Ile Ser Pro Asp Cys Ser Met Leu 195 200 205 Cys Ser Ala Ala Gly Glu Lys Ser Val Phe Leu Trp Ser Met Arg Ser 210 215 220 Tyr Thr Leu Ile Arg Lys Leu Glu Gly His Gln Ser Ser Val Val Ser 225 230 235 240 Cys Asp Phe Ser Pro Asp Ser Ala Leu Leu Val Thr Ala Ser Tyr Asp 245 250 255 Thr Asn Val Ile Met Trp Asp Pro Tyr Thr Gly Glu Arg Leu Arg Ser 260 265 270 Leu His His Thr Gln Val Asp Pro Ala Met Asp Asp Ser Asp Val His 275 280 285 Ile Ser Ser Leu Arg Ser Val Cys Phe Ser Pro Glu Gly Leu Tyr Leu 290 295 300 Ala Thr Val Ala Asp Asp Arg Leu Leu Arg Ile Trp Ala Leu Glu Leu 305 310 315 320 Lys Thr Pro Ile Ala Phe Ala Pro Met Thr Asn Gly Leu Cys Cys Thr 325 330 335 Phe Phe Pro His Gly Gly Val Ile Ala Thr Gly Thr Arg Asp Gly His 340 345 350 Val Gln Phe Trp Thr Ala Pro Arg Val Leu Ser Ser Leu Lys His Leu 355 360 365 Cys Arg Lys Ala Leu Arg Ser Phe Leu Thr Thr Tyr Gln Val Leu Ala 370 375 380 Leu Pro Ile Pro Lys Lys Met Lys Glu Phe Leu Thr Tyr Arg Thr Phe 385 390 395 400

Claims

What is claimed is:

1. An isolated polypeptide selected from the group consisting of: (i) an isolated polypeptide comprising an amino acid sequence selected from the group having at least: (a) 97% identity; or (b) 99% identity to the amino acid sequence of SEQ ID NO:2 over the entire length of SEQ ID NO:2; (ii) an isolated polypeptide comprising the amino acid sequence of SEQ ID NO:2 or (iii) an isolated polypeptide which is the amino acid sequence of SEQ ID NO:2.

2. An isolated polynucleotide selected from the group consisting of: (i) an isolated polynucleotide comprising a nucleotide sequence encoding a polypeptide that has at least (a) 97% identity; or (b) 99% identity; to the amino acid sequence of SEQ ID NO:2, over the entire length of SEQ ID NO:2; (ii) an isolated polynucleotide comprising a nucleotide sequence that has at least: (a) 90% identity; or (b) 95% identity; over its entire length to a nucleotide sequence encoding the polypeptide of SEQ ID NO:2; (iii) an isolated polynucleotide comprising a nucleotide sequence which has at least: (a) 90% identity; or (b) 95% identity; to that of SEQ ID NO: 1 over the entire length of SEQ ID NO:1; (iv) an isolated polynucleotide comprising a nucleotide sequence encoding the polypeptide of SEQ ID NO:2; (v) an isolated polynucleotide which is the polynucleotide of SEQ ID NO: 1; or (vi) an isolated polynucleotide obtainable by screening an appropriate library under stringent hybridization conditions with a labeled probe having the sequence of SEQ ID NO: 1 or a fragment thereof; or a nucleotide sequence complementary to said isolated polynucleotide.

3. An antibody immunospecific for the polypeptide of claim 1.

4. A method for the treatment of a subject: (i) in need of enhanced activity or expression of the polypeptide of claim 1 comprising: (a) administering to the subject a therapeutically effective amount of an agonist to said polypeptide; and/or (b) providing to the subject an isolated polynucleotide comprising a nucleotide sequence encoding said polypeptide in a form so as to effect production of said polypeptide activity in vivo.; or (ii) having need to inhibit activity or expression of the polypeptide of claim 1 comprising: (a) administering to the subject a therapeutically effective amount of an antagonist to said polypeptide; and/or (b) administering to the subject a nucleic acid molecule that inhibits the expression of a nucleotide sequence encoding said polypeptide; and/or (c) administering to the subject a therapeutically effective amount of a polypeptide that competes with said polypeptide for its ligand, substrate, or receptor.

5. A process for diagnosing a disease or a susceptibility to a disease in a subject related to expression or activity of the polypeptide of claim 1 in a subject comprising: (a) determining the presence or absence of a mutation in the nucleotide sequence encoding said polypeptide in the genome of said subject; and/or (b) analyzing for the presence or amount of said polypeptide expression in a sample derived from said subject.

6. A method for screening to identify compounds which stimulate or which inhibit the function of the polypeptide of claim 1 which comprises a method selected from the group consisting of: (a) measuring the binding of a candidate compound to the polypeptide (or to the cells or membranes bearing the polypeptide) or a fusion protein thereof by means of a label directly or indirectly associated with the candidate compound; (b) measuring the binding of a candidate compound to the polypeptide (or to the cells or membranes bearing the polypeptide) or a fusion protein thereof in the presence of a labeled competitor; (c) testing whether the candidate compound results in a signal generated by activation or inhibition of the polypeptide, using detection systems appropriate to the cells or cell membranes bearing the polypeptide; (d) mixing a candidate compound with a solution containing a polypeptide of claim 1, to form a mixture, measuring activity of the polypeptide in the mixture, and comparing the activity of the mixture to a standard; or (e) detecting the effect of a candidate compound on the production of MRNA encoding said polypeptide and said polypeptide in cells, using for instance, an ELISA assay.

7. An agonist or an antagonist of the polypeptide of claim 1.

8. An expression system comprising a polynucleotide capable of producing a polypeptide of claim 1 when said expression system is present in a compatible host cell.

9. A process for producing a recombinant host cell comprising transforming or transfecting a cell with the expression system of claim 8 such that the host cell, under appropriate culture conditions, produces a polypeptide comprising an amino acid sequence having at least 97% identity to the amino acid sequence of SEQ ID NO:2 over the entire length of SEQ ID NO:2.

10. A recombinant host cell produced by the process of claim 9.

11. A membrane of a recombinant host cell of claim 10 expressing a polypeptide comprising an amino acid sequence having at least 97% identity to the amino acid sequence of SEQ ID NO:2 over the entire length of SEQ ID NO:2.

12. A process for producing a polypeptide comprising culturing a host cell of claim 10 under conditions sufficient for the production of said polypeptide and recovering the polypeptide from the culture.

13. An isolated polynucleotide selected form the group consisting of: (a) an isolated polynucleotide comprising a nucleotide sequence which has at least 90%, 95%, 97% identity to SEQ ID NO:3 over the entire length of SEQ ID NO:3; (b) an isolated polynucleotide comprising the polynucleotide of SEQ ID NO:3; (c) the polynucleotide of SEQ ID NO:3; or (d) an isolated polynucleotide comprising a nucleotide sequence encoding a polypeptide which has at least 95%, 97-99% identity to the amino acid sequence of SEQ ID NO:4, over the entire length of SEQ ID NO:4.

14. A polypeptide selected from the group consisting of: (a) a polypeptide which comprises an amino acid sequence which has at least 95%, 97-99% identity to that of SEQ ID NO:4 over the entire length of SEQ ID NO:4; (b) a polypeptide which has an amino acid sequence which is at least 95%, 97-99% identity to the amino acid sequence of SEQ ID NO:4 over the entire length of SEQ ID NO:4; (c) a polypeptide which comprises the amino acid of SEQ ID NO:4; (d) a polypeptide which is the polypeptide of SEQ ID NO:4; or (e) a polypeptide which is encoded by a polynucleotide comprising the sequence contained in SEQ ID NO:3.