U.S. patent application number 09/863063 was filed with the patent office on 2002-04-04 for compositions and methods of nematode control.
Invention is credited to Greenstein, David, Miller, Michael A..
Application Number | 20020040483 09/863063 |
Document ID | / |
Family ID | 26900800 |
Filed Date | 2002-04-04 |
United States Patent
Application |
20020040483 |
Kind Code |
A1 |
Greenstein, David ; et
al. |
April 4, 2002 |
Compositions and methods of nematode control
Abstract
The present invention provides compositions and methods for
identifying agents that stimulate or inhibit nematode reproduction,
especially related to oocyte maturation, sheath cell contraction,
and ovulation. It is disclosed that the major sperm protein (MSP)
is acts in signal transduction of female sexual maturation in
nematodes. Provided are compositions and methods for identifying
anti-nematode agents with MSP as a target and for controlling
nematode populations. MSP is an excellent target for identification
of anti-nematode factors because it is highly conserved among
members of the phylum Nematoda and is not known to exist in other
organisms, especially crops, livestock, pets, and humans. Thus,
anti-nematode agents that target MSP are less likely to induce
severe side effects when administered to a host and the nematode is
unlikely to develop resistance to a highly conserved molecule
involved in sexual reproduction.
Inventors: |
Greenstein, David;
(Nashville, TN) ; Miller, Michael A.; (Nashville,
TN) |
Correspondence
Address: |
Waddey & Patterson, P.C.
Bank of America Plaza
Suite 2020
414 Union Street
Nashville
TN
37219
US
|
Family ID: |
26900800 |
Appl. No.: |
09/863063 |
Filed: |
May 21, 2001 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
60205829 |
May 19, 2000 |
|
|
|
60274358 |
Mar 8, 2001 |
|
|
|
Current U.S.
Class: |
800/3 ;
800/8 |
Current CPC
Class: |
A61K 38/00 20130101;
A01K 2217/05 20130101; G01N 33/5085 20130101; C07K 14/4354
20130101 |
Class at
Publication: |
800/3 ;
800/8 |
International
Class: |
A01K 067/033 |
Claims
What is claimed is:
1. A method of identifying an anti-nematode agent, comprising:
contacting a test compound to a nematode; and monitoring a female
sexual maturation of the nematode, wherein inhibition of the female
sexual maturation indicates that the test compound includes the
anti-nematode agent.
2. The method of claim 1, wherein the female sexual maturation
comprises an oocyte maturation or a gonadal sheath cell
contraction.
3. The method of claim 1, wherein the female sexual maturation
comprises an ovulation.
4. The method of claim 1, wherein the monitoring step includes
optical detection.
5. The method of claim 1, wherein the monitoring step includes
optical detection of more than one female sexual maturation episode
at the same time.
6. The method of claim 1, wherein the nematode is an animal
parasitic nematode.
7. The method of claim 1, wherein the nematode is a plant parasitic
nematode.
8. The method of claim 1, wherein the nematode is of the genus
Caenorhabditis.
9. The method of claim 1, wherein the nematode is Caenorhabditis
elegans.
10. The method of claim 1, wherein the nematode is of the genus
Ascaris.
11. The method of claim 1, wherein the nematode comprises a
roundworm.
12. The method of claim 1, wherein the nematode comprises a member
of a genus selected from a group consisting of: Ascaris,
Heterodera, Globodera, Meloidogyne, Ditylenchus, Anguina,
Pratylenchus, Radopholus, Hirschmanniella, Hoplolaimus,
Rotylenchulus, Tylenchulus, Helicotylenchus, Criconemella,
Xiphinema, Longidorus, Trichodorus, Paratrichodorus, Aphelenchs,
Onchocerca, Brugia, and Wuchereria.
13. The method of claim 1, wherein the nematode includes a defect
in a production of a sperm.
14. The method of claim 1, wherein the nematode includes a genetic
mutation.
15. The method of claim 1, wherein the nematode is selected from a
group consisting of: a fog-1 nematode, a fog-2 nematode, a fog-3
nematode, a fem-1 nematode, a fem-2 nematode, a fem-3 nematode, and
a gld-1 nematode.
16. The method of claim 1, wherein the nematode comprises a
transgenic nematode including a transgenic expression of a major
sperm protein, or a biologically active fragment thereof.
17. The method of claim 1, wherein the nematode comprises a
transgenic nematode including an ectopic expression of a major
sperm protein, or a biologically active fragment thereof.
18. The method of claim 1, wherein the nematode comprises a
transgenic nematode including a transgenic expression of a major
sperm protein from a nematode of a genus Caenorhabditis or a genus
Ascaris, or a biologically active fragment thereof.
19. A method of inhibiting a reproduction of the nematode of claim
1, comprising: administering the anti-nematode agent identified in
claim 1 to the nematode.
20. The method of claim 19, wherein the anti-nematode agent
comprises an antibody that binds specifically to the major sperm
protein, or a biologically active fragment thereof.
21. A method of controlling a population of nematodes, comprising:
administering the anti-nematode agent identified in claim 1 to the
nematodes.
22. A method of controlling a population of nematodes in an animal
in need thereof, comprising: administering the anti-nematode agent
identified in claim 1 to the animal in an amount effective to
control the population of nematodes.
23. A method of increasing a host resistance to a nematode
infection in an animal in need thereof, comprising: administering
the anti-nematode agent identified in claim 1 to the animal in an
amount effective to increase the host resistance.
24. A method of increasing a host resistance to a nematode
infection in a non-human animal in need thereof, comprising:
expressing the anti-nematode agent identified in claim 1 in the
animal, wherein the agent comprises a polypeptide which binds a
major sperm protein.
25. A method of controlling a population of nematodes in a plant in
need thereof, comprising: administering the anti-nematode agent
identified in claim 1 to the plant in an amount effective to
control the population of nematodes.
26. A method of increasing a host resistance to a nematode
infection in a plant in need thereof, comprising: administering the
anti-nematode agent identified in claim 1 to the plant in an amount
effective to increase the host resistance.
27. A method of increasing a host resistance to a nematode
infection in an plant in need thereof, comprising: expressing the
anti-nematode agent identified in claim 1 in the plant, wherein the
agent comprises a polypeptide which binds a major sperm
protein.
28. A process of making a factor that inhibits a female sexual
maturation of a nematode, the method comprising: contacting a test
compound to a nematode; monitoring the female sexual maturation,
wherein inhibition of the female sexual maturation indicates that
the test compound comprises the factor; and manufacturing the
factor.
29. A method of identifying an anti-nematode agent, comprising:
contacting a test compound to a polypeptide comprising a major
sperm protein or a portion thereof capable of stimulating a female
sexual maturation; and detecting a composition including the test
compound and the polypeptide, wherein the presence of the
composition indicates that the test compound is the anti-nematode
agent.
30. The method of claim 29, further comprising screening the
anti-nematode agent for inhibition of a female sexual
maturation.
31. The method of claim 29, wherein the MSP comprises the amino
acid sequence set forth in SEQ ID NO:2: or nematode major sperm
protein alignment variants thereof, or a portion thereof capable of
stimulating a female sexual maturation.
32. A method of inhibiting a reproduction of a nematode,
comprising: inhibiting a stimulation of a female reproductive cell
by a major sperm protein.
33. A method of identifying an agent that binds to a biologically
active domain of a nematode major sperm protein, comprising:
contacting a test compound to the domain; and detecting a
composition including the test compound and the domain, wherein the
presence of the composition indicates that the agent binds to the
domain.
34. An isolated nematode major sperm protein domain, comprising: a
polypeptide including 125 or fewer consecutive amino acids of a
nematode major sperm protein, wherein the domain is capable of
stimulating a female sexual maturation.
35. The major sperm protein domain of claim 34, wherein the
polypeptide includes 20 or fewer amino acids of the nematode major
sperm protein, wherein the domain is capable of stimulating the
female sexual maturation.
36. The major sperm protein domain of claim 34, wherein the
polypeptide includes 10 to 30 amino acids of the nematode major
sperm protein, wherein the domain is capable of stimulating the
female sexual maturation.
37. An isolated nematode major sperm protein domain, comprising: a
polypeptide including 125 or fewer consecutive amino acids as set
forth in SEQ ID NO:2 or nematode major sperm protein alignment
variants thereof, wherein the domain is capable of stimulating a
female sexual maturation.
38. The major sperm protein domain of claim 37, wherein the
polypeptide includes 20 or fewer amino acids, wherein the domain is
capable of stimulating a female sexual maturation.
39. The major sperm protein domain of claim 37, wherein the
polypeptide includes 10 to 30 amino acids, wherein the domain is
capable of stimulating a female sexual maturation.
40. An antibody that selectively binds to a biologically active
domain of a nematode major sperm protein, wherein the biologically
active domain comprises a sheath cell contraction domain.
41. The antibody of claim 40, wherein the biologically active
domain comprises 20 or fewer amino acids of a carboxyl-terminus of
the domain.
42. An antibody that selectively binds to a biologically active
domain of a nematode major sperm protein, wherein the biologically
active domain comprises an oocyte maturation domain.
43. The antibody of claim 42, wherein the biologically active
domain includes an amino acid sequence having a group of
consecutive residues in the range of 96-110 of SEQ ID NO:2, or
nematode major sperm protein alignment variants thereof; and
wherein the amino acid sequence includes 20 or fewer consecutive
residues of SEQ ID NO:2, or nematode major sperm protein alignment
variants thereof.
44. The antibody of claim 42, wherein the biologically active
domain includes an amino acid sequence having a group of
consecutive residues in the range of 1-106 of SEQ ID NO:2, or
nematode major sperm protein alignment variants thereof; and
wherein the amino acid sequence includes 20 or fewer consecutive
residues of SEQ ID NO:2, or nematode major sperm protein alignment
variants thereof.
45. A process of making an antibody, comprising immunizing a
non-human animal with an immunogenic fragment of a nematode major
sperm protein domain including a polypeptide having 20 or fewer
consecutive amino acids as set forth in SEQ ID NO:2 or nematode
major sperm protein alignment variants thereof, wherein the domain
is capable of stimulating a female sexual maturation.
Description
FILED UNDER 35 U.S.C. .sctn. 119 WITH RIGHT TO PRIORITY
[0001] This application claims benefit of U.S. patent application
Ser. No. 60/205,829 filed on May 19, 2000, entitled "Control of
Nematodes, Stimulation of Nematode Resistance, and Screening
Methods for Identifying Anti-Nematode Factors", incorporated herein
by reference in its entirety and U.S. patent application Ser. No.
60/274,358 filed on Mar. 08, 2001, entitled "Control of Nematodes",
incorporated herein by reference in its entirety.
[0002] Be it known that we, David Greenstein, a citizen of The
United States of America, residing at 104 Groome Drive, Nashville,
Tenn. 37205 and Michael A. Miller, a citizen of The United States
of America, residing at 2511 Barton Ave., Nashville, Tenn. 37212;
have invented new and useful "Compositions and Methods of Nematode
Control".
FIELD OF THE INVENTION
[0003] The present invention is related to compositions and methods
of nematode control and, in particular, to compositions and methods
for control of nematode fertility, for identifying anti-nematode
agents, and potentiating host resistance.
BACKGROUND OF THE INVENTION
[0004] Parasitic nematodes infection of plants and animals are
widespread with approximately 3 billion people being infected
worldwide, 100 million lives lost, and an estimated $80 billion
worth of crops lost annually to these organisms. Human conditions
include river fever and elephantiasis each of which cause terrible
human suffering. Parasitic nematodes are also a major problem in
livestock, horses, and pets. Free living nematodes also damage
plants during feeding, compete for oxygen, and transmit disease.
Certain anti-nematode agents are commercially available.
Disadvantages to these agents, such as the carbamates, include
their extreme toxicity to most animals and all humankind. Other
agents, such as ivermectin and its derivatives have undesirable
toxic effects and potentially severe side effects especially those
related to behavior and mental health. In addition, ivermectin
resistant strains of nematodes develop relatively quickly and are
reported in crops, livestock, and humans.
[0005] It is clear from the widespread and sever nature of the
nematode problem and the adverse or toxic nature of many nematode
treating agents, that more effective compounds and methods for
controlling nematodes and identifying anti-nematode agents are
needed.
STATUS OF THE PRIOR ART
[0006] McCarter et al, (1999) discloses that in the absence of
sperm, the production of oocytes remains arrested in nematodes.
[0007] Klass, M. R., et al. (1981) discloses that major sperm
protein is a structural protein in sperm cells of nematodes.
[0008] It is disclosed that all cells of Caenorhabditis elegans are
directly observable in the intact Caenorhabditis elegans animal as
reviewed in Hubbard and Greenstein (2000).
[0009] Video microscopy is disclosed to be used for observing the
late stages of oocyte development (Ward and Carrel, 1979;
Albertson, 1984; Albertson and Thomson, 1993; McCarter et al.,
1997; Rose et al., 1997; Hall et al., 1999).
SUMMARY OF THE INVENTION
[0010] The present invention provides, in part, compositions and
methods for controlling nematode populations, identifying
anti-nematode agents, enhancing host resistance to nematode
infection, and treating plants and animals for nematodes.
[0011] Although the present invention is not bound by mechanism or
theory, it is related, in part, to the surprising discovery made by
the inventors that the major sperm protein (MSP) of nematodes is a
molecular signaling factor which stimulates maturation of the
female reproductive system in nematodes. Biological activities of
MSP in this regard include, but are not limited to: oocyte
maturation, gonadal sheath cell contraction, and ovulation.
[0012] One advantage of the present invention is that inhibitors of
the MSP signaling mechanism described herein are contemplated to be
highly specific to inhibiting nematode proliferation and spread
while being non-toxic to vertebrates because the MSP gene and
polypeptide are highly conserved between groups and divisions
within the Phylum Nematoda, including the genera and species.
Vertebrates and other non-nematode organisms, on the other hand,
are not known to have an MSP gene, or protein. Thus, inhibitors of
MSP stimulated female sexual maturation (FSM) are expected to be
specific to organisms of the Phylum Nematoda.
[0013] Another advantage of the present invention is that the high
sequence conservation observed among MSP from various nematodes
suggests that resistance to anti-nematode agents that target MSP is
likely to be minimal as mutational changes in MSP in are likely to
result in a reduction of reproductive capacity.
[0014] Still another advantage of the present invention is that, in
general, MSP and FSM effective domains thereof, can be prepared in
soluble form. Thus, MSP provides an easily handled target for
methods of the present invention including in high-throughput
assays for identification of MSP binding and FSM blocking
agents.
[0015] One aspect of the present invention includes a method for
identifying an anti-nematode agent by contacting a test compound to
a nematode and monitoring the FSM response, wherein inhibiting test
compounds are selected as anti-nematode agents.
[0016] Another aspect of the present invention includes identifying
anti-nematode agents by selection of major sperm protein binding
agents as many of these agents will also inhibit FSM. Screening
methods are described to determine which MSP binding agents also
inhibit FSM.
[0017] In a further aspect of the present invention, a reduction or
an absence of MSP signal transduction impairs or virtually
eliminates nematode fertility.
[0018] Still further aspects of the present invention provide
methods of controlling nematode populations including, but not
limited to: free living nematode populations and parasitic nematode
populations which, in turn include animal and plant parasitic
nematodes.
[0019] Additional aspects, embodiments, and elements of the present
invention are described below, including in the detailed
description of the invention, the examples, and the claims.
Aspects, embodiments, and elements described herein are not meant
to limit the present invention in any way including to any
particular set thereof. Further aspects, embodiments, elements and
equivalents thereof, will be readily apparent based upon the
present disclosure and are considered to be within the spirit and
scope of the present invention.
BRIEF DESCRIPTION OF THE DRAWINGS
[0020] FIG. 1 shows a cross-section of a nematode and includes a
depiction of the reproductive anatomy. Microinjections as described
herein are preferred to be carried out at the point indicated.
[0021] FIG. 2 shows a polyacrylamide gel electrophoresis of crude
sperm-conditioned medium (SCM) (left lane) and isolated 14 kDa
female sexual maturation (FSM) stimulating factor (single band in
right lane) identified as major sperm protein (MSP) of C.
elegans.
[0022] FIG. 3 shows HPLC traces of fractionation of SCM on C-4 and
C-18 columns. The "+" sign indicates the respective fractions with
FSM positive biological activity.
[0023] FIG. 4 shows mass spectra of the FSM positive fractions from
the HPLC purification. The mass spectra confirm MSP-3 and MSP-142
of C. elegans are present in the biologically active SCM. No other
factors were observed or identified in these mass spectra.
[0024] FIG. 5 is a diagram of MSP mediated cellular communication
between female reproductive cell (for example, the oocytes) and
sperm.
[0025] FIG. 6 displays an alignment of twenty-seven MSP
polypeptides from C. elegans. The SEQ ID Numbers are not meant to
include the N-terminal most methionine which is believed to be
cleaved during processing.
[0026] FIG. 7 displays and alignment of Ascaris suum alpha and beta
MSP isoforms and MSP-142 of C-elegans. Again, the SEQ ID Numbers
are not meant to include to N-terminal most methionine which is
believed to be cleaved during processing.
[0027] FIG. 8 is a bar graph demonstrating bioactive properties of
MSP-77 and MSP-38, and sperm protein (versus and buffer control) in
stimulating FSM in nematodes. The top panel displays maturations
per hour which is a biological measure of oocyte maturation. The
center panel displays contractions per minute which is a biological
measure of sheath cell contraction. The bottom panel displays
average displacement (in microns) which is another measure of
sheath cell contraction. Measurements are made for buffer and the
shown concentrations of MSP-77, MSP-38, and sperm MSP. The 6His
marking denotes that the MSP includes a histidine tag (Qiagen) and
was purified using this system.
[0028] FIG. 9 shows an alignment (performed by visual inspection)
of the C-termini of MSPs from wide ranging nematode species and
demonstrates that there is a remarkable sequence conservation. The
residues numbers relative to the full length (minus the methionine)
polypeptide are 106-126 for each of the following. Ascaris suum
(As) MSP isoforms alpha and beta (GenBank accession numbers P27439
and P27440) fragment from 106-126 are both represented by SEQ ID
NO:13 (identical polypeptides). Onchocerca volvulus (Ov) MSP
isoforms 1 and 2 (P13262 and P13263) are also represented by SEQ ID
NO:13. Globodera rostochiensis (Gr, the potato cyst nematode) MSP
isoforms 1, 2, and 3 are each represented by SEQ ID NO:14. C.
elegans (Ce) MSP isoforms 142 and 33 (P53017 and P53019) are each
represented by SEQ ID NO:15.
[0029] FIG. 10 is a bar graph showing that the N-terminal region of
MSP is necessary and sufficient for stimulation of oocyte
maturation and the C-terminal region is necessary and sufficient
for stimulation of sheath cell contraction. The N-terminal residues
1-106 (SEQ ID NO: 16) of MSP-77 (SEQ ID NO:9) are necessary and
sufficient for stimulation of oocyte maturation (top panel). The
C-terminal residues 106-126 (SEQ ID NO:17) of MSP-77 (SEQ ID NO:9)
are necessary and sufficient for stimulation of sheath cell
contraction (middle panel) and displacement (bottom panel).
DETAILED DESCRIPTION OF THE INVENTION
[0030] Given the human suffering and economic loss due to
nematodes, it is critical that effective and safe anti-nematode
compounds and methods for controlling nematodes are identified.
Although not bound by mechanism or theory, the present invention
takes advantage of the discovery by the inventors that nematode
major sperm protein regulates the fertility of nematodes. Provided
herein are compositions and methods for inhibiting or blocking
major sperm protein action in fertility.
[0031] Certain utilities of the compositions and methods of the
present invention include, but are not limited to: identifying
anti-nematode agents, manufacturing anti-nematode agents, providing
reagents for screening test compounds for anti-nematode activity,
controlling nematode populations, treating animals and plants for
nematode infection or infestation, treating animals and plants for
certain negative effects of nematodes (including environmental or
other effects of free living nematodes), raising host resistance to
nematode infection, and prophylactic treatments to retard nematode
infection or the spread of nematodes.
[0032] 1.0 Definitions
[0033] Unless otherwise defined, all technical and scientific terms
used herein have the same meaning as commonly understood by one of
ordinary skill in the art to which this invention pertains. In case
of conflict, the present document, including definitions, will
control.
[0034] Descriptions of preferred methods and compositions are
provided herein, but should not be construed to be limiting.
[0035] As used herein "prophylaxis" or "prophylactic treatment"
refers to measures designed to preserve health or retard the spread
of disease. "Prophylaxis" or "prophylactic treatment" do not mean
herein a certainty of the preservation of health or a certainty of
a halt to a spread of a disease.
[0036] MSP is an abbreviation for major sperm protein.
[0037] FSM is an abbreviation for female sexual maturation.
[0038] FSM is meant to include, but is not necessarily limited to
oocyte maturation, sheath cell contraction, and ovulation.
[0039] SCM is an abbreviation for sperm-conditioned media.
[0040] C. elegans is an abbreviation for the nematode genus and
species Caenorhabditis elegans.
[0041] A. suum is an abbreviation for the nematode genus and
species Ascaris suum.
[0042] The term "biological activity" is meant to include, but is
not limited to: FSM, oocyte maturation, sheath cell contraction,
and ovulation.
[0043] The term "polypeptide" is known in the art, meanings of
which are included herein. However, in the event of conflict, the
term "polypeptide" means herein, an amino acid polymer of two units
or greater (e.g., a dipeptide or greater).
[0044] The term "polynucleotide" is known in the art, meanings of
which are included herein. However, in the event of conflict, the
term "polynucleotide" means a nucleic acid polymer of two units or
greater (e.g., a dinucleotide or greater).
[0045] The term "isolated polypeptide" refers to a polypeptide that
is at least partially removed from the milieu of molecules in which
it occurs in nature.
[0046] The term "isolated polynucleotide" refers to a
polynucleotide that is at least partially removed from the milieu
of molecules in which it occurs in nature. As used herein,
"isolated polynucleotide" also means that the polynucleotide is not
identical in structure to a naturally occurring genome or fragment
of a genome that spans more than three distinct, non-overlapping,
genomically consecutive genes in length.
[0047] Additional definitions of specific terms and phrases are
provided herein as needed.
[0048] 2.0 Caenorhabditis Elegans as a Model System
[0049] Caenorhabditis elegans, or C. elegans, is a widely accepted
genetic model system for studying the genes and gene functions of
higher organisms. C. elegans is also a widely accepted model system
for studying all features of other members of the phylum Nematoda.
These features include germline development, female sexual
maturation, oocyte maturation, sheath cell contraction, and
ovulation (reviewed by Hubbard and Greenstein, 2000).
[0050] C. elegans is a primitive organism which nonetheless shares
many of the essential biological characteristics that are central
problems of, for example, human biology. The worm is conceived as a
single cell which undergoes a complex process of development,
starting with embryonic cleavage, proceeding through morphogenesis
and growth to the adult. It has a nervous system including a
rudimentary brain, exhibits behaviors, and can "learn". It produces
sperm and eggs, mates and reproduces. After reproduction it
gradually ages, loses vigor and finally dies. Certain genetic
features of C. elegans have been extensively characterized and the
genome has been sequenced. All 959 somatic cells of its transparent
body are visible with a microscope, and its average life span (in
the normal state) is a mere 2-3 weeks. Thus, C. elegans provides an
ideal compromise between complexity and tractability.
[0051] 3.0 Germline Development in Nematoda
[0052] In general, sexual reproduction of nematodes depends on
coordination between meiotic cell cycle progression, gametogenesis,
and fertilization. For example, gamete differentiation is
coordinated with meiotic cell cycle transitions so that
fertilization produces a diploid zygote capable of completing
embryogenesis and growing into a fertile adult. Normally, nematode
oocytes arrest during diplotene/diakinesis of meiotic prophase
(after the completion of meiosis I and meiosis II) while they grow
in size. The release of oocytes from this arrest occurs during
meiotic maturation during which the nuclear envelope (i.e.,
germinal vesicle) breaks down, the cytoskeleton rearranges, and the
oocyte prepares for fertilization.
[0053] Typically, the progression of germline development in C.
elegans, and members of Nematoda in general, is as follows. During
embryogenesis a reproducible and largely invariant cell lineage
generates two germline precursor cells, Z2/Z3, and two somatic
gonadal precursor cells, Z1/Z4, that together comprise the gonadal
primordium at hatching (Kimble and Hirsh, 1979; Sulston et al.,
1983). During post-embryonic development, Z1 and Z4 give rise to
the entire somatic gonad (in the hermaphrodite, these structures
are distal tip cells (DTCs), sheath cells, spermathecae, and
uterus) and Z2 and Z3 give rise to the germ line. In later larval
stages the germ line contains a stem-cell population that
contributes cells to the meiotic pathway. Although germline nuclei
reside in a syncytium at these stages, individual germline nuclei
and their surrounding cytoplasm are typically referred to as a
"germ cell". Development of the soma and germ line in both sexes,
hermaphrodites and males, is coordinated by intercellular
signaling. The self-fertile hermaphrodites are essentially modified
females that produce sperm for a short time early in gametogenesis
and then produce exclusively oocytes as adults. Males produce only
sperm and can mate with hermaphrodites to produce cross
progeny.
[0054] During post-embryonic development germ cells proliferate
mitotically forming approximately 1000 nuclei in hermaphrodites and
500 in males. The C. elegans adult hermaphrodite gonad consists of
two U-shaped gonad arms (FIG. 1). The two equivalent gonad arms of
the adult hermaphrodite gonad have been described at an
ultrastructural level (Hirsh et al., 1976; Hall et al., 1999; see
FIG. 1). The distal portion of the gonad contains syncytial
germline nuclei surrounded by incomplete membranes. The germ cells
are connected to a core cytoplasm, also called the rachis. The
stem-cell population is restricted to the distal-most part of the
germ line; germ cells enter meiosis as they move proximally. In
hermaphrodites, approximately the first 40 germ cells to enter
meiotic prophase in each gonad arm differentiate as spermatocytes
which complete meiosis to form approximately 160 sperm during the
fourth larval stage of development. Upon progression to the adult
stage, the germ cells differentiate as oocytes. Oocytes are
surrounded by the proximal gonadal sheath cells (see FIG. 1).
[0055] The gonadal sheath cells are somatic cells that appear to
play several roles important for the structure, integrity, and
reproductive functions of the gonad (McCarter et al., 1997; Rose et
al., 1997). The ten thin gonadal sheath cells can be subdivided
into five pairs (1-5) with each pair having a distinct position
along the proximal-distal axis of each gonad arm (FIG. 1). These
elongated myoepithelial cells lie between germ cells and the
gonadal basal lamina (Hirsh et al., 1976; Kimble and Hirsh, 1979;
Strome, 1986; Hall et al., 1999). The distal sheath cells (pair 1)
have an unusual cellular structure with a flattened soma pressed
into the gonad such that the cytoplasm is concentrated into a
series of wedges that insert between the germ cells. Pair 1 distal
sheath cells also extend finger-like filopodia between distal germ
cells. Pair 2 ensheathes the loop region. The proximal sheath cells
(pairs 3-5; see FIG. 1) contain thick and thin filaments and
contract to drive ovulation (Strome, 1986; Myers et al., 1996;
McCarter et al., 1997; Rose et al., 1997; Hall et al., 1999). The
proximal sheath cells are positioned in an interdigitating pattern
form gap junctions with one another, and are closely apposed to
oocytes (Hall et al., 1999). On their basal surfaces the proximal
sheath cells attach to the gonadal basal lamina via hemi-adherens
junctions which also serve to anchor the actin cytoskeleton and the
contractile apparatus within the sheath cells. At their apical
face, the proximal sheath cells often form gap junctions with
oocytes. Yolk particles synthesized by the intestine (Kimble and
Sharrock, 1983) gain access to oocytes for receptor-mediated
endocytosis (Grant and Hirsh, 1999) by first moving through the
sheath pores (Hall et al., 1999). The most proximal sheath cells,
pair 5, directly attach to the spermatheca. The spermatheca (1 per
gonad arm) is a flexible accordion-like structure connected to the
gonad arm distally and to the uterus proximally. The spermatheca
expands greatly to accommodate oocytes, which are fertilized as
they enter from the gonad arm during ovulation.
[0056] 4.0 Female Sexual Maturation
[0057] The phrase "female sexual maturation" is defined herein to
include, but is not limited to: meiotic maturation, completion of
the meiotic divisions, oocyte production, oocyte or ovum
maturation, and the events and processes of sheath cell contraction
and ovulation. In certain embodiments, "maturation" generally
relates to the process by which an oocyte or an ova becomes
competent for being fertilized. For example, female sexual
maturation includes maturation of a female reproductive cell and
maturation of an oocyte. In another example, as used herein, female
sexual maturation also includes a contraction of a sheath cell
which is considered herein to be a female reproductive cell. Thus
certain cells of the nematode reproductive system are referred to
as female reproductive cells, even though they are not an oocyte or
ovum per say.
[0058] 5.0 Meiotic Maturation, Ovulation, and Completion of the
Meiotic Divisions
[0059] Fully grown oocytes remain in the diakinesis stage of
prophase I prior to undergoing meiotic maturation, ovulation, and
fertilization. The nuclear envelope of the most proximal oocyte
breaks down about 5 minutes prior to ovulation as it enters meiotic
M-phase from prophase (Ward and Carrel, 1979; McCarter et al.,
1999). During maturation, the oocyte also undergoes a structural
change termed cortical rearrangement (McCarter et al., 1999). These
changes within the oocyte coincide with a reproducible sequence of
somatic motor events mediated by the proximal sheath cells and the
distal spermatheca resulting in ovulation. During ovulation the
mature oocyte enters the spermatheca and is fertilized. The
fertilized oocyte then passes into the uterus where both meiotic
divisions are completed and embryogenesis begins (Albertson, 1984;
Albertson and Thomson, 1993; McCarter et al., 1999). McCarter et
al, (1999) discloses that in the absence of sperm, the production
of oocytes remains arrested in nematodes.
[0060] 6.0 Assay to Identify the Stimulator of Female Sexual
Maturation
[0061] The present inventors developed an in vivo assay for female
sexual maturation and used the assay to discover that the major
sperm protein (MSP) is the particular stimulator of female sexual
maturation. The general procedures used are as follows. Large
quantities of sperm (>108) are purified using a modification of
methods developed by Klass and Hirsh (1981). Synchronized cultures
of fog-2(q71), which are 50% male and 50% female, are used to
purify adult males (Lewis and Flemming, 1995). Mutations in the
fog-2 gene block spermatogenesis in XX animals, transforming them
into females, but have no effect on XO animals, which are fertile
males (Schedl and Kimble, 1988). Males are separated from females,
larvae, and embryos based on size by sieving through NITEX screens
of various pore sizes. The populations of males isolated in this
way are generally >99% pure. To isolate sperm, males are placed
between two PLEXIGLASS plates and smashed in a vice grip (The Home
Depot, Inc.). Intact sperm are then purified from the carcasses by
filtration through NITEX filters (20 micron pore size) and washed
in M9 phosphate buffer (Sulston and Hodgkin, 1988) using several
rounds of low speed centrifugation and resuspension.
Sperm-conditioned medium (SCM) are prepared by incubating purified
sperm in M9 for different periods of time (e.g., 1-12 hours) and
removing the sperm by centrifugation and filtration through a 0.2
micron filter. Microscopic analysis suggests that the sperm are not
lysing during the incubation. Polyacrylamide gel electrophoresis
(PAGE) also indicates that the sperm are not lysing during the
incubation and also reveals that that an approximately 14 kDa
protein is enriched in SCM. Referring to FIG. 2, an single protein
band at approximately 14 kDa is apparent in the second lane. PAGE
results for unfractionated SCM are displayed in lane 1.
[0062] Another aspect of the present invention provides an assay to
screen SCM for maturation- and contraction-inducing activities,
comprising microinjecting SCM into the uterus of reduced capacity
sperm producing female nematodes (virgin fog-2(q71) females are
used in certain preferred embodiments). Maturation and sheath cell
contraction are monitored by time-lapse video microscopy (see Rose
et al. (1997) for a general description of time-lapse video
microscopy of nematodes). Dramatic increases in oocyte maturation
and sheath cell contraction rates are observed following injection
of SCM. By contrast, no activity, or essentially no activity, is
observed following injection of female extracts, 1-methyladenine,
acetylcholine, oxytocin, or M9 buffer. The above described
embodiment, provides a bioassay for sperm derived factors that
promote oocyte maturation and sheath cell contraction. It is
disclosed in the present invention that the activity is, at least
in part, soluble and present in the sperm-conditioned media. This
suggests that the factor is secreted by the sperm. Thus, it is a
discovery of the present invention that while the sperm are
sometime physically blocked by the valve, a soluble (diffusible)
factor is secreted from the sperm to affect FSM and this factor
penetrates the valve.
[0063] Still another aspect of the present invention provides
compositions and methods for fractionation of SCM, and other
nematode biological materials, for isolation of the FSM stimulatory
factor. In one example, fractionation is performed using reversed
phase high pressure liquid chromatography (HPLC) on Vydak C-4 and
C-18 analytical columns. FIG. 3, a fraction marked by a + sign is
the only active fraction recovered when the SCM is fractionated on
the C-4 and C-18 columns, respectively (as determined using the in
vivo FSM assay described herein). The biologically active fraction
is analyzed using MALDI mass spectrometry peptide mapping and
sequencing, identification techniques which are known in the art
(FIG. 4). This result is verified by producing MSP-38 (GenBank Ac.
# CAA93089) and MSP-142 (GenBank Ac. # CAB03037) in bacteria and
purifying the respective isoforms using a commercially available
6-His tagging and protein product purification system. The inserts
are cloned into the pQE-30 Type IV Kit available from Qiagen. The
vector includes the 6-His tagging system and methods for this
cloning and use of the 6-His tagging system of identification and
purification of expressed polypeptides are well known. The result
is also confirmed using C. elegans MSP-77. Additional tests by
MADLI-MS analysis demonstrate the C. elegans MSP in SCM is MSP-3
and MSP 142 (Miller et al., 2001).
[0064] Microinjection of purified recombinant MSP mimics the
biological response (FSM) seen using the active, fraction purified
from SCM. Additionally, the recombinantly produced protein yields
the same peptide map as the MSP from the active SCM fraction when
cleaved with trypsin and analyzed using mass spectrometry. These
results demonstrate that C. elegans sperm secrete, or otherwise
release, the major sperm protein, that the MSP signal is at least
partially soluble in the extracellular fluid surrounds the sperm
and in buffers, and that MSP dramatically increases FSM (including
oocyte maturation, sheath cell contraction, and ovulation rates).
The concept of MSP directed signal transduction of FSM including
oocyte maturation, sheath cell contraction, and ovulation is
diagrammed in FIG. 5. Referring to FIG. 5, MSP serves as a simple
molecule for communication between the sperm and non-mature or
arrested oocytes and inactive female reproductive cells that sperm
is present and ready to fertilize the egg.
[0065] Furthermore, the MSP is believed to be necessary and
sufficient for stimulating that communication or signal
transduction of FSM. While it is contemplated and other factors may
form a web-like network of upstream and/or downstream signal
cascade, it is an advantage in certain embodiments herein that the
role of MSP is quite uncomplicated. Thus, MSP provides an excellent
target for anti-nematode agents. Also, due to the high sequence
conservation between MSP polypeptides in all known nematodes, it is
contemplated that nematodes will not readily evolve resistance to
compounds or agents that target MSP.
[0066] 7.0 MSP is Known as a Structural Protein Localized Within
the Sperm Cell
[0067] MSP is known in the art as a structural protein of the
nematode sperm (Klass, M. R., et al., 1981). Thus, it is a
surprising discovery of the present invention that MSP is also a
nematode female sexual maturation factor (stimulator, signal
transduction element, etc.).
[0068] It is widely accepted that motility of nematode sperm is not
actin based, but rather is dependent upon MSP structure and
function. Inside the sperm cell, dimeric MSP assembles at one end
of a fibrous polymer of dimeric MSP and disassembles at the other
end in a treadmill-like fashion which enables the sperm to protrude
and withdraw pseudopodia related to motility.
[0069] 8.0 Sequence Conservation Among the Many MSP Sequences
Described
[0070] There are likely more than sixty copies of the MSP gene in
the C. elegans genome and it is believed that most of these MSP
genes are transcribed. Referring to FIG. 6, twenty-seven MSP
polypeptide sequences are provided corresponding to polypeptides
transcribed from apparently distinct MSP genes or polynucleotide
sequences. Certain other nematodes apparently have fewer copies of
MSP. For example, A. suum are believed to have two copies of an MSP
gene both of which are believed to be transcribed into
polypeptides.
[0071] Twenty-seven polypeptide sequences for FIG. 6 are aligned
using Divide-and-Conquer Multiple Sequence Alignment which is
currently available over the world wide web (www) at the URL
http://bibiserv.techfak.uni-bielefeld.de/dca/. The server is
located at the Practical Computer Science and Bioinformatics
research group which is run by Robert Giegerich. The physical
location is: Robert Giegerich, AG Praktische Informatik, Technische
Fakulta.t, Universitat Bielefeld, Postfach 10 01 31, D-33501
Bielefeld, Germany. The parameters used are Blosum 62 predefined
substitution matrix, free shift activated, approximate cut
positions activated, recursion stop size L set to 20, window size W
set to 0, and weight intensity lambda set to 0. The algorithm and
method are disclosed in Stoye (1998).
[0072] Referring to FIG. 6, it is known that the N-terminal most
methionine (from the ATG translation start site) is cleaved. It is
expected that both forms (with and without the methionine) of MSP
polypeptides are active in FSM; therefore, the methionine was
included in FIG. 6. However, the references to the SEQ ID Numbers
provided in FIG. 6 correspond to MSP polypeptide sequences of 126
amino acids and are without each N-terminal most methionine as
shown in FIG. 6.
[0073] Again, referring to FIG. 6, the sequences of the numerous C.
elegans MSP display a high degree of sequence homology. Very few
sequence variations are observed. Residues that vary from the
global (general) consensus within a column (determined visually)
are marked in bold letter and underlined in FIG. 6. Because MSP
polypeptide sequences, and even those of the most divergent known
nematodes (see below), are so highly conserved; the preferred
method for alignment is by visual inspection. For example, two or
more MSP polypeptide sequences can be easily lined up next to one
another on a computer screen or as written out on a paper and one
moved against another until the majority of the bases match.
Percent identity between any two sequences is calculated by
counting the number of residues that do not match, dividing by the
total number of residues in the total sequence being compared (or
the shortest of the sequences being compared if one of the pair is
shorter in length), multiplying by 100, and expressing the
resulting value as a percent.
[0074] Using this approach, one of ordinary skill in the art can
easily determine an alignment of a given MSP isolated from any
member of the phylum Nematoda to another MSP, including to a C.
elegans MSP, and in preferred embodiments the MSP specified in SEQ
ID NO:2. It is also preferred that the alignment selected is the
one which produces the highest sequence identity as described
above.
[0075] Thus, for example, the visual inspection method described
above is used to align the sequences for the two known MSPs from A.
suum (alpha and beta) with MSP-142 of C. elegans (see FIG. 7).
Again, very little sequence variation is observed between MSP
polypeptides from these nematodes that are separated by hundreds of
millions of years of evolutionary pressure. This indicates that the
structure function relationship in MSP is tight and sequence
variation likely results in a reduced fitness of the organism.
[0076] 9.0 Biological Activities of MSP on FSM are Conserved in
Phylum Nematoda Ascaris suum is believed to be one of the most
widely separated nematode species from C. elegans in terms of both
evolution (hundreds of millions of years post divergence from the
common organism) and in terms of distinctness of the MSP sequence
including at the polypeptide level. For example, evaluation of the
biological activity of isolated MSP alpha and MSP beta from A. suum
in the in vivo FSM assay described above serves as a model system
for demonstrating that MSP sequences in general stimulate nematode
FSM in all or nearly all member of the phylum Nematoda.
[0077] MSP, isoforms alpha from A. suum is isolated from A. suum
nematodes or the corresponding nucleotide is cloned and expressed
in bacteria, for example. The specific sequence used is Accession
Number P27439 in the NCBI database
(maqsvppgdintqpsqkivfnapyddkhtyhikitnaggrrigwaikttnmrrlsvdp-
pcgvldpkekvlmavscdtfnaatedlnndritiewtntpdgaakqfrrewfqgdgmvrrknlpieynl)
and is set forth in SEQ ID NO: 11, wherein SEQ ID NO:11 does not
include the N-terminal methionine in order to represent the
polypeptide that is believed to be cleaved during cellular
processing (see FIG. 7).
[0078] MSP, isoforms beta from A. suum is isolated from A. suum
nematodes or the corresponding nucleotide is cloned and expressed
in bacteria, for example. The specific sequence used is Accession
Number P27440
(maqsvppgdintqpgskivfnapyddkhtyhikitnaggrrigwaikttnmrrlgvdppcgvldpkesvlma-
vscdtfnaatedlnndritiewtntpdgaakqfrrewfqgdgmvrrknlpieynl) in the
NCBI database and is set forth in SEQ ID NO: 12, wherein SEQ ID
NO:12 does not include the N-terminal methionine in order to
represent the polypeptide that is believed to be cleaved during
cellular processing.
[0079] Microinjection of MSP, isoform alpha or MSP, isoform beta
into the sperm defective (or reduced sperm capacity) female C.
elegans as described above results in a restoration of apparently
normal FSM biological activity even though no sperm are added. This
provides support for using any combination of MSP polypeptide
including as expressed from MSP polynucleotides. Methods known in
the art for expressing polynucleotides that are preferred herein
include, but are not limited to: expression in bacteria, transient
expression in nematodes, stable expression in nematodes, and
transgenic expression in nematodes. Transgenic expression in
nematodes includes gonadal specific expression and ectopic
expression, such as in transgenic expression in somatic cells of
the nematode.
[0080] 10.0 Experiments Demonstrating that MSP Stimulates FSM
[0081] The biological activities of MSP-77 and MSP 38 are studied
using the in vivo FSM assays described herein. Referring to FIG. 8,
MSP isolated from male nematodes, as well as MSP produced in
bacteria stimulate oocyte maturation and sheath cell contraction
when introduced into female nematodes with reduced sperm formation
such as fog-2 mutants (MSP-77 and MSP-38, in this figure, are
isolated from the bacteria with a 6His tag. This general protein
isolation technique is known in the art). Again, referring to FIG.
8, the top panel displays maturations per hour which is a
biological measure of oocyte maturation. The center panel displays
contractions per minute which is a biological measure of sheath
cell contraction. The bottom panel displays average displacement
(in microns) which is another measure of sheath cell contraction.
Measurements are made for buffer and the shown concentrations of
MSP-77, MSP-38, and sperm MSP. The 6His marking denotes that the
MSP includes a histidine tag (Qiagen) and was purified using this
system.
[0082] Similar experiments are performed with MSP-3 and MSP-142
(which are identified herein to be localized in sperm-conditioned
medium), and MSP from C. briggsae and C. remanei. Also, experiments
are performed with MSP from the distantly related A. suum. Each
experiment demonstrates that MSP is essentially interchangeable
with regard to its biological activities in FSM.
[0083] 11.0 The Carboxyl-Terminus of MSP Shows High Sequence
Conservation
[0084] Residues 105 through 125 of MSPs derived from nine different
genera of nematodes show a 100% sequence identity in these 19
consecutive amino acid residues (see FIG. 9). These nematodes
represent free-living (C. elegans), animal parasites (Ascaris and
Onchocerca), and plant parasites (Globodera). (Specifying these
genera as free-living, animal parasites, or plant parasites is not
meant to limit the range that Nematodes inhabit the environment. In
general many groups of nematodes have a diverse range)
[0085] 12.0 Certain Domains Within MSP Differentially Stimulate FSM
Activities
[0086] Another aspect of the present invention provides that
certain domains within MSP differentially regulate certain FSM
activities. For example, FIG. 10 demonstrates that residues 1-106
(SEQ ID NO:16 ) of MSP-77 (SEQ ID NO:9) preferentially stimulates
oocyte maturation, while residues 106-126 (SEQ ID NO:17) of MSP-77
(SEQ ID NO:9) preferentially stimulates the rate of sheath cell
contraction and displacement.
[0087] Thus, the biological activities of FSM, including oocyte
maturation and sheath cell contraction, can be separated and the
present invention discloses that different domains within MSP are
capable of regulating those activities independently.
[0088] 13.0 Description of MSP Sequence Fragments
[0089] Still another aspect of the present invention includes
compositions and methods for identifying and using domains within
MSP including for differential regulation of the biological
activities of FSM. For example, specific sized segments of MSP
polypeptide are systematically screened for the impact of that
domain on FSM. This provides a fine resolution map of the MSP
polypeptide with regard to FSM function that can be exploited to
identify and manufacture highly specific anti-nematode agents, for
example. This is also useful, for example, to identify FSM related
domains of particularly high sequence conservation among members of
Nematoda and/or to avoid areas that might include a short region
that is similar to a gene or polypeptide in another organism, the
targeting of which with anti-organism agents is not desired.
[0090] In certain embodiments antibodies (polyclonal and/or
monoclonal) are generated against each fragment for use in
labeling, identification, and an assay of the present invention. In
preferred embodiments, the antibodies are raised against those
segments of MSP that influence FSM (either positively or
negatively). In other embodiments, the antibodies are raised by
injection of the MSP, or the FSM active domain of the MSP, into an
animal (in certain embodiments, a non-human animal) using
techniques known to one of skill in the art for producing
antibodies. In other embodiments, the antibodies and preferably
monoclonal antibodies are produced in cell, such as hybridomas or
by recombinant techniques that are known in the art. In certain
embodiments, the antibodies are produced in humanized form. This
can be accomplished in certain embodiments by injection of the
immunogenic fragment of MSP into a human.
[0091] 14.0 Production of MSP Polypeptide Fragments
[0092] Segments of MSP polypeptide sequences are readily
manufactured by chemical synthesis, for example by solid phase
polypeptide manufacture. Alternatively, such segments can be
cloned, synthesized in a heterologous cell system, and isolated.
Chemical synthesis is preferred for embodiments wherein the
polypeptide is a polymer of 50 residues or fewer. Segments are
polypeptides that are generally 10 amino acids or more in length
(referring to consecutive amino acids in an MSP sequence in this
section entitled Production of MSP Polypeptide Fragments).
Although, in certain embodiments useful segments are contemplated
that include fewer than 10 consecutive MSP amino acids. It is
believed herein that all or nearly all MSPs are essentially
interchangeable with each other in regard to FSM activity. Although
differences may be identified when examining the differential
regulation of FSM activity.
[0093] Segments do not include the full length MSP polypeptide
sequence. For example, the 126 consecutive amino acids of SEQ ID
NO:2 is not a segment. Segments of a 126 amino acid MSP include 125
or fewer of consecutive amino acids of the MSP. It is preferred
that the segment includes 120 or fewer, 110 or fewer, 106 or fewer,
105 or fewer, 100 or fewer, 95 or fewer, 90 or fewer, 85 or fewer,
80 or fewer, 75 or fewer, 70 or fewer, 65 or fewer, 60 or fewer, 55
or fewer, 50 or fewer, 45 or fewer, 40 or fewer, 30 or fewer, 25 or
fewer, 20 or fewer, 19 or fewer, 18 or fewer, 17 or fewer, 16 or
fewer, 15 or fewer, 14 or fewer, 13 or fewer, 12 or fewer, 11 or
fewer, or 10 or fewer consecutive amino acids of an MSP. An MSP
alignment variant means that amino acids may be substituted in any
given MSP or MSP segment to make that position identical to the
same position in another MSP molecule including from diverse groups
of Nematoda. The segments may also be MSP alignment variant which
may be referred to herein as MSP alignment variant segments.
Functionally equivalent sequences and biological functional
equivalents are also generally considered to be within the spirit
and scope of the present invention and are described below.
[0094] Ranges of segments are also provided in certain embodiments
of the present invention. For example, a 10 amino acid segment may
be selected from any portion of the MSP polypeptide. An 11 amino
acid segment may be selected from any portion of the MSP
polypeptide. Segments of lengths including 9 amino acids
(consecutive in an MSP), 10, 12, 13, 14, 15, 16, 17, 18, 19, 20,
21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37,
38, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 55, 60, 65, 70, 75,
80, 85, 90, 95, 100, 105, 106, 110, 115, 116, 117, 118, 119, 120,
121, 122, 123, and 124 are contemplated for certain
embodiments.
[0095] These segments are generally screened for FSM activity or
used in assays to identify MSP binding agents (e.g., agents that
bind to specific domains) and to identify anti-nematode agents.
Although many segments are described, they can be screened readily
for FSM activity given the present disclosure and without undue
burden. A preferred method of screening is to utility
high-throughput assays such as in microtitre plates or other
multiple-sample format to rapidly examine a large number of
segments. Such general assay are known in the art and are provided
herein with regard to MSP and the embodiments of the present
invention.
[0096] 15.0 Description of Certain MSP Sequences
[0097] Numerous examples of MSP sequences (including polynucleotide
and polypeptide) are known in the art and are useful for various
embodiments of the present invention. Also, additional MSP
sequences including from additional nematodes types and species can
be readily determined, without burden, using conventional cloning
techniques and the fact that many sequences are described. Thus,
for example, primers can be designed to pull out additional
polynucleotides from a pool, such as a gene or genomic library,
including by PCR amplification. These polynucleotide can be
expressed using standard cloning techniques and the MSP activity of
the resulting polypeptide is measurable based upon the assays
disclosed herein. Certain known and described MSPs are provided by
way of example in Table 1 below. The MSPs are represented by
Accession Numbers corresponding to files in the publicly available
database maintained by the National Center for Biotechnology
Information (the NCBI database). These files include polynucleotide
sequences and polypeptide sequences of MSP. All information within
each file identified by Accession Number is hereby incorporated
herein by reference.
[0098] The NCBI database is available on the world wide web at URL
"http://www.ncbi.nlm.nih.gov/" and is physically located at:
National Center for Biotechnology Information; National Library of
Medicine; Building 38A, Room 8N805; Bethesda, Md. 20894
1TABLE 1 Nucleotide Protein Nematode Identifier Accession Numbers
Accession Numbers Mansonella ozzardi AJ404225 CAC20724 AJ404224
CAC20723 AJ404223 CAC20722 AJ404222 CAC20721 AJ404221 CAC20720
AJ404220 CAC20719 AJ404219 CAC20718 AJ404218 CAC20717 AJ404217
CAC20716 AJ404216 CAC20715 AJ404215 CAC20714 AJ404214 CAC20713
AJ404213 CAC20712 AJ404212 CAC20711 AJ404211 CAC20710 AJ404210
CAC20709 AJ404209 CAC20708 CAC20742 Onchocerca volvulus AJ404208
CAC20741 AJ404207 CAC20740 AJ404206 CAC20739 AJ404205 CAC20738
AJ404204 B45528 J04663 A45528 J04662 Ascaris suum X94249 A45944
P27439 P27440 AAB23264 CAA63933 Ascaris lumbricoides M15680
AAA29375 Globodera rostochiensis L24501 AAA29148 L24500 AAA29147
L24499 AAA29146 Pratylenchus penetrans AAB02264 AAB02263 AAB02262
AAB02251 AAB02250 AAB02249 Pratylenchus scribneri AAB02242 AAB02241
AAB02240 AAB02239
[0099] 16.0 An Assay for Female Sexual Maturation
[0100] A method is provided of identifying an anti-nematode agent,
by contacting a test compound to a nematode and monitoring a female
sexual maturation of the nematode, wherein inhibition of the female
sexual maturation indicates that the test compound includes the
anti-nematode agent.
[0101] The in vivo bioassay is useful, for example, to identify
sperm-related factors that promote oocyte maturation and gonadal
sheath cell contraction. The assay is also useful, as another
example, for identifying agents that inhibit nematode female sexual
maturation.
[0102] In certain embodiments of the assay, mutant nematodes are
utilized which have a reduced capacity for sperm production, or
lack the capacity altogether. Such mutants are disclosed to have
either low rates of oocyte maturation and sheath cell contraction
activity or none at all. The present invention provides
compositions and methods for using these mutants to screen for
factors that stimulate or inhibit female sexual maturation. In
similar embodiments, compositions and methods are provided that for
using transgenic nematodes. These embodiments are described in
detail below.
[0103] Test compounds include any compound in general. Preferred
test compounds are soluble in aqueous solution and thus conducive
to typical biological assay conditions. In certain embodiments,
test compounds are selected from any chemical in a library, for
example, as maintained by a pharmaceutical or other company. In
certain embodiments, test compounds, include proteins,
glycoproteins, polypeptides, glycopeptides, amino acids, nucleic
acids of any variety, including DNA, RNA, peptide nucleic acid
(PNA), carbohydrates, fatty acids, lipids, etc. In certain
embodiments the test compound includes any biologically active
molecule.
[0104] Test compounds are administered to nematodes by any
desirable method for determining which of the test compounds has an
inhibitory activity on nematode fertility, female sexual
maturation, or other activity described herein. For example, the
test compound can be microinjected, co-injected, incubated, or fed
to the nematodes. The assay measures the ability of specific test
compounds to inhibit MSP stimulation of oocyte maturation, gonadal
sheath cell contraction, and ovulation using optical monitoring. In
addition to ovulation, laying or releasing of oocytes or embryos
from the organism can be monitored optically and used as an
endpoint of test compound activity. The optical monitoring can be
enhanced using labeling reagents, such as fluorescent, radioactive,
or enzymatic labels. These labels can be attached using standard
chemistry known in the art to the test compound, a sperm, a major
sperm protein, the oocyte, a sheath cell, etc.
[0105] Methods for monitoring the FSM by video microscopy are
disclosed herein. Other methods for monitoring the FSM can include
by radiolabel assay, fluorescent assay, etc. (Miller et al.,
Science 2001).
[0106] Inhibition of FSM generally refers to a reduction or
termination in rate of an FSM event, in certain preferred
embodiments. In other embodiments, inhibition means reduction in
reproductive success, fecundity, etc. In other preferred
embodiments, inhibition results in control of a population of
nematodes including a free-living, parasitic, terrestrial, or an
aquatic nematodes population.
[0107] 17.0 Assay for Identifying Inhibitors of MSP Signaling
[0108] As described herein, an object of the present invention is
to provide assays for screening test compounds to identify
anti-nematode agents. In certain embodiments, the agents will be
inhibitors of female nematode fertility. In certain embodiments,
the agents will be inhibitors of an MSP signal transduction. Such
agents generally interfere with nematode fertility and are useful
as agents for control of nematodes including free-living and animal
and plant parasitic nematodes. Certain embodiments of screening
assays for inhibitors of MSP signal transduction follow.
[0109] 18.0 Mutant Nematode Strains
[0110] In general, MSP protein is administered to a mutant
hermaphrodite or female nematode strain that does not produce sperm
(e.g., mutants in fog-1, fog-2, fog-3, fem-1, fem-2, fem-3, or
gld-1(Fog). The MSP protein can be administered, for example, by
microinjection into the uterus of the mutant hermaphrodite or
female nematode strain. Such strains are available from the C.
elegans Genetic Center or natural isolates of gonochoristic
species. In embodiments that use microinjection, the technique is
carried out according to standard practice (e.g., see LaMunyon and
Ward, Genetics (1994) 138:689-692, incorporated herein by
reference). Female nematode sexual maturation, such as oocyte
maturation, sheath cell contraction, and ovulation are generally
observed optically. Certain methods are described by McCarter et
al., supra.
[0111] 19.0 Wild-Type Nematode Strains
[0112] In general, methods for screening test compounds for
identifying factors that inhibit nematode fertility, and preferably
that inhibit female sexual maturation, can be administered to
wild-type nematodes and the effect of the test compounds is usually
monitored optically. Typically, the test compounds can be
co-injected, incubated, or fed to nematodes. Ordinarily the
endpoint of the assay measures the ability of compounds to inhibit
MSP stimulation of oocyte maturation, gonadal sheath cell
contraction, and ovulation as described above.
[0113] 20.0 Transgenic Nematode Strains
[0114] Nematode strains that ectopically express MSP (including in
non-spermatogenic tissues) can be used in methods for screening
test factors to identify anti-nematode agents. Transgenic nematodes
expressing MSP are generated using standard methods (e.g., Methods
in Cell Biology, ed. H. Epstein and D. Shakes, San Diego Academic
Press, 452-482, incorporated by reference). Inhibitor compounds
are, for example, incubated with or fed to the transgenic
nematodes. The assay measures the ability of compounds to inhibit
nematode fertility including, but not limited to: MSP stimulation
of oocyte maturation, gonadal sheath cell contraction, and
ovulation as described above. Typically, the inhibition of nematode
fertility is measured optically. Test factors that inhibit MSP
signal transduction will inhibit the nematode female sexual
maturation. In addition, most transgenic strains produce different
amounts of the transgenic factor, as is known in the art. Thus,
nematodes that transgenically express varying amounts of MSP can be
utilized to determine anti-nematode agent concentrations that are
optimized for use on a particular nematode given that different
nematodes express varying levels of MSP in the wild.
[0115] 21.0 MSP Binding Assay
[0116] Compounds are screened for MSP binding affinity. Panels of
candidate molecules are affixed to a matrix, for example microtitre
wells, using standard methods. Labeled MSP protein, such as
fluorescently, radioactively, or enzymatically linked MSP protein,
is incubated with the compounds attached to the matrix, and then
washed off (under conditions that remove unbound labeled MSP
protein). Compounds which bind MSP are recognized by retention of
the label (for example, optical recognition). Alternatively, MSP
protein is affixed to a matrix, for example microtitre wells, and
incubated with labeled test compounds, such as fluorescently,
radioactively, or enzymatically linked compounds, and then washed
off, (under conditions that remove unbound labeled compound).
Compounds which bind MSP are recognized by retention of the
label.
[0117] In certain embodiments, compounds which bind MSP are then
tested for the ability to block MSP signaling, for example by using
bio-assays described herein. Compounds that inhibit or block
nematode reproduction or fertility are anti-nematode agents. In
certain embodiments, the anti-nematode agents are used to treat
parasitic nematode infections in plants and animals by
administering a therapeutically effective amount of the
anti-nematode agent to the plant or animal to inhibit, or in
certain cases to virtually block, nematode reproduction in the
infected plant or animal.
[0118] 22.0 Regulation of MSP Protein to Protein Interactions
[0119] Compounds are screened for the ability to regulate protein
to protein interactions of MSP. For example, MSP is known to exist
in monomeric and dimeric forms. Thus, test compounds are screened
in biological assays to identify factors that prevent dimerization,
multimerization (complexes with two or more MSP subunits), and for
factors that prevent multimers from dissociating into monomers. The
effect test compounds on multimer formation can be determined by
incubating the test compound with the MSP under multimer
associating and dissociating conditions. These samples can be
tested for biological activity in regard to nematode fertility as
described herein. Multimer and monomer formation and dissociation
can be monitored by techniques known in the art. For example, SDS
versus native gel electrophoresis (polyacrylamide gel
electrophoresis), electrospray mass spectroscopy, and gel
exclusion.
[0120] In certain embodiments, compounds which regulate
multimerization of MSP (formation and dissociation of
multimers/monomers) are then tested for the ability to block MSP
signaling. For example by using biological assays measuring
nematode female sexual maturation as described herein. Compounds
that inhibit nematode reproduction are anti-nematode agents. In
certain embodiments, the anti-nematode agents are used to treat
parasitic nematode infections in plants and animals by
administering a therapeutically effective amount of the
anti-nematode agent to the plant or animal to inhibit, or in
certain cases to virtually block, nematode reproduction in the
infected plant or animal.
[0121] 23.0 Certain Nematode Varieties
[0122] Nematoda includes the roundworms and threadworms, and
comprises a phylum of generally smooth-skinned, unsegmented worms
with a long cylindrical body shape tapered at the ends; the phylum
includes free-living and parasitic forms both aquatic and
terrestrial (adapted from Academic Press Dictionary of Science and
Technology).
[0123] Table 2, below, provides a listing of the common name and
scientific name of a multitude of nematode varieties. MSP genes and
proteins can be derived from these or other nematode varieties and
strains for use in conjunction with the present invention (e.g., in
a screening assay). Also, parasitic nematode infections of these or
other types of nematodes may be treated by anti-nematode agents
described herein or identified as described herein. This list is
not meant to be limited on the scope of the invention, but merely
to be exemplary of types of nematode. Animal parasitic nematodes
are also described in supplementary materials appended to this
provisional application.
2TABLE 2 Common Name Nematode Genus and species African spiral
nematode Helicotylenchus africanus Alfalfa root nematode Heterodera
goettingiana Almond cyst nematode Heterodera amygdali Amaranth cyst
nematode Cactodera amaranthi American dagger nematode Xiphinema
americanum Amu-Darya nematode Heterodera oxiana Apple cyst nematode
Globodera mali Apple root-knot nematode Meloidogyne mali Awl
nematodes Dolichodorus spp. Banana meadow nematode Pratylenchus
coffeae Banana nematode Pratylenchus musicola Banana root-lesion
nematode Pratylenchus coffeae Banana spiral nematode
Helicotylenchus multicinctus Banana-root nematode Radopholus
similis Barley cyst nematode Heterodera hordecalis Barley root-knot
nematode Meloidogyne nassi Beachgrass root-knot nematode
Meloidogyne sasseri Beer nematode Panagrellus silusiae Beet
nematode Heterodera schachtii Beet stem nematode Ditylenchus
dipsaci Begonia leaf nematode Aphelenchoides fragariae Bentgrass
nematode Anguina agrostis Bermudagrass cyst nematode Heterodera
cardiolata Birch cyst nematode Cactodera betulae Black currant
nematode Aphelenchoides ritzemabosi Blueberry root-knot nematode
Meloidogyne carolinensis Boxwood spiral nematode Rotylenchus
buxophilus Brassica root eelworm Heterodera cruciferae Brassica
root nematode Heterodera cruciferae Brazilian root-knot nematode
Meloidogyne exigua Brazilian root-knot nematode Meloidogyne
inornata British root-knot nematode Meloidogyne artiellia British
spiral nematode Scutellonema brachyurum Buckwheat cyst nematode
Heterodera graduni Bud and leaf nematodes Aphelenchoides spp. Bud
and stem nematode Ditylenchus dipsaci Bulb and stem nematodes
Ditylenchus spp. Bulb nematode Ditylenchus dipsaci Bulb or stem
nematodes Ditylenchus spp. Burrowing nematode Radopholus similis
Burrowing nematodes Radopholus spp. Cabbage cyst nematode
Heterodera cruciferae Cabbage nematode Heterodera cruciferae
Cabbage root nematode Heterodera cruciferae Cactus cyst nematode
Cactodera cacti Cajanus cyst nematode Heterodera cajani California
dagger nematode Xiphinema index California meadow nematode
Pratylenchus neglectus California root-lesion nematode Pratylenchus
neglectus California sessile nematode Cacopaurus epacris Camel
thorn cyst nematode Heterodera oxiana Camellia root-knot nematode
Meloidogyne camelliae Canadian root-knot nematode Meloidogyne
microtyla Carnation pin nematode Paratylenchus curvitatus Carnation
pin nematode Paratylenchus dianthus Carolina spiral nematode
Scutellonema brachyurum Carrot cyst nematode Heterodera carotae
Carrot root nematode Heterodera carotae Cereal cyst nematode
Heterodera avenae Cereal cyst nematode Heterodera latipons Cereal
root nematode Heterodera avenae Cereal root-knot nematode
Meloidogyne nassi Cereals root eelworm Heterodera major Cereals
root nematode Heterodera avenae Chamber's dagger nematode Xiphinema
chambersi Christie's spiral nematode Scutellonema christiei
Christie's stubby root nematode Trichodorus christiei Chrysanthemum
foliar nematode Aphelenchoides ritzemabosi Chrysanthemum leaf
nematode Aphelenchoides ritzemabosi Chrysanthemum nematode
Aphelenchoides ritzemabosi Citrus nematode Tylenchulus
semipenetrans Citrus ring nematode Criconemoides citri Citrus root
nematode Tylenchulus semipenetrans Citrus root-knot nematode
Meloidogyne indica Citrus spine nematode Criconema civellae Clover
cyst nematode Heterodera trifolii Clover root nematode Heterodera
trifolii Clover stem nematode Ditylenchus dipsaci Cobb's awl
nematode Dolichodorus heterocephalous Cobb's lance nematode
Hoplolaimus galeatus Cobb's meadow nematode Pratylenchus penetrans
Cobb's ring nematode Criconemoides simile Cobb's root lesion
nematode Pratylenchus penetrans Cobb's root-knot nematode Nacobbus
batatiformis Cobb's spiral nematode Helicotylenchus multicinctus
Cobb's stubby root nematode Trichodorus primitivus Coconut nematode
Rhadinaphelenchus cocophilus Coconut palm nematode
Rhadinaphelenchus cocophilus Cocopalm nematode Rhadinaphelenchus
cocophilus Coffee meadow nematode Pratylenchus coffeae Coffee
root-knot nematode Meloidogyne exigua Coffee root-lesion nematode
Pratylenchus coffeae Columbia nematode Hoplolaimus columbus
Columbia root-knot nematode Meloidogyne chitwoodi Corn cyst
nematode Heterodera zeae Corn meadow nematode Pratylenchus zeae
Corn root-lesion nematode Pratylenchus zeae Cotton root-knot
nematode Meloidogyne incognita acrita Cowpea cyst nematode
Heterodera vigni Crown-headed lance nematode Hoplolaimus
tylenchiformis Currant nematode Aphelenchoides ribes Cyperus cyst
nematode Heterodera mothi Cyst nematodes Globodera spp. Cyst
nematodes Heterodera spp. Cyst-forming nematodes Heterodera spp.
Cystoid body nematodes Meloidoderita spp. Cystoid nematodes
Meloidodera spp. Dagger nematodes Xiphinema spp. De Man's meadow
nematode Pratylenchus pratensis De Man's root-lesion nematode
Pratylenchus pratensis Dock cyst nematode Heterodera rosii Douglas
Fir nematode Nacobbodera chitwoodi Ear-cockle nematode Anguina
tritici Estonian cyst nematode Cactodera estonica Eucalypt cystoid
nematode Cryphodera eucalypti European dagger nematode Xiphinema
diversicaudatum False root-knot nematode of Nacobbus batatiformis
sugar beets False root-knot nematode Nacobbus spp. Fern nematode
Aphelenchoides fragariae Fern nematode Aphelenchoides olesistus
Fescue leaf gall nematode Anguina graminis Ficus cyst nematode
Heterodera fici Fig cyst nematode Heterodera fici Fig pin nematode
Paratylenchus hamatus Fig spine nematode Criconema decalineatum
Foliar nematodes Aphelenchoides spp. Galeopsis cyst nematode
Heterodera galeopsidis Galeopsis root nematode Heterodera
galeopsidis Gall-forming nematodes Meloidogyne spp. Godfrey's
meadow nematode Pratylenchus brachyurus Godfrey's root-lesion
nematode Pratylenchus brachyurus Gold-plated nematode Globodera
rostochiensis Golden nematode Globodera rostochiensis Golden
nematode of potato Globodera rostochiensis Grass cyst nematode
Punctodera punctata Grass root-gall nematode Subanguina radicicola
Grass sheath nematode Hemicycliophora similis Grass spiral nematode
Helicotylenchus erythrinae Great root nematode Heterodera avenae
Hairy-gall nematode Nacobbus batatiformis Heart-shaped cyst
nematode Heterodera cardiolata Hop cyst nematode Heterodera humuli
Hop nematode Heterodera humuli Hop root nematode Heterodera humuli
Horsenettle cyst nematode Globodera tabacum virginiae Indian
root-knot nematode Meloidogyne brevicauda Iris nematode Ditylenchus
destructor Japanese cyst nematode Heterodera elachista Javanese
root-knot nematode Meloidogyne javanica Kansas cyst nematode
Heterodera longicolla Kidney-shaped nematode Rotylenchulus
reniformis Kikuyu grass nematode Meloidogyne kikuyuensis Knapweed
nematode Mesoanguina picridis Knawel cyst nematode Heterodera
scleranthii Knotweed cyst nematode Cactodera weissi Kona coffee
root-knot nematode Meloidogyne konaensis Lance nematodes
Hoplolaimus spp. Lesion nematodes Pratylenchus spp. Lespedeza cyst
nematode Heterodera lespedezae Lucerne cyst nematode Heterodera
medicaginis Maple root-knot nematode Meloidogyne ovalis Meadow
nematodes Pratylenchus spp. Mediterranean cereal cyst nematode
Heterodera latipons Milfoil cyst nematode Globodera millefolii
Motha cyst nematode Heterodera mothi Mushroom nematode
Aphelenchoides composticola Mushroom spawn nematode Ditylenchus
myceliophagus Needle nematodes Longidorous spp. Nettle cyst
nematode Heterodera urticae Nigerian dagger nematode Xiphinema
nigeriense Northern root-knot nematode Meloidogyne hapla Nutgrass
cyst nematode Heterodera cyperi Oak root-knot nematode Meloidogyne
querciana Oak sheathoid nematode Hemicriconemoides biformis Oat
cyst nematode Heterodera avenae Oat cyst nematode Heterodera major
Oat nematode Heterodera avenae Oat root nematode Heterodera avenae
Onion stem nematode Ditylenchus dipsaci Osborne's cyst nematode
Globodera tabacum solanacearum Pacific dagger nematode Xiphinema
radicicola Pea cyst nematode Heterodera goettingiana Pea root
eelworm Heterodera goettingiana Pea root nematode Heterodera
goettingiana Peanut root-knot nematode Meloidogyne arenaria Persian
sessile nematode Cacopaurus pestis Phlox stem nematode Ditylenchus
dipsaci Pigeon pea cyst nematode Heterodera cajani Pin nematodes
Paratylenchus spp. Pine cystoid nematode Meloidodera floridensis
Pine sheathoid nematode Hemicriconemoides floridensis Pine sting
nematode Belonolaimus gracilis Pine wood nematode Bursaphelenchus
xylophilus Potato cyst eelworm Globodera rostochiensis Potato cyst
nematode Globodera pallida Potato cyst nematode Globodera
rostochiensis Potato nematode Globodera rostochiensis Potato root
eelworm Globodera rostochiensis Potato root nematode Globodera
rostochiensis Potato rot nematode Ditylenchus destructor Potato
tuber eelworm Ditylenchus destructor Potato tuber nematode
Ditylenchus destructor Pseudo root-knot nematode Hypsoperine
graminis Ramie pin nematode Paratylenchus elachistus Red ring
nematode Rhadinaphelenchus cocophilus Reniform nematode
Rotylenchulus reniformis Reniform nematodes Rotylenchulus spp. Rice
blind root nematodes Hirschmanniella spp. Rice cyst nematode
Heterodera oryzae Rice nematode Aphelenchoides oryzae Rice root
nematode Hirschmanniella oryzae Rice root-knot nematode Meloidogyne
graminicola Rice stem nematode Ditylenchus angustus Rice stunt
nematode Tylenchorhynchus martini Rice white-tip nematode
Aphelenchoides besseyi Rice-root nematode Radopholus oryzae Ring
nematodes Criconema spp. Ring nematodes Criconemoides spp. Root
nematodes Heterodera spp. Root nematodes Hirschmanniella spp.
Root-gall nematodes Meloidogyne spp. Root-knot nematodes
Meloidogyne spp. Root-lesion nematodes Pratylenchus spp. Round
cystoid nematode Thecavermiculatus andinus Rubber cyst nematode
Heterodera fici Rumex cyst nemtode Heterodera rumicis Scribner's
lesion nematode Pratylenchus scribneri Scribner's meadow nematode
Pratylenchus scribneri Scribner's root-lesion nematode Pratylenchus
scribneri Sedge cyst nematode Heterodera cyperi Seed gall nematode
Afrina wevelli Seed gall nematodes Anguina spp. Seed-gall nematode
Anguina tritici Seinhorst's stubby root nematode Trichodorus
pachydermis Sessile nematodes Cacopaurus spp. Seville root-knot
nematode Meloidogyne hispanica Sheath nematodes Hemicycliophora
spp. Sheathoid nematodes Hemicriconemoides spp. Shoot gall
nematodes Anguina spp. Smooth-headed lesion nematode Pratylenchus
brachyurus Smooth-headed meadow nematode Pratylenchus leiocephalus
Smooth-headed nematode Pratylenchus brachyurus Sorghum root-knot
nematode Meloidogyne acronea Sour paste nematode Panagrellus
redivivus South African pin nematode Paratylenchus curvitatus
Southern root-knot nematode Meloidogyne incognita Sowthistle cyst
nematode Heterodera sonchophila Soybean cyst nematode Heterodera
glycines Spear nematodes Dorylaimus spp. Spine nematodes Criconema
spp. Spiral nematodes Helicotylenchus spp. Spiral nematodes
Rotylenchus spp. Spiral nematodes Scutellonema spp. Spring crimp
nematode Aphelenchoides fragariae Spring dwarf nematode
Aphelenchoides besseyi Steiner's spiral nematode Helicotylenchus
dihystera Stem gall nematode Pterotylenchus cecidogenus Stem
nematode Ditylenchus dipsaci Sting nematode Belonolaimus gracilis
Sting nematode Belonolaimus longicaudatus Sting nematodes
Belonolaimus spp. Strawberry bud nematode Aphelenchoides besseyi
Strawberry bud nematode Aphelenchoides fragariae Strawberry foliar
nematode Aphelenchoides fragariae Strawberry nematode
Aphelenchoides fragariae Stubby root nematode Trichodorus christiei
Stubby root nematode Trichodorus kurumeensis Stubby root nematodes
Paratrichodorus spp. Stubby root nematodes Trichodorus spp. Stunt
nematode Tylenchorhynchus claytoni Stunt nematodes Tylenchorhynchus
spp. Stylet nematodes Tylenchorhynchus spp. Sugar beet cyst
nematode Heterodera schachtii Sugar beet nematode Heterodera
schachtii Sugar cane cyst nematode Heterodera sacchari Sugar cane
cyst nematode Heterodera schachtii Sugar cane stylet nematode
Tylenchorhynchus martini Summer dwarf nematode Aphelenchoides
fragariae Sycamore root-knot nematode Meloidogyne platani Tadzhik
cyst nematode Heterodera tadshikistanica Tadzhik cystoid nematode
Meloidodera tadshikistanica Tadzhik root-knot nematode Meloidogyne
tadshikistanica Tarjan's sheath nematode Hemicycliophora parvana
Tea root-knot nematode Meloidogyne brevicauda Teasel nematode
Ditylenchus dipsaci Tesselate stylet nematode Tylenchorhynchus
claytoni Thames' root-knot nematode Meloidogyne thamesi Thorne's
cyst nematode Cactodera thornei Thorne's lance nematode Rotylenchus
uniformis Thorne's meadow nematode Pratylenchus thornei Thorne's
needle nematode Longidorus sylphus Thorne's root-lesion nematode
Pratylenchus thornei Tobacco cyst nematode Globodera tabacum
Tobacco stunt nematode Tylenchorhynchus claytoni Tulip root
nematode Ditylenchus dipsaci Turf spiral nematode Rotylenchus
christiei Turkmen cyst nematode Heterodera turcomanica Ustinov cyst
nematode Heterodera ustinovi Valentine cyst nematode Heterodera
cardiolata Vinegar eels Turbatrix aceti Vinegar nematode Turbatrix
aceti Walnut meadow nematode Pratylenchus vulnus Walnut root-lesion
nematode Pratylenchus vulnus Walnut sessile nematode Cacopaurus
pestis Wesson's sheathoid nematode Hemicriconemoides wessoni West
African spiral nematode Scutellonema blaberum Wheat cyst nematode
Heterodera latipons Wheat gall nematode Anguina tritici White-tip
nematode Aphelenchoides besseyi Willow cyst nematode Heterodera
salixophila Yam nematode Scutellonema bradys Yarrow cyst nematode
Globodera achilleae Zimmerman's spiral nematode Helicotylenchus
erythrinae Zoysia spine nematode Criconema spinalineatum
[0124] 24.0 Treating a Parasitic Nematode Infection
[0125] In certain embodiments of the present invention, a parasitic
nematode infection is treated in an infected organism (including
plants and animals). A preferred method of treating a parasitic
nematode infection is to inhibit nematode fertility or reproduction
in the infected animal. In general, this is done by administering a
therapeutically effective amount of an anti-nematode agent as
described herein which disrupts a biological activity of MSP
related to female nematode sexual maturation. The anti-nematode
agent can be identified as described in the present invention.
[0126] In certain embodiments, a method of inhibiting a
reproduction of a nematode is provided, comprising inhibiting a
signal transduction of a major sperm protein of the nematode,
wherein the signal transduction stimulates a female sexual
maturation.
[0127] In certain embodiments, MSP signal transduction is inhibited
by a method comprising administering an MSP-specific antibody
(Several MSP-specific antibodies have been described in the art.
For example, see, Klass, M. R., and Hirsh, D. 1981. Sperm isolation
and biochemical analysis of the major sperm protein from
Caenorhabditis elegans. Dev. Biol. 84, 299-312, incorporated herein
by reference). (In certain examples, the MSP-specific antibody can
be administered by solublizing the antibody in the nematode's
environment or by microinjection into the uterus of the nematode.
Without being bound to mechanism or theory, these antibodies bind
MSP in vivo and inhibit MSP-mediated signaling. Experiments are
contemplated wherein hermaphrodite oocyte maturation and sheath
cell contraction rates will be compared to hermaphrodites injected
with an antibody which does not bind MSP (a suitable antibody for a
negative control experiment).
[0128] In certain embodiments, MSP signal transduction is inhibited
by administering a vaccine (especially in the case of treating an
animal) wherein the vaccine is developed to an MSP protein or
fragment thereof. Any variety of MSP protein, or fragment thereof,
can be used in vaccine development. Many nematode types are
described herein and the MSP or MSPs isolated therefrom may be
used. Vaccine development protocols are well known.
[0129] In certain embodiments the identified anti-nematode agent is
applied to crops including by spraying a field to distribute the
agent. The agent may gain access directly to the nematode or exist
in the soil, water, food or general environment of the nematode.
The agent may also be transferred to the nematode from a plant or
animal.
[0130] 25.0 Pharmaceutical Formulations
[0131] In certain embodiments, the preferred method of
administering a biologically active molecule (such as MSP or an
anti-nematode agent) is in combination with an excipient (a
pharmaceutically acceptable carrier). The combination of at least
one pharmaceutically acceptable carrier and at least one
biologically active molecule is referred to herein as a
pharmaceutical formulation.
[0132] The particular excipient is not believed to be critical as
long as it is compatible with the biological activity of the
biologically active molecule and compatible with administration to
the subject, especially plants, animals, human, and other mammals.
The choice of excipient depends on the nature of the treatment
being administered and the biologically active molecule. The
pharmaceutical formulation can be applied to the surface of the
organism being treated for a parasitic nematode infection or
injected into the local tissue either in one application or
multiple applications. The pharmaceutical formulation can be
combined with additional inert or carrier ingredients and used as a
topical salve. The pharmaceutical formulation may also be
aerosolized an administered through the lungs.
[0133] In certain preferred embodiments, a pharmaceutical
formulation is provided along with a method of applying a metered
amount of the formulation. For example, if a syringe may include
unit markings on the barrel of the syringe. Typically a syringe
will also include a needle and a plunger to form a device effective
for administration by injection. The particular choice of
pharmaceutically acceptable carrier can be made by one with skill
in the art, such as a treating physician, veterinarian, farmer, or
extension service personnel.
[0134] As used herein, "pharmaceutically acceptable carrier"
includes any and all solvents, dispersion media, coatings,
antibacterial and antifungal agents, isotonic and absorption
delaying agents and the like that are compatible with the
biologically active molecule(s) and with administration to the
organism being treated.
[0135] In certain embodiments, the pharmaceutical formulations of
the present invention are advantageously administered either as
liquid solutions or suspensions. Solid forms may be solubilized or
suspended in liquid prior to application or injection. These
preparations also may be emulsified. In certain embodiments, a
typical composition comprises about 50 mg or up to about 100 mg of
human serum albumin per milliliter of phosphate buffered saline.
Other pharmaceutically acceptable carriers include aqueous
solutions, salts, preservatives, buffers and the like. Examples of
non-aqueous solvents are propylene glycol, polyethylene glycol,
vegetable oil, and organic esters, such as theyloleate. Aqueous
carriers include water, alcoholic/aqueous solutions, and saline
solutions including sodium chloride, Ringer's dextrose, etc.
Preservatives include antimicrobial agents, anti-oxidants,
chelating agents and inert gases. The pH and exact concentration of
the various components in the pharmaceutical formulation are
adjusted according to well known parameters using well known
buffering and dilution agents.
[0136] 26.0 Production of Recombinant MSP Containing Vectors
[0137] Recombinant MSP bacterial strains were produced by cloning
MSP-142 and MSP-38 into the pQe-30 6-His vector from Qiagen.
Primers specific for MSP were made that contained a 5' BamHI site
(5' primer) or a 5' HindIII (3' primer) followed by the respective
MSP-coding sequences. MSP-38 and MSP-142 were amplified by PCR, cut
with BamHI and HindIII, and ligated into the pQe-30 vector (FIG. 6)
which was also cut with BamHI and HindIII. This strategy generated
a vector containing an IPTG-inducible promoter followed by an
initiator methionine, an N-terminal 6-His tag, and the respective
MSP-38 or MSP-142 coding sequences. This construct was then
transformed into M15(pREP4) bacterial cells and vector-containing
colonies were selected with LB medium containing Ampicillin and
Kanamycin. MSP-containing colonies were grown overnight and then
MSP expression was induced for 4 hours with 1 mM IPTG. Induced
bacteria were pelleted, lysed, and purified using a NiNTA agarose
column, which binds the 6-His tag. 6-His purification is known in
the art.
[0138] 27.0 Biological Functional Equivalents of Polynucleotides
and Polypeptides
[0139] As is known to one with skill in the art, the biological
function or activity of a gene product may not correspond directly
to an absolute polynucleotide or polypeptide sequence of the gene
product. Therefore, the inventor specifically contemplates that
alterations to sequences provided herein may be made or used
wherein the altered sequences, or methods of use thereof, are
equivalent to sequences, or methods of use thereof, and are within
the spirit and scope of the present invention. These equivalent
sequences are referred to as biologically functional equivalents,
or simply as functional equivalents. Functional equivalents can
include, but are not limited to: conservatively modified variants,
degeneracy of the nucleic acid code, polymorphisms, certain
insertions and deletions, and certain length variants. Methods for
altering sequence residues and testing the altered sequences for
function or activity are known in the art or described herein.
These alterations may be natural or made by the "hand of man".
[0140] At the nucleotide level, different codons can encode the
same amino acid. In other words, the genetic code is degenerate
(Alberts et al., Molecular Biology of the Cell, (1989) 2nd Edition,
Garland Publishing, Inc., and incorporated herein by reference).
The terms "wobble" and "nucleic acid degeneracy" are used herein to
refer to codons that encode the same amino acid, such as the six
codons for arginine or serine. Preferred human codons are provided
in materials appended to this application. Codon preferences for
other organisms also are well known to those of skill in the art
(Wada et al., 1990, supra). Thus, one with skill in the art knows
that two different polynucleotides can encode identical polypeptide
sequences due to codon wobble.
[0141] It is understood in the art that amino acid and nucleic acid
sequences may include additional residues, such as additional
N-terminal or C-terminal amino W acids or 5' or 3' sequences, and
yet still be essentially as set forth in one of the sequences
disclosed herein; so long as the sequence meets the criteria set
forth herein, including the maintenance of at least one biological
protein activity where protein expression is concerned (MSP
activity should include at least one type of stimulation of female
nematode sexual maturation). The addition of terminal sequences
particularly applies to nucleic acid sequences that may, for
example, include various non-coding sequences flanking either of
the 5' or 3' portions of the coding region or may include various
internal sequences, i.e., introns, which are known to occur within
genes between coding regions (Alberts et al., supra, incorporated
herein by reference). Thus; about 1, 2, 3, 4, 5, 6, 7, or more than
7 amino acids could be added to a polypeptide and the polypeptide
may still retain at least one biological activity. Or; about 1, 2,
3, 4, 5, 6, 7, or more than 7 nucleotides could be added to a
polynucleotide and expression products of the polynucleotide may
still retain at least one biological activity.
[0142] It also is understood in the art that amino acid and nucleic
acid residues may be removed from the N-terminal or C-terminal ends
of polypeptide or 5' or 3' ends of polynucleotide sequences, and
yet still be essentially as set forth in one of the sequences
disclosed herein; so long as the sequence meets the criteria set
forth herein, including the maintenance of at least one biological
protein activity of where protein expression is concerned (in
particular stimulating a female nematode sexual maturation with
regard to MSP). The removal of terminal sequences particularly
applies to nucleic acid sequences that may, for example, include
various non-coding sequences flanking either of the 5' or 3'
portions of the coding region or may include various internal
sequences, i.e., introns, which are known to occur within genes
between coding regions (Alberts et al., supra, incorporated herein
by reference). Thus; about 1, 2, 3, 4, 5, 6, 7, or more than 7
amino acids could be removed from a polypeptide and the polypeptide
may still retain at least one biological activity. Or, about 1, 2,
3, 4, 5, 6, 7, or more than 7 nucleotides could be removed from a
polynucleotide and expression products of the polynucleotide may
still retain at least one biological activity.
[0143] If desired, it is possible using techniques known to one
with skill in the art, to include an intron in a recombinant
polynucleotide sequence. For example, a bovine growth hormone (bGH)
intron including splice sites may be added. In certain instances,
the addition of an intron to a recombinant polynucleotide has been
observed to increase expression of the encoded expression product
in eukaryotic cells. It is understood that the addition of an
intron may create a functionally equivalent sequence.
[0144] It is further understood in the art that insertions and
deletions may be made within the amino acid and nucleic acid
sequence, and yet still be essentially as set forth in one of the
sequences disclosed herein; so long as the sequence meets the
criteria set forth herein, including the maintenance of biological
protein activity where protein expression is concerned (for MSP
this should be a stimulation of at least one female nematode sexual
maturation). It is preferred that the reading frame of a
polynucleotide sequence be maintained, as is known in the art
(Alberts et al., supra, incorporated herein by reference).
[0145] Excepting intronic or flanking regions, and allowing for the
degeneracy of the genetic code, sequences that have between about
70% and about 79%; or more preferably, between about 80% and about
89%; or more preferably, between about 90% and about 95% or more;
or even more preferably, between about 96% and about 99%, or more
of nucleotides being identical are homologous nucleic acids.
Homologous sequences may be functionally defined as sequences that
are capable of hybridizing to a nucleic acid segment under
relatively stringent conditions. Suitable relatively stringent
hybridization conditions are well known to those of skill in the
art. In certain embodiments, relatively stringent hybridization
conditions allow hybridization between sequences with about 70%
homology or more, but disrupt binding between sequences with less
than 70% homology. In certain embodiments, sequences that are
considered "essentially as set forth" in a sequence listed herein
are also biologically functional equivalents to the listed sequence
if at least one biological activity is found in common.
[0146] At the protein level, peptide sequences that are essentially
the same, in general, are capable of cross-reacting with antibody
raised against the respective peptide factor. Methods for
isolating, resolving, and analyzing protein/antibody interactions
are well known in the art including techniques such as SDS-PAGE and
Western analysis.
[0147] The nucleic acid segments of the present invention,
regardless of the length of the coding sequence itself, may be
combined with other DNA sequences (one or more of each), such as
promoters, polyadenylation signals, additional restriction enzyme
sites, multiple cloning sites, internal ribosome entry sites,
introns, other coding segments, membrane transport sequences, and
the like, such that their overall length may vary considerably. It
is therefore contemplated that a nucleic acid fragment of almost
any length may be employed, with the total length preferably being
limited by the ease of preparation and use in the intended
recombinant DNA protocol. Therefore, the terms "MSP gene" may also
comprise any combination of associated control sequences.
Furthermore, those skilled in the art of mutagenesis will
appreciate that other analogs, as yet undisclosed or undiscovered,
may be used to construct MSP analogs (mutants, variants, etc).
Additional meaning of biological functional equivalents,
similarity, percent similarity, equivalents, substantially
identical sequences, essentially the same, and essentially similar
sequences and activities are described in U.S. Pat. No. 5,922,688
to Hung et al., incorporated herein by reference.
[0148] Naturally, the present invention also encompasses peptides
and polypeptides (or the nucleic acid sequences that encode such
peptides and polypeptides) that contain conservatively modified
variants of sequences of interest, for example, a MSP sequence. One
with skill in the art is able to determine conservative sequence
modifications. In the case of a polypeptide, amino acid
substitutions, such as those which might be employed in modifying a
peptide, such as MSP, are generally based on the relative
similarity of the amino acid side-chain substituents, for example,
their hydrophobicity, hydrophilicity, charge, size, and the
like.
[0149] An analysis of the size, shape and type of the amino acid
side-chain substituents reveals that arginine, lysine and histidine
are all positively charged residues; that alanine, glycine and
serine are all a similar size; and that phenylalanine, tryptophan
and tyrosine all have a generally similar shape. Therefore, based
upon these considerations, arginine, lysine and histidine; alanine,
glycine and serine; and phenylalanine, tryptophan and tyrosine; are
defined herein as conservative amino acid changes or substitutions.
In general, conservatively modified variants of a sequence may
include one or more conservative amino acid change or
substitution.
[0150] In making such changes, the hydropathic index of amino acids
may be considered. Each amino acid has been assigned a hydropathic
index on the basis of their hydrophobicity and charge
characteristics, these are: isoleucine (+4.5); valine (+4.2);
leucine (+3.8); phenylalanine (+2.8); cysteine/cystine (+2.5);
methionine (+1.9); alanine (+1.8); glycine (-0.4); threonine
(-0.7); serine (-0.8); tryptophan (-0.9); tyrosine (-1.3); proline
(-1.6); histidine (-3.2); glutamate (-3.5); glutamine (-3.5);
aspartate (-3.5); asparagine (-3.5); lysine (-3.9); and arginine
(-4.5).
[0151] The importance of the hydropathic amino acid index in
conferring interactive biological function on a protein is
generally understood in the art (Kyte et al., J. Mol. Biol. (1982)
157(1):105-32, incorporated herein by reference). It is known that
certain amino acids may be substituted for other amino acids having
a similar hydropathic index or score and still retain a similar
biological activity. In making changes based upon the hydropathic
index, the substitution of amino acids whose hydropathic indices
are within .+-.2 is preferred, those which are within .+-.1 are
particularly preferred, and those within .+-.0.5 are even more
particularly preferred.
[0152] It also is understood in the art that the substitution of
like amino acids can be made effectively on the basis of
hydrophilicity. U.S. Pat. No. 4,554,101 to Hopp, incorporated
herein by reference, states that the greatest local average
hydrophilicity of a protein, as governed by the hydrophilicity of
its adjacent amino acids, correlates with its immunogenicity and
antigenicity, i.e. with a biological property of the protein. It is
understood that an amino acid can be substituted for another having
a similar hydrophilicity value and still obtain a biologically
equivalent protein.
[0153] As detailed in U.S. Pat. No. 4,554,101, supra, the following
hydrophilicity values have been assigned to amino acid residues:
arginine (+3.0); lysine (+3.0); aspartate (+3.0.+-.1); glutamate
(+3.0.+-.1); serine (+0.3); asparagine (+0.2); glutamine (+0.2);
glycine (0); threonine (-0.4); proline (-0.5.+-.1); alanine (-0.5);
histidine (-0.5); cysteine (-1.0); methionine (-1.3); valine
(-1.5); leucine (-1.8); isoleucine (-1.8); tyrosine (-2.3);
phenylalanine (-2.5); tryptophan (-3.4).
[0154] In making changes based upon similar hydrophilicity values,
the substitution of amino acids whose hydrophilicity values are
within .+-.2 is preferred, those which are within .+-.1 are
particularly preferred, and those within .+-.0.5 are even more
particularly preferred.
[0155] While discussion has focused on conservatively modified
variant polypeptides and functionally equivalent polypeptides
arising from amino acid changes, it will be appreciated that these
changes may be effected by alteration of the encoding
polynucleotide; taking into consideration also that the genetic
code is degenerate and that two or more codons may code for the
same amino acid.
[0156] 28.0 Sequence Modification Techniques
[0157] Modifications to sequences, such as MSP sequences, may be
made during chemical synthesis of the polymers (either nucleotide
or peptide synthesis). It is believed, however, that site-directed
mutagenesis of an encoding nucleic acid, creating a suitably
altered polynucleotide sequence is the most cost effective method
of generating an altered polynucleotide sequence. Where the MSP
protein is desired, then the mutated sequence may be expressed
including in culture (in vitro or ex vivo) or in vivo.
[0158] Site-directed mutagenesis is a technique useful in the
preparation of individual peptides, or biologically functional
equivalent proteins or peptides, through specific mutagenesis of
the underlying DNA. Several methods for site directed mutagenesis
are described in U.S. Pat. No. 4,873,192 to Kunkel, incorporated
herein by reference and in U.S. Pat. No. 4,351,901 to Ball,
incorporated herein by reference. The technique further provides a
ready ability to prepare and test sequence variants, for example,
incorporating one or more of the foregoing considerations, by
introducing one or more nucleotide sequence changes into the DNA.
Site-specific mutagenesis allows the production of mutants through
the use of specific oligonucleotide sequences which encode the DNA
sequence of the desired mutation, as well as a sufficient number of
adjacent nucleotides, to provide a primer sequence of sufficient
size and sequence complexity to form a stable duplex on both sides
of the deletion junction being traversed. Typically, a primer of
about 14 to about 25 nucleotides in length is preferred, with about
5 to 10 residues on both sides of the junction of the sequence
being altered. The primers can be selected by one with ordinary
skill in the art based upon information provided herein, including
the Sequence Listings and Figures.
[0159] The technique of site-specific mutagenesis is well known in
the art as exemplified by publications (Adelman et al., (1983) DNA
2(3)183-193, incorporated herein by reference). As will be
appreciated, the technique typically employs a phage vector which
exists in both a single stranded and double stranded form. Typical
vectors useful in site-directed mutagenesis include vectors such as
the M13 phage. These phage are readily commercially available and
their use is well known to those skilled in the art. Double
stranded plasmids are also routinely employed in site directed
mutagenesis which eliminates the step of transferring the gene of
interest from a plasmid to a phage. Kits for phage based site
directed mutagenesis are commercially available. In addition PCR
based methods which may, or may not, involve phage are known in the
art and kits for such purposes are commercially available.
[0160] In certain known techniques, site-directed mutagenesis is
performed by first obtaining a single-stranded vector or melting
apart the two strands of a double stranded vector which includes
within its sequence a DNA sequence which encodes the desired
nucleotide, such as MSP. An oligonucleotide primer bearing the
desired mutated sequence is prepared, generally synthetically as is
known to one of ordinary skill in the art. This primer is then
annealed with the single-stranded vector, and subjected to DNA
polymerizing enzymes such as Escherichia coli (E. coli) polymerase
I Klenow fragment, in order to complete the synthesis of the
mutation-bearing strand. Thus, a heteroduplex is formed wherein one
strand encodes the original non-mutated sequence and the second
strand bears the desired mutation. This heteroduplex vector is then
used to transform appropriate cells, such as E. coli cells, and
clones are selected which include recombinant vectors bearing the
mutated sequence arrangement. Various selection methods that
increase the percentage of specifically modified clones over
wild-type are known and available commercially.
[0161] Kalderon et al. (1984) report several mutagenic methods
which have proved useful in mutating the native LT gene.
Specifically, Kalderon et al. teach deletion mutations by
displacement-loop mutagenesis and by the random insertion of Eco RI
linkers into the LT gene. Further, point mutation by deletion-loop
mutagenesis is taught. The reference also teaches screening
procedures for determining the success of such mutations. The
teachings of Kalderon et al. (1984) Virology 139(1)109-137 are
incorporated herein by reference.
[0162] The preparation of sequence variants of the selected gene
using site-directed mutagenesis is provided as a method of
producing potentially useful nucleic acids and peptides (such as
MSP and MSP variants) and is not meant to be limiting as there are
other ways in which sequence variants of these nucleotide and
peptides may be obtained. For example, recombinant vectors encoding
the desired genes may be treated with mutagenic agents to obtain
sequence variants for the mutagenesis of plasmid DNA using
hydroxylamine or random mutagenesis may be performed using the PCR
technique.
[0163] Sequence analysis of a potentially mutant nucleic acid
sequence is carried out by methods known in the art, typically by
either Sanger dideoxy sequencing (Sanger et al., PNAS (1977)
74:5363-5467, incorporated herein by reference; U.S. Pat. No.
4,871,929 to Barnes; and U.S. Pat. No. 4,962,020 to Tabor et al.,
each patent incorporated herein by reference) or automated
sequencing (U.S. Pat. No. 5,365,455 to Tibbetts et al.,
incorporated herein by reference).
[0164] In addition to the MSP peptidyl compounds described herein,
the inventors also contemplate that other sterically similar
compounds may be formulated to mimic the key portions of the
peptide structure. Such compounds may be used in the same manner as
the peptides of the invention and hence are also functional
equivalents. The generation of a structural functional equivalent
may be achieved by the techniques of modeling and chemical design
known to those of skill in the art. It will be understood that all
such sterically similar constructs fall within the scope of the
present invention.
[0165] Livestock include, but are not limited to: horses, work
horses, show horses, cattle, sheep, goats, and the like. Pets
include, but are not limited to: dogs, cats, horses, birds, and the
like.
EXAMPLES
Example 1
[0166] Large quantities of sperm (generally >108) are purified
using a modification of methods developed by Klass and Hirsh
(1981). Adult males are identified using synchronized cultures
(Lewis and Flemming, 1995) of fog-2(q71), which are 50% male and
50% female. Mutations in the fog-2 gene block spermatogenesis in
)XX animals, transforming them into females, but have no effect on
XO animals, which are fertile males (Schedl and Kimble, 1988).
Males are separated from females, larvae, and embryos based on size
by sieving through NITEX screens of various pore sizes. The
populations of males isolated in this way are generally >99%
pure. To isolate sperm, males are placed between two PLEXIGLASS
plates and smashed in a vice grip (The Home Depot, Inc.). Intact
sperm are then purified from the carcasses by filtration through
NITEX filters (20 micron pore size) and washed in M9 phosphate
buffer (Sulston and Hodgkin, 1988) using several rounds of low
speed centrifugation (e.g., 10,000 xg) and resuspension.
Sperm-conditioned medium (SCM) is prepared by incubating purified
sperm in M9 for different periods of time (1-12 h) and subsequently
removing the sperm by centrifugation and filtration through a 0.2
micron filter. Microscopic analysis suggests that the sperm are not
lysing during the incubation. Polyacrylamide gel electrophoresis
(PAGE) further indicaets that the sperm are not lysing during the
incubation, but that a 14 kDa protein is enriched in SCM (FIG.
2).
REFERENCES
[0167] All references, articles, U.S. patents, Non-U.S. patents,
exhibits and the like referred to herein, including those listed
below or attached, are hereby incorporated herein by reference in
their entirety.
[0168] Achanzar, W. E., and Ward, S. (1997). A nematode gene
required for sperm vesicle fusion. Journal of Cell Science 110:
1073-1081.
[0169] Albertson, D. G. (1984). Formation of the first cleavage
spindle in nematode embryos. Developmental Biology 101: 61-72.
[0170] Albertson, D. G., and Thomson, J. N. (1993). Segregation of
holocentric chromosomes at meiosis in the nematode, Caenorhabditis
elegans. Chromosome Research 1: 15-26.
[0171] Anderson, E., and Albertini, D. F. (1976). Gap junctions
between the oocyte and companion follicle cells in the mammalian
ovary. Journal of Cell Biology 71: 680-686.
[0172] Argon, Y., and Ward, S. (1980). C. elegans
fertilization-defective mutants with abnormal sperm. Genetics 96:
413-433.
[0173] Aroian, R. V., Field, C., Pruliere, G., Kenyon, C., and
Alberts, B. M. (1997). Isolation of actin-associated proteins from
Caenorhabditis elegans oocytes and their localization in the early
embryo. EMBO Journal 16: 1541-1549.
[0174] Aruffo, A., and Seed, B. (1987). Molecular cloning of a CD28
cDNA by a high-efficiency COS cell expression system. Proceedings
of the National Academy of Sciences U S A 84: 8573-8577.
[0175] Austin, J., and Kimble, J. (1987). glp-1 is required in the
germ line for regulation of the decision between mitosis and
meiosis in C. elegans. Cell 51: 589-599.
[0176] Barton, M. K., and Kimble, J. (1990). fog-1, a regulatory
gene required for specification of spermatogenesis in the germ line
of Caenorhabditis elegans. Genetics 125: 29-39.
[0177] Bashir, R., Britton, S., Strachan, T., Keers, S., Vafiadaki,
E., Lako, M., Richard, I., Marchand, S,. Bourg, N., Argov, Z.,
Sadeh, M., Mahjneh, I., Marconi, G., Passos-Bueno, M. R., Moreira,
E. de S., Zatz, M., Beckmann, J. S., and Bushby, K. (1998). A gene
related to Caenorhabditis elegans spermatogenesis factor fer-1 is
mutated in limb-girdle muscular dystrophy type 2B. Nature Genetics
20: 37-42.
[0178] Blaxter, M. (1998). Caenorhabditis elegans is a nematode.
Science 282: 2041-2046.
[0179] Boxem, M., Srinivasan, D. G., and van den Heuvel, S. (1999).
The Caenorhabditis elegans gene ncc-1 encodes a cdc2-related kinase
required for M phase in meiotic and mitotic cell divisions, but not
for S phase. Development 126: 2227-2239.
[0180] Brenner, S. (1974). The genetics of Caenorhabditis elegans.
Genetics 77: 71-94.
[0181] Browning, H., and Strome, S. (1996). A sperm-supplied factor
required for embryogenesis in C. elegans. Development 122:
391-404.
[0182] Bullock, T. L., Roberts, T. M., and Stewart, M. (1996). 2.5
A resolution crystal structure of the motile major sperm protein
(MSP) of Ascaris suum. Journal of Molecular Biology 263:
284-296.
[0183] C. elegans Sequencing Consortium. (1998). Genome sequence of
the nematode Caenorhabditis elegans: A platform for investigating
biology. Science 282: 2012-2018.
[0184] Cadigan, K. M., and Nusse, R. (1997). Wnt signaling: a
common theme in animal development. Genes and Development 11:
3286-3305.
[0185] Chase, D., Serafinas, C., Ashcroft, N., Kosinski, M., Longo,
D., Ferris, D. K., and Golden, A. (2000). The polo-like kinase
PLK-1 is required for nuclear envelope breakdown and the completion
of meiosis in Caenorhabditis elegans. Genesis: The Journal of
Genetics and Development 26: 26-41.
[0186] Chen, P. J., Singal, A., Kimble, J., and Ellis, R. E.
(2000). A novel member of the Tob family of proteins controls
sexual fate in Caenorhabditis elegans germ cells. Developmental
Biology 217: 77-90.
[0187] Church, D. L., Guan, K.-L., and Lambie, E. J. (1995). Three
genes of the MAP kinase cascade, mek-2, mpk-1/sur-1 and let-60 ras,
are required for meiotic cell cycle progression in Caenorhabditis
elegans. Development 121: 2525-2535.
[0188] Clandinin, T. R., DeModena, J. A., and Sternberg, P. W.
(1998). Inositol triphosphate mediates a RAS-independent response
to LET-23 receptor tyrosine kinase activation in C. elegans. Cell
92: 523-533.
[0189] Colledge, W. H., Carlton, M. B. L., Udy, G. B., and Evans,
M. J. (1994). Disruption of c-mos causes parthenogenetic
development of unfertilized mouse eggs. Nature 370: 65-68.
[0190] Cordero, M. M., Cornish, T. J., Cotter, R. J., and Lys, I.
A. (1995). Sequencing peptides without scanning the reflectron:
post-source decay with a curved-field reflectron time-of-flight
mass spectrometer. Rapid Communications in Mass Spectrometry 9:
1356-1361.
[0191] Coulson, A., Huynh, C., Kozono, Y., and Shownkeen, R.
(1995). The physical map of the Caenorhabditis elegans genome. In:
Epstein, H. F., and Shakes, D. C., editors. Methods in Cell
Biology. Caenorhabditis elegans: Modern Biological Analysis of an
Organism. San Diego: Academic Press. p. 533-550.
[0192] Cross, D. A., and Smythe, C. (1998). PD98059 prevents
establishment of the spindle assembly checkpoint and inhibits the
G2-M transition in meiotic but not mitotic cell cycles in Xenopus.
Experimental Cell Research 241: 12-22.
[0193] Davis, S., Aldrich, T. H., Valenzuela, D. M., Wong, V. V.,
Furth, M. E., Squinto, S. P., and Yancopoulos, G. D. (1991). The
receptor for ciliary neurotrophic factor. Science 253: 59-63.
[0194] Dernburg, A. F., McDonald, K., Moulder, G., Barstead, R.,
Dresser, M., and Villeneuve, A. M. (1998). Meiotic recombination in
C. elegans initiates by a conserved mechanism and is dispensable
for homologous chromosome synapsis. Cell 94: 387-398.
[0195] Ellis, R. E., and Kimble, J. (1995). The fog-3 gene and
regulation of cell fate in the germ line of Caenorhabditis elegans.
Genetics 139: 561-577.
[0196] Ferby, I., Blazquez, M., Palmer, A., Eritja, R., and
Nebreda, A. R. (1999). A novel p34(cdc2)-binding and activating
protein that is necessary and sufficient to trigger G(2)/M
progression in Xenopus oocytes. Genes and Development 13:
2177-2189.
[0197] Ferrell, J. E., Jr. (1999). Xenopus oocyte maturation: new
lessons from a good egg. BioEssays 21: 833-842.
[0198] Ferrell, J. E., Jr., Wu, M., Gerhart, J. C., and Martin, G.
S. (1991). Cell cycle tyrosine phosphorylation of p34cdc2 and a
microtubule-associated protein kinase homolog in Xenopus oocytes
and eggs. Molecular and Cellular Biology 11: 1965-1971.
[0199] Fire, A., Xu, S., Montgomery, M. K., Kostas, S. A., Driver,
S. E, and Mello, C. C. (1998). Potent and specific genetic
interference by double-stranded RNA in Caenorhabditis elegans.
Nature 391: 806-811.
[0200] Fisher, D. L., Brassac, T., Galas, S., and Doree, M. (1999).
Dissociation of MAP kinase activation and MPF activation in
hormone-stimulated maturation of Xenopus oocytes. Development 126:
4537-4546.
[0201] Francis, R., Barton, M. K., Kimble, J., and Schedl, T.
(1995). gld-1, a tumor suppressor gene required for oocyte
development in Caenorhabditis elegans. Genetics 139: 579-606.
[0202] Gavrilets, G., Nature 403, 886 (2000).
[0203] Godeau, J. F., Schorderet-Slatkine, S., Hubert, P., and
Baulieu, E. E. (1978). Induction of maturation in Xenopus laevis
oocytes by a steroid linked to a polymer. Proceedings of the
National Academy of Sciences USA 75: 2353-2357.
[0204] Gotob, Y., Masuyama, N., Dell, K., Shirakabe, K., and
Nishida, E. (1995). Initiation of Xenopus oocyte maturation by
activation of the mitogen-activated protein kinase cascade. Journal
of Biological Chemistry 270: 25898-25904.
[0205] Gotoh, Y., Moriyama, K., Matsuda, S., Okumura, E.,
Kishimoto, T., Kawasaki, H., Suzuki, K., Yahara, I., Sakai, H., and
Nishida, E. (1991). Xenopus M phase MAP kinase: isolation of its
cDNA and activation by MPF. EMBO Journal 10 :2661-2668.
[0206] Grant, B., and Hirsh, D. (1999). Receptor-mediated
endocytosis in the Caenorhabditis elegans oocyte. Molecular Biology
of the Cell 10: 4311-4326.
[0207] Greenstein, D., Hird, S., Plasterk, R. H. A., Andachi, Y.,
Kohara, Y., Wang, B., Finney, M., and Ruvkun, G. (1994). Targeted
mutations in the Caenorhabditis elegans POU homeo box gene ceh-18
cause defects in oocyte cell cycle arrest, gonad migration, and
epidermal differentiation. Genes and Development 8: 1935-1948.
[0208] Greenstein, D., unpublished results.
[0209] Gross, S. D., Schwab, M. S., Taieb, F. E., Lewellyn, A. L.,
Qian, Y. W., and Mailer, J. L. (2000). The critical role of the MAP
kinase pathway in meiosis II in Xenopus oocytes is mediated by
p90(Rsk). Current Biology 10: 430-438.
[0210] Haaf, A., Butler, P. J., Kent, H. M., Fearnley, I. M.,
Roberts, T. M., Neuhaus, D., and Stewart, M. (1996). The motile
major sperm protein (MSP) from Ascaris suum is a symmetric dimer in
solution. Journal of Molecular Biology 260: 251-260.
[0211] Haccard, O., Lewellyn, A., Hartley, R. S., Erikson, E., and
Maller, J. L. (1995). Induction of Xenopus oocyte meiotic
maturation by MAP kinase. Developmental Biology 168: 677-682.
[0212] Hall, D. H., Winfrey, V. P., Blaeuer, G., Hoffman, L. H.,
Furuta, T., Rose, K. L., Hobert, O., and Greenstein, D. (1999).
Ultrastructural features of the adult hermaphrodite gonad of
Caenorhabditis elegans: relations between the germ line and soma.
Developmental Biology 212: 101-123.
[0213] Hashimoto, N., Watanabe, N., Furuta, Y., Tamemoto, H.,
Sagata, N., Yokoyama, M., Okazaki, K., Nagayoshi, M., Takeda, N.,
Ikawa, Y., and Aizawa, S. (1994). Parthenogenetic activation of
oocytes in c-mos deficient mice. Nature 370: 68-71.
[0214] Hill, D. P., Shakes, D. C., Ward, S., and Strome, S. (1989).
A sperm-supplied product essential for initiation of normal
embryogenesis in Caenorhabditis elegans is encoded by the
paternal-effect embryonic-lethal gene, spe-11. Developmental
Biology 136: 154-166.
[0215] Hill, K. L. and L'Hernault, S. W., submitted.
[0216] Hirsh, D., Oppenheim, D., and Klass, M. (1976). Development
of the reproductive system of Caenorhabditis elegans. Developmental
Biology 49: 200-219.
[0217] Holst, P. A., and Phemister, R. D. (1971). The prenatal
development of the dog: Preimplantation events. Biology of
Reproduction 5: 194-206.
[0218] Hooper, N. M., and Bashir, A. (1991).
Glycosyl-phosphatidylinositol- -anchored membrane proteins can be
distinguished from transmembrane polypeptide-anchored proteins by
differential solubilization and temperature-induced phase
separation in Triton X-114. Biochemical Journal 280: 745-751.
[0219] Huang, W., Kessler, D. S., and Erikson, R. L. (1995).
Biochemical and biological analysis of Mek1 phosphorylation site
mutants. Molecular Biology of the Cell 6: 237-245.
[0220] Hubbard, E. J. A., and Greenstein, D. (2000). The C. elegans
gonad: a test tube for cell and developmental biology.
Developmental Dynamics 218: 2-22.
[0221] Hyttel, P., Farstad, W., Mondain-Monval, M., Bakke Lajord,
K., and Smith, A. J. (1990). Structural aspects of oocyte
maturation in the blue fox (Alopex lagopus). Anatomy and Embryology
181, 325-331.
[0222] Ishikawa, K., Hanaoka, Y., Kondo, Y., and Imai, K. (1977).
Primary action of steroid hormone at the surface of amphibian
oocyte in the induction of germinal vesicle breakdown. Molecular
and Cellular Endocrinology 9: 91-100.
[0223] Italiano, J. E., Jr., Roberts, T. M., Stewart, M., and
Fontana, C. A. (1982). Reconstitution in vitro of the motile
apparatus from the amoeboid sperm of Ascaris shows that filament
assembly and bundling move membranes. Cell 84: 105-114.
[0224] Jansen, G., Hazendonk, E., Thijssen, K. L., and Plasterk, R.
H. (1997). Reverse genetics by chemical mutagenesis in
Caenorhabditis elegans. Nature Genetics 17: 119-121.
[0225] Kagiwada, S., Hosaka, K., Murata, M., Nikawa, J., and
Takatsuki, A. (1998). The Saccharomyces cerevisiae SCS2 gene
product, a homolog of a synaptobrevin-associated protein, is an
integral membrane protein of the endoplasmic reticulum and is
required for inositol metabolism. Journal of Bacteriology 180:
1700-1708.
[0226] Kanatani, H., Shirai, H., Nakanishi, K., and Kurokawa, T.
(1969). Isolation and identification on meiosis inducing substance
in starfish Asterias amurensis. Nature 221: 273-274.
[0227] Kaufmann, R., Spengler, B., and Lutzenkirchen, F. (1993).
Mass spectrometric sequencing of linear peptides by product-ion
analysis in a reflectron time-of-flight mass spectrometer using
matrix-assisted laser desorption ionization. Rapid Communications
in Mass Spectrometry 7: 902-910.
[0228] Kimble, J., and Hirsh, D. (1979). The postembryonic cell
lineages of the hermaphrodite and male gonads in Caenorhabditis
elegans. Developmental Biology 70: 396-417.
[0229] Kirby, C., Kusch, M., and Kemphues, K. (1990). Mutations in
the par genes of Caenorhabditis elegans affect cytoplasmic
reorganization during the first cell cycle. Developmental Biology
142: 203-215.
[0230] Klass, M. R., and Hirsh, D. (1981). Sperm isolation and
biochemical analysis of the major sperm protein from C. elegans.
Developmental Biology 84: 299-312.
[0231] Kosako, H., Gotoh, Y., and Nishida, E. (1994). Requirement
for the MAP kinase kinase/MAP kinase cascade in Xenopus oocyte
maturation. EMBO Journal 3: 2131-2138.
[0232] LaMunyon, C. W., and Ward, S. (1994). Assessing the
viability of mutant and manipulated sperm by artificial
insemination of Caenorhabditis elegans. Genetics 138: 689-692.
[0233] Laurent, F., Labesse, G., and de Wit, P. (2000). Molecular
cloning and partial characterization of a plant VAP33 homologue
with a major sperm protein domain. Biochemical and Biophysical
Research Communications 270: 286-292.
[0234] Lee, M. -H. and Schedl, T., unpublished results.
[0235] Lewis, J. A., and Flemming, J. T. (1995). Basic culture
methods. In: Epstein, H. F., and Shakes, D. C., editors. Methods in
Cell Biology. Caenorhabditis elegans: Modern Biological Analysis of
an Organism. San Diego: Academic Press. p. 3-29.
[0236] L'Hernault, S. W. (1997). Spermatogenesis. In: Riddle, D.
L., Blumenthal, T., Meyer, B. J., and Priess, J. R., editors. C.
elegans II. Cold Spring Harbor, New York: Cold Spring Harbor
Laboratory Press. p. 271-294.
[0237] L'Hernault, S. W., and Roberts, T. M. (1995). Cell biology
of nematode sperm. In: Epstein, H. F., and Shakes, D. C., editors.
Methods in Cell Biology. Caenorhabditis elegans: Modern Biological
Analysis of an Organism. San Diego: Academic Press. p. 273-301.
[0238] L'Hernault, S. W., Arduengo, P. M., J. Cell Biol. 119, 55
(1992).
[0239] Lin, R. J., Kao, H. Y., Ordentlich, P., and Evans, R. M.
(1998). The transcriptional basis of steroid physiology. Cold
Spring Harbor Symposium on Quantitative Biology 63: 577-585.
[0240] Liu, X., Kim, C. N., Yang, J., Ronald Jemmerson, R., and
Wang, X. (1996). Induction of apoptotic program in cell-free
extracts: requirement for dATP and cytochrome c. Cell 86:
147-157.
[0241] MacMorris, M., Spieth, J., Madej, C., Lea, K., and
Blumenthal, T. (1994). Analysis of the VPE sequences in the
Caenorhabditis elegans vit-2 promoter with extrachromosomal tandem
array-containing transgenic strains. Molecular and Cellular Biology
14: 484-491.
[0242] Masui, Y., and Clarke, H. J. (1979). Oocyte maturation.
International Review of Cytology 57: 185-282.
[0243] Masui, Y., and Markert, C. L. (1971). Cytoplasmic control of
nuclear behavior during meiotic maturation of frog oocytes. Journal
of Experimental Zoology 177: 129-145.
[0244] McCarter, J., Bartlett, B., Dang, T., and Schedl, T. (1997).
Soma-germ cell interactions in Caenorhabditis elegans: Multiple
events in germline development require the somatic sheath and
spermathecal lineages. Developmental Biology 181: 121-143.
[0245] McCarter, J., Bartlett, B., Dang, T., and Schedl, T. (1999).
On the control of oocyte meiotic maturation and ovulation in C.
elegans. Developmental Biology 205: 111-128.
[0246] Mendez, R., Hake, L. E., Andresson, T., Littlepage, L. E.,
Ruderman, J. V., and Richter, J. D. (2000). Phosphorylation of CPE
binding factor by Eg2 regulates translation of c-mos mRNA. Nature
404: 302-307.
[0247] Miller, M. A., Nguyen V. Q., Lee, M., Kosinski, M., Schedl,
M., Caprioli, R. M., and Greenstein D. (2001) A Sperm Cytoskeletal
Protein That Signals Oocyte Meiotic Maturation and Ovulation.
Science 2001 291: 2144-2147.
[0248] Morgan, D. 0. (1997). Cyclin-dependent kinases: engines,
clocks, and microprocessors. Annual Review of Cell and
Developmental Biology 13: 261-291.
[0249] Muhlrad, D., Hunter, R., and Parker, R. (1992). A rapid
method for localized mutagenesis of yeast genes. Yeast 8:
79-82.
[0250] Mukherjee, S., Ghosh, R. N., and Maxfield, F. R. (1997).
Endocytosis. Physiology Reviews 77: 759-803.
[0251] Munson, P. J., and Rodbard, D. (1980). Ligand: a versatile
computerized approach for characterization of ligand-binding
systems. Analytical Biochemistry 107: 220-239.
[0252] Myers, C. D., Goh, P. -Y., Allen, T. St. C., Bucher, E. A.,
and Bogaert, T. (1996). Developmental genetic analysis of Troponin
T mutations in striated and nonstriated muscle cells of
Caenorhabditis elegans. Journal of Cell Biology 132: 1061-1077.
[0253] Nance, J., Minniti, A. N., Sadler, C., and Ward, S. (1999).
spe-12 encodes a sperm cell surface protein that promotes
spermiogenesis in Caenorhabditis elegans. Genetics 152:
209-220.
[0254] Nelson, G. A., Roberts, T. M., and Ward, S. (1982). C.
elegans spermatozoan locomotion: Amoeboid movement with almost no
actin. Journal of Cell Biology 92: 121-131.
[0255] Nelson, G. A., and Ward, S. (1980). Vesicle fusion,
pseudopod extension and amoeboid motility are induced in nematode
spermatids by the ionophore monensin. Cell 19: 457-464.
[0256] Palmer, A. and Nebreda, A. R., Prog. Cell Cycle Res.4, 131
(2000).
[0257] Pandey, A., and Mann, M. (2000). Proteomics to study genes
and genomes. Nature 405: 837-846.
[0258] Pavalko, F. M., and Roberts, T. M. (1989). Posttranslational
insertion of a membrane protein on Caenorhabditis elegans sperm
occurs without de novo protein synthesis. Journal of Cellular
Biochemistry 41: 57-70.
[0259] Podbilewicz, B. (1996). ADM-1, a protein with
metalloprotease- and disintegrin-like domains, is expressed in
syncytial organs, sperm, and sheath cells of sensory organs in
Caenorhabditis elegans. Molecular Biology of the Cell 7:
1877-1893.
[0260] Posada, J., and Cooper, J. A. (1992). Requirements for
phosphorylation of MAP kinase during meiosis in Xenopus oocytes.
Science 255: 212-215.
[0261] Qian, Y. W., Erikson, E., and Maller, J. L. (1999). Mitotic
effects of a constitutively active mutant of the Xenopus polo-like
kinase Plx1. Molecular and Cellular Biology 19: 8625-8632.
[0262] Ramalho-Santos, J., et al., Dev. Biol. 223, 54 (2000).
[0263] Resing, K. A., Mansour, S. J., Hermann, A. S., Johnson, R.
S., Candia, J. M., Fukasawa, K., Vande Woude, G. F., and Ahn, N. G.
(1995). Determination of v-Mos-catalyzed phosphorylation sites and
autophosphorylation sites on MAP kinase kinase by ESI/MS.
Biochemistry 34: 2610-2620.
[0264] Roberts, T. M. (1983). Crawling C. elegans spermatozoa
contact the substrate only by their pseudopods and contain 2-nm
filaments. Cell Motility 3: 333-347.
[0265] Roberts, T. M., Pavalko, F. M., and Ward, S. (1986).
Membrane and cytoplasmic proteins are transported in the same
organelle complex during nematode spermatogenesis. Journal of Cell
Biology 102: 1787-1796.
[0266] Roberts, T. M., and Stewart, M. (1995). Nematode sperm
locomotion. Current Opinion in Cell Biology 7: 13-17.
[0267] Roberts, T. M., and Stewart, M. (2000). Acting like actin.
The dynamics of the nematode major sperm protein (msp) cytoskeleton
indicate a push-pull mechanism for amoeboid cell motility. Journal
of Cell Biology 149: 7-12.
[0268] Roberts, T. M., and Ward, S. (1982a). Membrane flow during
nematode spermiogenesis. Journal of Cell Biology 92: 113-120.
[0269] Roberts, T. M., and Ward, S. (1982b). Centripetal flow of
pseudopodial surface components could propel the amoeboid movement
of C. elegans spermatozoa. Journal of Cell Biology 92: 132-138.
[0270] Rose, K. L., Winfrey, V. P., Hoffman, L. H., Hall, D. H.,
Furuta, T., and Greenstein D. (1997). The POU gene ceh-18 promotes
gonadal sheath cell differentiation and function required for
meiotic maturation and ovulation in Caenorhabditis elegans.
Developmental Biology 192: 59-77.
[0271] Rutledge, E., Bianchi, L., Christensen, M., Morrison, R.,
Broslat, A., Beld, A., George Jr., A. L., Greenstein, D., and
Strange, K. (2000). CLH-3: a C. elegans ClC-2 chloride channel
orthologue regulated by cell cycle events and involved in
soma-germline intercellular signaling. Submitted.
[0272] Sagata, N. (1997). What does Mos do in oocytes and somatic
cells? BioEssays 19: 13-21.
[0273] Sagata, N., Oskarsson, M., Copeland, T., Brumbaugh, J., and
Vande Woude, G. F. (1988). Function of c-mos proto-oncogene product
in meiotic maturation in Xenopus oocytes. Nature 335:519-525.
[0274] Sagata, N., Watanabe, N., Vande Woude, G. F., and Ikawa, Y.
(1989). The c-mos proto-oncogene product is a cytostatic factor
responsible for meiotic arrest in vertebrate eggs. Nature 342:
512-518.
[0275] Schagger, H., and von Jagow, G. (1987). Tricine-sodium
dodecyl sulfate-polyacrylamide gel electrophoresis for the
separation of proteins in the range from 1 to 100 kDa. Analytical
Biochemistry 166: 368-379.
[0276] Schedl, T., and Kimble, J. (1988). fog-2, a
germ-line-specific sex determination gene required for
hermaphrodite spermatogenesis in C. elegans. Genetics 119:
43-61.
[0277] Schulz, J. R., et al., J. Biol. Chem. 273, 24355 (1998).
[0278] Seed, B., and Aruffo, A. (1987). Molecular cloning of the
CD2 antigen, the T-cell erythrocyte receptor, by a rapid
immunoselection procedure. Proceedings of the National Academy of
Sciences USA 84: 3365-3369.
[0279] Shakes, D. C., and Ward, S. (1989). Initiation of
spermiogenesis in C. elegans: A pharmacological and genetic
analysis. Developmental Biology 134: 189-200.
[0280] Sheets, M. D., Wu, M., and Wickens, M. (1995).
Polyadenylation of c-mos mRNA as a control point in Xenopus meiotic
maturation. Nature 374: 511-516.
[0281] Skehel, P. A., Armitage, B. A., Bartsch, D., Hu, Y., Kaang,
B. K., Siegelbaum, S. A., Kandel, E. R., and Martin, K. C. (1995).
Proteins functioning in synaptic transmission at the sensory to
motor synapse of Aplysia. Neuropharmacology 34: 1379-1385.
[0282] Skehel, P. A. et al., Science 269, 1580 (1995).
[0283] Smith, H. E., and Ward, S. (1998). Identification of
protein-protein interactions of the major sperm protein (MSP) of
Caenorhabditis elegans. Journal of Molecular Biology 279:
605-619.
[0284] Smith, L. D., and Ecker, R. E. (1969). Role of the oocyte
nucleus in physiological maturation in Rana pipiens. Developmental
Biology 19: 281-309.
[0285] Smith, L. D., and Ecker, R. E. (1971). The interaction of
steroids with Rana pipiens oocytes in the induction of maturation.
Developmental Biology 25: 232-247.
[0286] Soussan, L. et al., J. Cell Biol. 146, 301 (1999).
[0287] Spector, D. L., Goldman, R. D., and Leinwand, L. A. (1998).
Plasma membrane isolation using the cationic colloidal silica
isolation technique. In Culture and Biochemical Analysis of Cells.
K. Janssen, editor. p. 35.1-35.14. Cold Spring Harbor Laboratory
Press: Plainview, N.Y.
[0288] Starck, J., Gibert, M. -A., Brun, J., and Bosch C. (1983),
Ribosomal RNA synthesis and processing during oogenesis of the free
living nematode C. elegans. Comparative Biochemistry and Physiology
75B: 575-580.
[0289] Stebbins-Boaz, B., Hake, L. E., and Richter, J. D. (1996).
CPEB controls the cytoplasmic polyadenylation of cyclin, Cdk2 and
c-mos mRNAs and is necessary for oocyte maturation in Xenopus. EMBO
Journal 5: 2582-2592.
[0290] Strome, S. (1986). Fluorescence visualization of the
distribution of microfilaments in gonads and early embryos of the
nematode C. elegans. Journal of Cell Biology 103: 2241-2252.
[0291] Sulston, J., and Hodgkin, J. (1988). Methods. In The
Nematode Caenorhabditis elegans. W. B. Wood, editor, p. 587-606.
Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.
[0292] Swofford, D., "PAUP: Phylogenetic analysis using parsimony."
Illinois National History Survey, Champaign (1993).
[0293] Vacquier, V. D., Science 281, 1995 (1998).
[0294] Veenstra, J. A. (2000). Mono- and dibasic proteolytic
cleavage sites in insect neuroendocrine peptide precursors.
Archives of Insect Biochemistry and Physiology 43: 49-63.
[0295] Ward, S. (1986). Asymmetric localization of gene products
during the development of C. elegans spermatozoa. In Gametogenesis
and the Early Embryo. 44th Symposium of the Society for
Developmental Biology. Gall, J. G., (ed). p.55-75. Alan R. Liss,
NY.
[0296] Ward, S., Argon, Y., and Nelson, G. A. (1981). Sperm
morphogenesis in wild-type and fertilization-defective mutants of
C. elegans. Journal of Cell Biology 91: 26-44.
[0297] Ward, S., Burke, D. J., Sulston, J. E., Coulson, A. R.,
Albertson, D. G., Ammons, D., Klass, M., and Hogan, E. (1988).
Genomic organization of major sperm protein genes and pseudogenes
in the nematode Caenorhabditis elegans. Journal of Molecular
Biology 199, 1-13.
[0298] Ward, S., and Carrel, J. S. (1979). Fertilization and sperm
competition in the nematode Caenorhabditis elegans. Developmental
Biology 73: 304-321.
[0299] Ward, S., Hogan, E., and Nelson, G. A. (1983). The
initiation of spermiogenesis in the nematode C. elegans.
Developmental Biology 98: 70-79.
[0300] Ward, S., and Klass, M. (1982). The location of the major
protein in C. elegans sperm and spermatocytes. Developmental
Biology 92: 203-208.
[0301] Ward, S., and Miwa, J. (1978). Characterization of
temperature-sensitive, fertilization-defective mutants of the
nematode C. elegans. Genetics 88: 285-303.
[0302] Ward, S., Roberts, T. M., Strome, S., Pavalko, F. M., and
Hogan, E. (1986). Monoclonal antibodies that recognize a
polypeptide antigenic determinant shared by multiple C. elegans
sperm-specific proteins. Journal of Cell Biology 102:
1778-1786.
[0303] Wimalawansa, S. J. (1995). Purification and biochemical
characterization of Neuropeptide Y2 receptor. The Journal of
Biological Chemistry 270: 18523-18530.
[0304] Wolf, N., Hirsh, D., and McIntosh, J. R. (1978).
Spermatogenesis in males of the free-living nematode, C. elegans.
Journal of Ultrastructure Research 63: 155-169.
[0305] Yasunaga, S., Grati, M., Cohen-Salmon, M., El-Amraoui, A.,
Mustapha, M., Salem, N., El-Zir, E., Loiselet, J., and Petit, C.
(1999). A mutation in OTOF, encoding otoferlin, a FER-1-like
protein, causes DFNB9, a nonsyndromic form of deafness. Nature
Genetics 21:363-369.
[0306] Yew, N., Mellini, M. L., and Vande Woude, G. F. (1992).
Meiotic initiation by the mos protein in Xenopus. Nature 355:
649-652.
[0307] Yung, Y., et al., FEBS Lett. 408, 292 (1997).
[0308] 4. To prepare SCM, purified sperm (26) were incubated in M9
buffer (.about.5.times.10.sup.7 sperm/ml) for 1-16 hrs at
20.degree. C. Sperm were removed by centrifugation for 5 min at
14,000 rpm in an Eppendorf microcentrifuge (model 5415C) and
filtration through a 0.22 .mu.m cellulose acetate filter (Costar).
Samples (.about.50 pl) were microinjected into the uterus of
fog-2(q71) (3) adult females (30 hrs post-L4 at 20.degree. C.).
Following injection, females were anesthetized for 20 minutes with
0.1% tricaine/0.01% tetramisole (32) in M9. Oocyte maturation and
sheath cell contraction rates were monitored by time-lapse video
microscopy (1) for 70 minutes.
[0309] 5. SCM or sperm lysates (by vortexing with glass beads) were
fractionated on C.sub.4 and C.sub.18 columns (Vydac) using an
acetonitrile gradient (0-100%) mobile phase. TFA (0.1%) was added
to the mobile phase to sharpen peaks by ion pairing. Absorbance
peaks (214 nm) were collected manually, dialyzed against M9, and
bioassayed. Active fractions were analyzed by MALDI-TOF mass
spectrometry using internal molecular weight standards (insulin,
cytochrome C and myoglobin).
[0310] 6. Post source decay mass spectrometry (33) of a 1960 Da
peptide, generated by tryptic digestion of the active fraction,
yielded the sequence IVFNAPYDDKHTYHIK, which matched MSP.
[0311] 9. His-tagged MSP-77, MSP-38, and MSP(1-106) were expressed
in Escherichia coli M15[pRep4] (Qiagen) and purified under native
conditions by Ni-NTA affinity chromatography (>99% pure by
SDS-PAGE and mass spectrometry). The extinction coefficient c (275
nm) of MSP was estimated by amino acid analysis of a purified
His-tagged MSP-77 standard. MSP concentrations were determined by
amino acid hydrolysis, SDS-PAGE, and spectrophotometrically using
.epsilon. (275 nm)=3.29.times.10.sup.4M.sup.- -1cm.sup.-1.
[0312] 10. Anti-MSP (26) or control EMB-30 antibodies (34) were
injected (.about.40 .mu.g/ml) into adult wild-type N2
hermaphrodites (24 hr post-L4 at 20.degree. C.). The injected
animals were cultured individually with food for a 3 hr time period
and total ovulations were determined. The effect of antibody
injection on oocyte maturation was determined by time lapse video
microscopy. A two-sample t-test was used to compare results of MSP
injections with controls.
[0313] 12. The C-terminal MSP peptide (EWFQGDGMVRRKNLPIEYNP) was
prepared by solid-phase synthesis and purified by HPLC (Research
Genetics).
[0314] 15. Diphosphorylated MAP kinase was detected in dissected
and fixed (3% paraformaldehyde) gonadal preparations using indirect
immunofluorescence with the antibody MAPK-YT (35) (Sigma). In C.
elegans preparations, MAPK-YT only recognizes mpk-1 map kinase gene
products (36). Gonads were stained 8, 40, or 50 min post MSP
injection. Activated MAP kinase was detected 40 and 50 min
post-injection but was not detectable 8 min post injection.
[0315] 22. Phylogenetic analyses were performed using maximum
parsimony and neighbor-joining methods. Amino acid sequences from
MSP and MSP-like domains of several representative VAPs were used
in the analyses. For parsimony, the heuristic search option of
PAUP* 3.1 (37) was used for tree construction, with 200 random
order taxon addition replicates and tree bisection and reconnection
branch swapping. Bacterial PapD, which is structurally related to
MSP, was used as the outgroup. The "protpars" matrix of PAUP* 3.1
was used to weigh amino acid substitutions. To obtain bootstrap
values, 100 bootstrap replicates were performed using simple taxon
addition with tree bisection and reconnection branch swapping.
[0316] The present invention is not limited by mechanism or theory.
Although there have been described general and specific embodiments
of the invention herein, these embodiments do not limit the scope
of the invention except as set forth in the claims below.
* * * * *
References