U.S. patent application number 09/828746 was filed with the patent office on 2002-03-07 for novel compounds.
Invention is credited to Chapman, Conrad Gerald, Meadows, Helen Jane.
Application Number | 20020028485 09/828746 |
Document ID | / |
Family ID | 26151120 |
Filed Date | 2002-03-07 |
United States Patent
Application |
20020028485 |
Kind Code |
A1 |
Meadows, Helen Jane ; et
al. |
March 7, 2002 |
Novel compounds
Abstract
h-TREK1 polypeptides and polynucleotides and methods for
producing such polypeptides by recombinant techniques are
disclosed. Also disclosed are methods for utilizing h-TREK1
polypeptides and polynucleotides in therapy, and diagnostic assays
for such.
Inventors: |
Meadows, Helen Jane;
(Upminster, GB) ; Chapman, Conrad Gerald;
(Orpington, GB) |
Correspondence
Address: |
Ratner & Prestia
P.O. Box 980
Valley Forge
PA
19482-0980
US
|
Family ID: |
26151120 |
Appl. No.: |
09/828746 |
Filed: |
April 9, 2001 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
09828746 |
Apr 9, 2001 |
|
|
|
09236080 |
Jan 25, 1999 |
|
|
|
6242217 |
|
|
|
|
Current U.S.
Class: |
435/69.1 ;
435/325; 435/6.14; 435/7.1; 514/12.2; 514/16.4; 514/17.6; 514/17.8;
514/18.3; 514/19.3; 514/44R; 536/23.5 |
Current CPC
Class: |
A61K 38/00 20130101;
C07K 14/705 20130101 |
Class at
Publication: |
435/69.1 ;
435/325; 435/6; 435/7.1; 514/44; 514/12; 536/23.5 |
International
Class: |
C12Q 001/68; G01N
033/53; C07H 021/04; C12P 021/02; C12N 005/06 |
Foreign Application Data
Date |
Code |
Application Number |
Jan 27, 1998 |
EP |
98300570.3 |
Oct 9, 1998 |
GB |
9822135.1 |
Claims
What is claimed is:
1. An isolated polypeptide selected from the group consisting of:
(i) an isolated polypeptide comprising an amino acid sequence
selected from the group having at least: (a) 97% identity; (b) 98%
identity; or (c) 99% identity; to the amino acid sequence of SEQ ID
NO:2 over the entire length of SEQ ID NO:2; (ii) an isolated
polypeptide comprising the amino acid sequence of SEQ ID NO:2;
(iii) an isolated polypeptide which is the amino acid sequence of
SEQ ID NO:2; (iv) an isolated polypeptide comprising the amino acid
sequence of SEQ ID NO:6 or (v) an isolated polypeptide which is the
amino acid sequence of SEQ ID NO:6.
2. An isolated polynucleotide selected from the group consisting
of: (i) an isolated polynucleotide comprising a nucleotide sequence
encoding a polypeptide that has at least (a) 97% identity; (b) 98%
identity; or (c) 99% identity; to the amino acid sequence of SEQ ID
NO:2, over the entire length of SEQ ID NO:2; (ii) an isolated
polynucleotide comprising a nucleotide sequence that has at least:
(a) 90% identity; or (b) 95% identity; over its entire length to a
nucleotide sequence encoding the polypeptide of SEQ ID NO:2; (iii)
an isolated polynucleotide comprising a nucleotide sequence which
has at least: (a) 90% identity; or (b) 95% identity; to that of SEQ
ID NO:1 over the entire length of SEQ ID NO:1; (iv) an isolated
polynucleotide comprising a nucleotide sequence encoding the
polypeptide of SEQ ID NO:2; (v) an isolated polynucleotide which is
the polynucleotide of SEQ ID NO:1; or (vi) an isolated
polynucleotide obtainable by screening an appropriate library under
stringent hybridization conditions with a labelled probe having the
sequence of SEQ ID NO:1or a fragment thereof.; (vii) an isolated
polynucleotide comprising a nucleotide sequence that has at least:
95% identity over its entire length to a nucleotide sequence
encoding the polypeptide of SEQ ID NO:6; (viii) an isolated
polynucleotide comprising a nucleotide sequence which has at least:
95% identity to that of SEQ ID NO:5 over the entire length of SEQ
ID NO:5; (ix) an isolated polynucleotide comprising a nucleotide
sequence encoding the polypeptide of SEQ ID NO:6; (x) an isolated
polynucleotide which is the polynucleotide of SEQ ID NO:5; or (xi)
an isolated polynucleotide obtainable by screening an appropriate
library under stringent hybridization conditions with a labelled
probe having the sequence of SEQ ID NO:5 or a fragment thereof.; or
a nucleotide sequence complementary to said isolated
polynucleotide.
3. An antibody immunospecific for the polypeptide of claim 1.
4. A method for the treatment of a subject: (i) in need of enhanced
activity or expression of the polypeptide of claim 1 comprising:
(a) administering to the subject a therapeutically effective amount
of an agonist to said polypeptide; and/or (b) providing to the
subject an isolated polynucleotide comprising a nucleotide sequence
encoding said polypeptide in a form so as to effect production of
said polypeptide activity in vivo.; or (ii) having need to inhibit
activity or expression of the polypeptide of claim 1 comprising:
(a) administering to the subject a therapeutically effective amount
of an antagonist to said polypeptide; and/or (b) administering to
the subject a nucleic acid molecule that inhibits the expression of
a nucleotide sequence encoding said polypeptide; and/or (c)
administering to the subject a therapeutically effective amount of
a polypeptide that competes with said polypeptide for its ligand,
substrate, or receptor.
5. A process for diagnosing a disease or a susceptibility to a
disease in a subject related to expression or activity of the
polypeptide of claim 1 in a subject comprising: (a) determining the
presence or absence of a mutation in the nucleotide sequence
encoding said polypeptide in the genome of said subject; and/or (b)
analyzing for the presence or amount of said polypeptide expression
in a sample derived from said subject.
6. A method for screening to identify compounds which stimulate or
which inhibit the function of the polypeptide of claim 1 which
comprises a method selected from the group consisting of: (a)
measuring the binding of a candidate compound to the polypeptide
(or to the cells or membranes bearing the polypeptide) or a fusion
protein thereof by means of a label directly or indirectly
associated with the candidate compound; (b) measuring the binding
of a candidate compound to the polypeptide (or to the cells or
membranes bearing the polypeptide) or a fusion protein thereof in
the presense of a labeled competitor; (c) testing whether the
candidate compound results in a signal generated by activation or
inhibition of the polypeptide, using detection systems appropriate
to the cells or cell membranes bearing the polypeptide; (d) mixing
a candidate compound with a solution containing a polypeptide of
claim 1, to form a mixture, measuring activity of the polypeptide
in the mixture, and comparing the activity of the mixture to a
standard; or (e) detecting the effect of a candidate compound on
the production of mRNA encoding said polypeptide and said
polypeptide in cells, using for instance, an ELISA assay.
7. An agonist or an antagonist of the polypeptide of claim 1.
8. An expression system comprising a polynucleotide capable of
producing a polypeptide of claim 1 when said expression system is
present in a compatible host cell.
9. A process for producing a recombinant host cell comprising
transforming or transfecting a cell with the expression system of
claim 8 such that the host cell, under appropriate culture
conditions, produces a polypeptide selected from the group
consisting of: (i) a polypeptide comprising an amino acid sequence
having at least 97% identity to the amino acid sequence of SEQ ID
NO:2 over the entire length of SEQ ID NO:2; or (ii) a polypeptide
comprising an amino acid sequence having the sequence of SEQ ID
NO:6.
10. A recombinant host cell produced by the process of claim 9.
11. A membrane of a recombinant host cell of claim 10 expressing a
polypeptide selected from the group consisting of: (i) a
polypeptide comprising an amino acid sequence having at least 97%
identity to the amino acid sequence of SEQ ID NO:2 over the entire
length of SEQ ID NO:2; or (ii) a polypeptide comprising an amino
acid sequence having the sequence of SEQ ID NO:6.
12. A process for producing a polypeptide comprising culturing a
host cell of claim 10 under conditions sufficient for the
production of said polypeptide and recovering the polypeptide from
the culture.
13. An isolated polynucleotide selected form the group consisting
of (a) an isolated polynucleotide comprising a nucleotide sequence
which has at least 90%, 95%, 97% identity to SEQ ID NO:3 over the
entire length of SEQ ID NO:3; (b) an isolated polynucleotide
comprising the polynucleotide of SEQ ID NO:3; (c) the
polynucleotide of SEQ ID NO:3; or (d) an isolated polynucleotide
comprising a nucleotide sequence encoding a polypeptide which has
at least 99% identity to the amino acid sequence of SEQ ID NO:4,
over the entire length of SEQ ID NO:4.
14. A polypeptide selected from the group consisting of: (a) a
polypeptide which comprises an amino acid sequence which has at
least 99% identity to that of SEQ ID NO:4 over the entire length of
SEQ ID NO:4; (b) a polypeptide which has an amino acid sequence
which is at least 99% identity to the amino acid sequence of SEQ ID
NO:4 over the entire length of SEQ ID NO:4; (c) a polypeptide which
comprises the amino acid of SEQ ID NO:4; (d) a polypeptide which is
the polypeptide of SEQ ID NO:4; or (e) a polypeptide which is
encoded by a polynucleotide comprising the sequence contained in
SEQ ID NO:3.
Description
FIELD OF THE INVENTION
[0001] This invention relates to newly identified polypeptides and
polynucleotides encoding such polypeptides, to their use in therapy
and in identifying compounds which may be agonists, antagonists and
/or inhibitors which are potentially useful in therapy, and to
production of such polypeptides and polynucleotides.
BACKGROUND OF THE INVENTION
[0002] The drug discovery process is currently undergoing a
fundamental revolution as it embraces `functional genomics`, that
is, high throughput genome- or gene-based biology. This approach is
a means to identify genes and gene products as therapeutic targets
is rapidly superseding earlier approaches based on `positional
cloning`. A phenotype, that is a biological function or genetic
disease, would be identified and this would then be tracked back to
the responsible gene, based on its genetic map position.
[0003] Functional genomics relies heavily on high-throughput DNA
sequencing technologies and the various tools of bioinformatics to
identify gene sequences of potential interest from the many
molecular biology databases now available. There is a continuing
need to identify and characterise further genes and their related
polypeptides/proteins, as targets for drug discovery.
SUMMARY OF THE INVENTION
[0004] The present invention relates to h-TREK1, in particular
h-TREK1 polypeptides and h-TREK1 polynucleotides, recombinant
materials and methods for their production. In another aspect, the
invention relates to methods for using such polypeptides and
polynucleotides, including the treatment of cancer, pulmonary
disease, cardiovascular diseases, inflammatory diseases, renal
disease, pain, psychiatric disorders including depression and
schizophrenia, neurodegenerative disease including Alzheimer's,
stroke and head trauma and neurological disorders including
migraine, hereinafter referred to as "the Diseases", amongst
others. In a further aspect, the invention relates to methods for
identifying agonists and antagonists/inhibitors using the materials
provided by the invention, and treating conditions associated with
h-TREK1 imbalance with the identified compounds. In a still further
aspect, the invention relates to diagnostic assays for detecting
diseases associated with inappropriate h-TREK1 activity or
levels.
DESCRIPTION OF THE INVENTION
[0005] In a first aspect, the present invention relates to h-TREK1
polypeptides. Such polypeptides include isolated polypeptides
comprising an amino acid sequence which has at least 97% identity,
preferably 98%, most preferably 99% to that of SEQ ID NO:2 over the
entire length of SEQ ID NO:2. Such polypeptides include those
comprising the amino acid of SEQ ID NO:2.
[0006] Further polypeptides of the present invention include
isolated polypeptides in which the amino acid sequence has at least
97% identity, preferably at least 98% identity, most preferably at
least 99% identity, to the amino acid sequence of SEQ ID NO:2 over
the entire length of SEQ ID NO:2. Such polypeptides include the
polypeptide of SEQ ID NO:2.
[0007] Further polypeptides of the present invention are
polypeptides that comprise the sequence of SEQ ID NO:6 or
polypeptides that have the sequence of SEQ ID NO:6.
[0008] Further peptides of the present invention include isolated
polypeptides encoded by a polynucleotide comprising the sequence
contained in SEQ ID NO:1 or SEQ ID NO:5.
[0009] Polypeptides of the present invention are believed to be
members of the potassium channel family of polypeptides. They are
therefore of interest because potassium channels are a ubiquitous
group of ion channels that are important in controlling
excitability and modulating secretory processes. They have a number
of roles including neuronal integration, volume regulation,
maintenance of the resting membrane potential and an important role
in determining the frequency and duration of action potentials. The
changes in cell excitability that follow modulation of potassium
channels give rise to a broad number of potential therapeutic uses
of such modulators. One example is the potassium channel blocker,
dofetilide, which is an effective antiarrhythmic. A new structural
family of potassium channels has recently been identified which
includes the mouse TREK1 (Fink et al., EMBO J., 15: 6854-6862,
1996). These properties are hereinafter referred to as h-TREK1
activity" or h-TREK1 polypeptide activity" or "biological activity
of h-TREK1". Also included amongst these activities are antigenic
and immunogenic activities of said h-TREK 1 polypeptides, in
particular the antigenic and immunogenic activities of the
polypeptide of SEQ ID NO:2 or SEQ ID NO:6. Preferably, a
polypeptide of the present invention exhibits at least one
biological activity of h-TREK1.
[0010] The polypeptides of the present invention may be in the form
of the "mature" protein or may be a part of a larger protein such
as a precursor or a fusion protein. It is often advantageous to
include an additional amino acid sequence which contains secretory
or leader sequences, pro-sequences, sequences which aid in
purification such as multiple histidine residues, or an additional
sequence for stability during recombinant production.
[0011] The present invention also includes variants of the
aforementioned polypeptides, that is polypeptides that vary from
the referents by conservative amino acid substitutions, whereby a
residue is substituted by another with like characteristics.
Typical such substitutions are among Ala, Val, Leu and Ile; among
Ser and Thr; among the acidic residues Asp and Glu; among Asn and
Gln; and among the basic residues Lys and Arg; or aromatic residues
Phe and Tyr. Particularly preferred are variants in which several,
5-10, 1-5, 1-3, 1-2 or 1 amino acids are substituted, deleted, or
added in any combination.
[0012] Polypeptides of the present invention can be prepared in any
suitable manner. Such polypeptides include isolated naturally
occurring polypeptides, recombinantly produced polypeptides,
synthetically produced polypeptides, or polypeptides produced by a
combination of these methods. Means for preparing such polypeptides
are well understood in the art.
[0013] In a further aspect, the present invention relates to
h-TREK1 polynucleotides. Such polynucleotides include isolated
polynucleotides comprising a nucleotide sequence encoding a
polypeptide which has at least 97% identity, preferably at least
98% identity, to the amino acid sequence of SEQ ID NO:2, over the
entire length of SEQ ID NO:2. In this regard, polypeptides which
have at least 99% identity are most highly preferred. Such
polynucleotides include a polynucleotide comprising the nucleotide
sequence contained in SEQ ID NO. 1 encoding the polypeptide of SEQ
ID NO:2.
[0014] Further polynucleotides of the present invention include
isolated polynucleotides comprising a nucleotide sequence that has
at least 90% identity, yet more preferably at least 95% identity,
to a nucleotide sequence encoding a polypeptide of SEQ ID NO:2 ,
over the entire coding region. In this regard, polynucleotides
which have at least 97% identity are highly preferred, whilst those
with at least 98-99% identity are more highly preferred, and those
with at least 99% identity are most highly preferred.
[0015] Further polynucleotides of the present invention include
isolated polynucleotides comprising a nucleotide sequence which has
at least 90% identity, preferably at least 95% identity, to SEQ ID
NO:1 over the entire length of SEQ ID NO:1. In this regard,
polynucleotides which have at least 97% identity are highly
preferred, whilst those with at least 98-99%identity are more
highly preferred, and those with at least 99% identity are most
highly preferred. Such polynucleotides include a polynucleotide
comprising the polynucleotide of SEQ ID NO:1 as well as the
polynucleotide of SEQ ID NO:1.
[0016] Further polynucleotides of the invention include isolated
polynucleotides comprising a nucleotide sequence encoding the
polypeptide of SEQ ID NO:6. Such polynucleotides include a
polynucleotide comprising the nucleotide sequence contained in SEQ
ID NO:5 encoding the polypeptide of SEQ ID NO:6.
[0017] Further polynucleotides of the present invention include
isolated polynucleotides comprising a nucleotide sequence that has
at least95% identity, to a nucleotide sequence encoding a
polypeptide of SEQ ID NO:6, over the entire coding region. In this
regard, polynucleotides which have at least 97% identity are highly
preferred, whilst those with at least 98-99% identity are more
highly preferred, and those with at least 99% identity are most
highly preferred.
[0018] Further polynucleotides of the present invention include
isolated polynucleotides comprising a nucleotide sequence which has
at least 95% identity, preferably at least 97% identity, to SEQ ID
NO:5 over the entire length of SEQ ID NO:5. In this regard,
polynucleotides which have at least 98-99% identity are highly
preferred, and those with at least 99% identity are most highly
preferred. Such polynucleotides include a polynucleotide comprising
the polynucleotide of SEQ ID NO:5 as well as the polynucleotide of
SEQ ID NO:5.
[0019] The invention also provides polynucleotides which are
complementary to all the above described polynucleotides.
[0020] The nucleotide sequences of SEQ ID NO:1 and SEQ ID NO:5 show
homology with mouse TREK-1 potassium channel (M. Fink et al., EMBO
J., 15: 6854-6862, 1996). The nucleotide sequence of SEQ ID NO:1 is
a human cDNA sequence and comprises a polypeptide encoding sequence
(nucleotide 9 to 1241) encoding a polypeptide of 411 amino acids,
the polypeptide of SEQ ID NO:2. The nucleotide sequence encoding
the polypeptide of SEQ ID NO:2 may be identical to the polypeptide
encoding sequence contained in SEQ ID NO:1 or it may be a sequence
other than the one contained in SEQ ID NO:1, which, as a result of
the redundancy (degeneracy) of the genetic code, also encodes the
polypeptide of SEQ ID NO:2.
[0021] The nucleotide sequence of SEQ ID NO:5 is a mouse cDNA
sequence and comprises a polypeptide encoding sequence (nucleotide
484 to 1719) encoding a polypeptide of 411 amino acids, the
polypeptide of SEQ ID NO:6. The nucleotide sequence encoding the
polypeptide of SEQ ID NO:6 may be identical to the polypeptide
encoding sequence contained in SEQ ID NO:5 or it may be a sequence
other than the one contained in SEQ ID NO:5, which, as a result of
the redundancy (degeneracy) of the genetic code, also encodes the
polypeptide of SEQ ID NO:6. The polypeptides of the SEQ ID NO:2 and
SEQ ID NO:6 are structurally related to other proteins of the
potassium channel family, having homology and/or structural
similarity with mouse TREK-1 potassium channel (M. Fink et al.,
EMBO J., 15: 6854-6862, 1996).
[0022] Preferred polypeptides and polynucleotides of the present
invention are expected to have, inter alia, similar biological
functions/properties to their homologous polypeptides and
polynucleotides. Furthermore, preferred polypeptides and
polynucleotides of the present invention have at least one h-TREK1
activity.
[0023] The present invention also relates to partial or other
polynucleotide and polypeptide sequences which were first
identified prior to the determination of the corresponding full
length sequences of SEQ ID NO:1 and SEQ ID NO:2.
[0024] Accordingly, in a further aspect, the present invention
provides for an isolated polynucleotide which:
[0025] (a) comprises a nucleotide sequence which has at least 90%
identity, preferably at least 95% identity, more preferably at
least 97-99% identity to SEQ ID NO:3 over the entire length of SEQ
ID NO:3;
[0026] (b) has a nucleotide sequence which has at least 90%
identity, preferably at least 95% identity, more preferably at
least 97-99% identity, to SEQ ID NO:3 over the entire length of SEQ
ID NO:3;
[0027] (c) the polynucleotide of SEQ ID NO:3; or
[0028] (d) a nucleotide sequence encoding a polypeptide which has
at least 99% identity to the amino acid sequence of SEQ ID NO:4,
over the entire length of SEQ ID NO:4.
[0029] The present invention further provides for a polypeptide
which:
[0030] (a) comprises an amino acid sequence which has at least 99%
identity to that of SEQ ID NO:4 over the entire length of SEQ ID
NO:4;
[0031] (b) has an amino acid sequence which is at least 99%
identity to the amino acid sequence of SEQ ID NO:4 over the entire
length of SEQ ID NO:4;
[0032] (c) comprises the amino acid of SEQ ID NO:4; and
[0033] (d) is the polypeptide of SEQ ID NO:4;
[0034] as well as polypeptides encoded by a polynucleotide
comprising the sequence contained in SEQ ID NO:3.
[0035] The nucleotide sequence of SEQ ID NO:3 and the peptide
sequence encoded thereby are derived from EST (Expressed Sequence
Tag) sequences. It is recognized by those skilled in the art that
there will inevitably be some nucleotide sequence reading errors in
EST sequences (see Adams, M. D. et al, Nature 377 (supp) 3, 1995).
Accordingly, the nucleotide sequence of SEQ ID NO:3 and the peptide
sequence encoded therefrom are therefore subject to the same
inherent limitations in sequence accuracy. Furthermore, the peptide
sequence encoded by SEQ ID NO:3 comprises a region of identity or
close homology and/or close structural similarity (for example a
conservative amino acid difference) with the closest homologous or
structurally similar protein.
[0036] Polynucleotides of the present invention may be obtained,
using standard cloning and screening techniques, from a cDNA
library derived from mRNA in cells of foetal brain, adrenal gland
and ovary tumor (Sambrook et al., Molecular Cloning: A Laboratory
Manual, 2nd Ed., Cold Spring Harbor Laboratory Press, Cold Spring
Harbor, N.Y. (1989). Polynucleotides of the invention can also be
obtained from natural sources such as genomic DNA libraries or can
be synthesized using well known and commercially available
techniques.
[0037] When polynucleotides of the present invention are used for
the recombinant production of polypeptides of the present
invention, the polynucleotide may include the coding sequence for
the mature polypeptide, by itself; or the coding sequence for the
mature polypeptide in reading frame with other coding sequences,
such as those encoding a leader or secretory sequence, a pre-, or
pro- or prepro- protein sequence, or other fusion peptide portions.
For example, a marker sequence which facilitates purification of
the fused polypeptide can be encoded. In certain preferred
embodiments of this aspect of the invention, the marker sequence is
a hexa-histidine peptide, as provided in the pQE vector (Qiagen,
Inc.) and described in Gentz et al., Proc Natl Acad Sci USA (1989)
86:821-824, or is an HA tag. The polynucleotide may also contain
non-coding 5' and 3' sequences, such as transcribed, non-translated
sequences, splicing and polyadenylation signals, ribosome binding
sites and sequences that stabilize mRNA.
[0038] Further embodiments of the present invention include
polynucleotides encoding polypeptide variants which comprise the
amino acid sequence of SEQ ID NO:2 and in which several, for
instance from 5 to 10, 1 to 5, 1 to 3, 1 to 2 or 1, amino acid
residues are substituted, deleted or added, in any combination.
[0039] Polynucleotides which are identical or sufficiently
identical to a nucleotide sequence contained in SEQ ID NO::1 or SEQ
ID NO:5, may be used as hybridization probes for cDNA and genomic
DNA or as primers for a nucleic acid amplification (PCR) reaction,
to isolate full-length cDNAs and genomic clones encoding
polypeptides of the present invention and to isolate cDNA and
genomic clones of other genes (including genes encoding paralogs
from human or mouse sources and orthologs and paralogs from species
other than human or mouse) that have a high sequence similarity to
SEQ ID NO:1 or SEQ ID NO:5. Typically these nucleotide sequences
are 70% identical, preferably 80% identical, more preferably 90%
identical, most preferably 95% identical to that of the referent.
The probes or primers will generally comprise at least 15
nucleotides, preferably, at least 30 nucleotides and may have at
least 50 nucleotides. Particularly preferred probes will have
between 30 and 50 nucleotides. Particularly preferred primers will
have between 20 and 25 nucleotides.
[0040] A polynucleotide encoding a polypeptide of the present
invention, including homologs from species other than human, may be
obtained by a process which comprises the steps of screening an
appropriate library under stringent hybridization conditions with a
labeled probe having the sequence of SEQ ID NO:1, SEQ ID NO:5 or
fragments thereof; and isolating full-length cDNA and genomic
clones containing said polynucleotide sequence. Such hybridization
techniques are well known to the skilled artisan. Preferred
stringent hybridization conditions include overnight incubation at
42.degree. C. in a solution comprising: 50% formamide, 5.times.SSC
(150 mM NaCl, 15 mM trisodium citrate), 50 mM sodium phosphate
(pH7.6), 5.times. Denhardt's solution, 10% dextran sulfate, and 20
microgram/ml denatured, sheared salmon sperm DNA; followed by
washing the filters in 0.1.times.SSC at about 65.degree. C. Thus
the present invention also includes polynucleotides obtainable by
screening an appropriate library under stringent hybridization
conditions with a labeled probe having the sequence of SEQ ID NO:1,
SEQ ID NO:5 or fragments thereof.
[0041] The skilled artisan will appreciate that, in many cases, an
isolated cDNA sequence will be incomplete, in that the region
coding for the polypeptide is short at the 5' end of the cDNA. This
is a consequence of reverse transcriptase, an enzyme with
inherently low `processivity` (a measure of the ability of the
enzyme to remain attached to the template during the polymerisation
reaction), failing to complete a DNA copy of the mRNA template
during 1st strand cDNA synthesis.
[0042] There are several methods available and well known to those
skilled in the art to obtain full-length cDNAs, or extend short
cDNAs, for example those based on the method of Rapid Amplification
of cDNA ends (RACE) (see, for example, Frohman et al., PNAS USA 85,
8998-9002, 1988). Recent modifications of the technique,
exemplified by the Marathon.TM. technology (Clontech Laboratories
Inc.) for example, have significantly simplified the search for
longer cDNAs. In the Marathon.TM. technology, cDNAs have been
prepared from mRNA extracted from a chosen tissue and an `adaptor`
sequence ligated onto each end. Nucleic acid amplification (PCR) is
then carried out to amplify the `missing` 5' end of the cDNA using
a combination of gene specific and adaptor specific oligonucleotide
primers. The PCR reaction is then repeated using `nested` primers,
that is, primers designed to anneal within the amplified product
(typically an adaptor specific primer that anneals further 3' in
the adaptor sequence and a gene specific primer that anneals
further 5' in the known gene sequence). The products of this
reaction can then be analyzed by DNA sequencing and a full-length
cDNA constructed either by joining the product directly to the
existing cDNA to give a complete sequence, or carrying out a
separate full-length PCR using the new sequence information for the
design of the 5' primer.
[0043] Recombinant polypeptides of the present invention may be
prepared by processes well known in the art from genetically
engineered host cells comprising expression systems. Accordingly,
in a further aspect, the present invention relates to expression
systems which comprise a polynucleotide or polynucleotides of the
present invention, to host cells which are genetically engineered
with such expression systems and to the production of polypeptides
of the invention by recombinant techniques. Cell-free translation
systems can also be employed to produce such proteins using RNAs
derived from the DNA constructs of the present invention.
[0044] For recombinant production, host cells can be genetically
engineered to incorporate expression systems or portions thereof
for polynucleotides of the present invention. Introduction of
polynucleotides into host cells can be effected by methods
described in many standard laboratory manuals, such as Davis et al,
Basic Methods in Molecular Biology (1986) and Sambrook et al.,
Molecular Cloning: A Laboratory Manual, 2nd Ed., Cold Spring Harbor
Laboratory Press, Cold Spring Harbor, N.Y. (1989). Preferred such
methods include, for instance, calcium phosphate transfection,
DEAE-dextran mediated transfection, transvection, microinjection,
cationic lipid-mediated transfection, electroporation,
transduction, scrape loading, ballistic introduction or
infection.
[0045] Representative examples of appropriate hosts include
bacterial cells, such as Streptococci, Staphylococci, E. coli,
Streptomyces and Bacillus subtilis cells; fungal cells, such as
yeast cells and Aspergillus cells; insect cells such as Drosophila
S2 and Spodoptera Sf9 cells; animal cells such as CHO, COS, HeLa,
C127, 3T3, BHK, HEK 293 and Bowes melanoma cells; and plant
cells.
[0046] A great variety of expression systems can be used, for
instance, chromosomal, episomal and virus-derived systems, e.g.,
vectors derived from bacterial plasmids, from bacteriophage, from
transposons, from yeast episomes, from insertion elements, from
yeast chromosomal elements, from viruses such as baculoviruses,
papova viruses, such as SV40, vaccinia viruses, adenoviruses, fowl
pox viruses, pseudorabies viruses and retroviruses, and vectors
derived from combinations thereof, such as those derived from
plasmid and bacteriophage genetic elements, such as cosmids and
phagemids. The expression systems may contain control regions that
regulate as well as engender expression. Generally, any system or
vector which is able to maintain, propagate or express a
polynucleotide to produce a polypeptide in a host may be used. The
appropriate nucleotide sequence may be inserted into an expression
system by any of a variety of well-known and routine techniques,
such as, for example, those set forth in Sambrook et al., Molecular
Cloning, A Laboratory Manual (supra). Appropriate secretion signals
may be incorporated into the desired polypeptide to allow secretion
of the translated protein into the lumen of the endoplasmic
reticulum, the periplasmic space or the extracellular environment.
These signals may be endogenous to the polypeptide or they may be
heterologous signals.
[0047] If a polypeptide of the present invention is to be expressed
for use in screening assays, it is generally preferred that the
polypeptide be produced at the surface of the cell. In this event,
the cells may be harvested prior to use in the screening assay. If
the polypeptide is secreted into the medium, the medium can be
recovered in order to recover and purify the polypeptide. If
produced intracellularly, the cells must first be lysed before the
polypeptide is recovered.
[0048] Polypeptides of the present invention can be recovered and
purified from recombinant cell cultures by well-known methods
including ammonium sulfate or ethanol precipitation, acid
extraction, anion or cation exchange chromatography,
phosphocellulose chromatography, hydrophobic interaction
chromatography, affinity chromatography, hydroxylapatite
chromatography and lectin chromatography. Most preferably, high
performance liquid chromatography is employed for purification.
Well known techniques for refolding proteins may be employed to
regenerate active conformation when the polypeptide is denatured
during intracellular synthesis, isolation and or purification.
[0049] This invention also relates to the use of polynucleotides of
the present invention as diagnostic reagents. Detection of a
mutated form of the gene characterized by the polynucleotide of SEQ
ID NO:1, or SEQ ID NO:5 which is associated with a dysfunction will
provide a diagnostic tool that can add to, or define, a diagnosis
of a disease, or susceptibility to a disease, which results from
under-expression, over-expression or altered spatial or temporal
expression of the gene. Individuals carrying mutations in the gene
may be detected at the DNA level by a variety of techniques.
[0050] Nucleic acids for diagnosis may be obtained from a subject's
cells, such as from blood, urine, saliva, tissue biopsy or autopsy
material. The genomic DNA may be used directly for detection or may
be amplified enzymatically by using PCR or other amplification
techniques prior to analysis. RNA or cDNA may also be used in
similar fashion. Deletions and insertions can be detected by a
change in size of the amplified product in comparison to the normal
genotype. Point mutations can be identified by hybridizing
amplified DNA to labeledh-TREK1 nucleotide sequences. Perfectly
matched sequences can be distinguished from mismatched duplexes by
RNase digestion or by differences in melting temperatures. DNA
sequence differences may also be detected by alterations in
electrophoretic mobility of DNA fragments in gels, with or without
denaturing agents, or by direct DNA sequencing (see, e.g., Myers et
al., Science (1985) 230:1242). Sequence changes at specific
locations may also be revealed by nuclease protection assays, such
as RNase and S1 protection or the chemical cleavage method (see
Cotton et al., Proc Natl Acad Sci USA (1985) 85: 4397-4401). In
another embodiment, an array of oligonucleotides probes comprising
h-TREK1 nucleotide sequence or fragments thereof can be constructed
to conduct efficient screening of e.g., genetic mutations. Array
technology methods are well known and have general applicability
and can be used to address a variety of questions in molecular
genetics including gene expression, genetic linkage, and genetic
variability (see for example: M.Chee et al., Science, Vol 274, pp
610-613 (1996)).
[0051] The diagnostic assays offer a process for diagnosing or
determining a susceptibility to the Diseases through detection of
mutation in the h-TREK1 gene by the methods described. In addition,
such diseases may be diagnosed by methods comprising determining
from a sample derived from a subject an abnormally decreased or
increased level of polypeptide or mRNA. Decreased or increased
expression can be measured at the RNA level using any of the
methods well known in the art for the quantitation of
polynucleotides, such as, for example, nucleic acid amplification,
for instance PCR, RT-PCR, RNase protection, Northern blotting and
other hybridization methods. Assay techniques that can be used to
determine levels of a protein, such as a polypeptide of the present
invention, in a sample derived from a host are well-known to those
of skill in the art. Such assay methods include radioimmunoassays,
competitive-binding assays, Western Blot analysis and ELISA
assays.
[0052] Thus in another aspect, the present invention relates to a
diagnostic kit which comprises:
[0053] (a) a polynucleotide of the present invention, preferably
the nucleotide sequence of SEQ ID NO: 1, or a fragment thereof;
[0054] (b) a nucleotide sequence complementary to that of (a);
[0055] (c) a polypeptide of the present invention, preferably the
polypeptide of SEQ ID NO:2 or a fragment thereof; or
[0056] (d) an antibody to a polypeptide of the present invention,
preferably to the polypeptide of SEQ ID NO:2.
[0057] It will be appreciated that in any such kit, (a), (b), (c)
or (d) may comprise a substantial component. Such a kit will be of
use in diagnosing a disease or susceptibility to a disease,
particularly cancer, pulmonary disease, cardiovascular diseases,
inflammatory diseases, renal disease, pain, psychiatric disorders
including depression and schizophrenia, neurodegenerative disease
including Alzheimer's, stroke and head trauma and neurological
disorders including migraine, amongst others.
[0058] The nucleotide sequences of the present invention are also
valuable for chromosome localization. The sequence is specifically
targeted to, and can hybridize with, a particular location on an
individual human chromosome. The mapping of relevant sequences to
chromosomes according to the present invention is an important
first step in correlating those sequences with gene associated
disease. Once a sequence has been mapped to a precise chromosomal
location, the physical position of the sequence on the chromosome
can be correlated with genetic map data. Such data are found in,
for example, V. McKusick, Mendelian Inheritance in Man (available
on-line through Johns Hopkins University Welch Medical Library).
The relationship between genes and diseases that have been mapped
to the same chromosomal region are then identified through linkage
analysis (coinheritance of physically adjacent genes).
[0059] The differences in the cDNA or genomic sequence between
affected and unaffected individuals can also be determined. If a
mutation is observed in some or all of the affected individuals but
not in any normal individuals, then the mutation is likely to be
the causative agent of the disease.
[0060] The human gene of the present invention maps to human
chromosome 1q32, between the markers D1S237 and WI5105.
[0061] The nucleotide sequences of the present invention are also
valuable for tissue localisation. Such techniques allow the
determination of expression patterns of the human h-TREK1
polypeptides in tissues by detection of the mRNAs that encode them.
These techniques include in situ hybridziation techniques and
nucleotide amplification techniques, for example PCR. Such
techniques are well known in the art. Results from these studies
provide an indication of the normal functions of the polypeptides
in the organism. In addition, comparative studies of the normal
expression pattern of human h-TREK1 mRNAs with that of mRNAs
encoded by a human h-TREK1 gene provide valuable insights into the
role of mutant human h-TREK1 polypeptides, or that of inappropriate
expression of normal human h-TREK1 polypeptides, in disease. Such
inappropriate expression may be of a temporal, spatial or simply
quantitative nature.
[0062] The polypeptides of the invention or their fragments or
analogs thereof, or cells expressing them, can also be used as
immunogens to produce antibodies immunospecific for polypeptides of
the present invention. The term "immunospecific" means that the
antibodies have substantially greater affinity for the polypeptides
of the invention than their affinity for other related polypeptides
in the prior art.
[0063] Antibodies generated against polypeptides of the present
invention may be obtained by administering the polypeptides or
epitope-bearing fragments, analogs or cells to an animal,
preferably a non-human animal, using routine protocols. For
preparation of monoclonal antibodies, any technique which provides
antibodies produced by continuous cell line cultures can be used.
Examples include the hybridoma technique (Kohler, G. and Milstein,
C., Nature (1975) 256:495-497), the trioma technique, the human
B-cell hybridoma technique (Kozbor et al., Immunology Today (1983)
4:72) and the EBV-hybridoma technique (Cole et al., Monoclonal
Antibodies and Cancer Therapy, 77-96, Alan R. Liss, Inc.,
1985).
[0064] Techniques for the production of single chain antibodies,
such as those described in U.S. Pat. No. 4,946,778, can also be
adapted to produce single chain antibodies to polypeptides of this
invention. Also, transgenic mice, or other organisms, including
other mammals, may be used to express humanized antibodies.
[0065] The above-described antibodies may be employed to isolate or
to identify clones expressing the polypeptide or to purify the
polypeptides by affinity chromatography.
[0066] Antibodies against polypeptides of the present invention may
also be employed to treat the Diseases, amongst others.
[0067] In a further aspect, the present invention relates to
genetically engineered soluble fusion proteins comprising a
polypeptide of the present invention, or a fragment thereof, and
various portions of the constant regions of heavy or light chains
of immunoglobulins of various subclasses (IgG, IgM, IgA, IgE).
Preferred as an immunoglobulin is the constant part of the heavy
chain of human IgG, particularly IgG1, where fusion takes place at
the hinge region. In a particular embodiment, the Fc part can be
removed simply by incorporation of a cleavage sequence which can be
cleaved with blood clotting factor Xa. Furthermore, this invention
relates to processes for the preparation of these fusion proteins
by genetic engineering, and to the use thereof for drug screening,
diagnosis and therapy. A further aspect of the invention also
relates to polynucleotides encoding such fusion proteins. Examples
of fusion protein technology can be found in International Patent
Application Nos. WO94/29458 and WO94/22914.
[0068] Another aspect of the invention relates to a method for
inducing an immunological response in a mammal which comprises
inoculating the mammal with a polypeptide of the present invention,
adequate to produce antibody and/or T cell immune response to
protect said animal from the Diseases hereinbefore mentioned,
amongst others. Yet another aspect of the invention relates to a
method of inducing immunological response in a mammal which
comprises, delivering a polypeptide of the present invention via a
vector directing expression of the polynucleotide and coding for
the polypeptide in vivo in order to induce such an immunological
response to produce antibody to protect said animal from
diseases.
[0069] A further aspect of the invention relates to an
immunological/vaccine formulation (composition) which, when
introduced into a mammalian host, induces an immunological response
in that mammal to a polypeptide of the present invention wherein
the composition comprises a polypeptide or polynucleotide of the
present invention. The vaccine formulation may further comprise a
suitable carrier. Since a polypeptide may be broken down in the
stomach, it is preferably administered parenterally (for instance,
subcutaneous, intramuscular, intravenous, or intradermal
injection). Formulations suitable for parenteral administration
include aqueous and non-aqueous sterile injection solutions which
may contain anti-oxidants, buffers, bacteriostats and solutes which
render the formulation instonic with the blood of the recipient;
and aqueous and non-aqueous sterile suspensions which may include
suspending agents or thickening agents. The formulations may be
presented in unit-dose or multi-dose containers, for example,
sealed ampoules and vials and may be stored in a freeze-dried
condition requiring only the addition of the sterile liquid carrier
immediately prior to use. The vaccine formulation may also include
adjuvant systems for enhancing the immunogenicity of the
formulation, such as oil-in water systems and other systems known
in the art. The dosage will depend on the specific activity of the
vaccine and can be readily determined by routine
experimentation.
[0070] Polypeptides of the present invention are responsible for
one or more biological functions, including one or more disease
states, in particular the Diseases hereinbefore mentioned. It is
therefore desirous to devise screening methods to identify
compounds which stimulate or which inhibit the function of the
polypeptide. Accordingly, in a further aspect, the present
invention provides for a method of screening compounds to identify
those which stimulate or which inhibit the function of the
polypeptide. In general, agonists or antagonists may be employed
for therapeutic and prophylactic purposes for such Diseases as
hereinbefore mentioned. Compounds may be identified from a variety
of sources, for example, cells, cell-free preparations, chemical
libraries, and natural product mixtures. Such agonists, antagonists
or inhibitors so-identified may be natural or modified substrates,
ligands, receptors, enzymes, etc., as the case may be, of the
polypeptide; or may be structural or functional mimetics thereof
(see Coligan et al., Current Protocols in Immunology 1(2):Chapter 5
(1991)).
[0071] The screening method may simply measure the binding of a
candidate compound to the polypeptide, or to cells or membranes
bearing the polypeptide, or a fusion protein thereof by means of a
label directly or indirectly associated with the candidate
compound. Alternatively, the screening method may involve
competition with a labeled competitor. Further, these screening
methods may test whether the candidate compound results in a signal
generated by activation or inhibition of the polypeptide, using
detection systems appropriate to the cells bearing the polypeptide.
Inhibitors of activation are generally assayed in the presence of a
known agonist and the effect on activation by the agonist by the
presence of the candidate compound is observed. Constitutively
active polypeptides may be employed in screening methods for
inverse agonists or inhibitors, in the absence of an agonist or
inhibitor, by testing whether the candidate compound results in
inhibition of activation of the polypeptide. Further, the screening
methods may simply comprise the steps of mixing a candidate
compound with a solution containing a polypeptide of the present
invention, to form a mixture, measuring h-TREK1 activity in the
mixture, and comparing the h-TREK1 activity of the mixture to a
standard. Fusion proteins, such as those made from Fc portion and
h-TREK1 polypeptide, as hereinbefore described, can also be used
for high-throughput screening assays to identify antagonists for
the polypeptide of the present invention (see D. Bennett et al., J
Mol Recognition, 8:52-58 (1995); and K. Johanson et al., J Biol
Chem, 270(16):9459-9471 (1995)).
[0072] The polynucleotides, polypeptides and antibodies to the
polypeptide of the present invention may also be used to configure
screening methods for detecting the effect of added compounds on
the production of mRNA and polypeptide in cells. For example, an
ELISA assay may be constructed for measuring secreted or cell
associated levels of polypeptide using monoclonal and polyclonal
antibodies by standard methods known in the art. This can be used
to discover agents which may inhibit or enhance the production of
polypeptide (also called antagonist or agonist, respectively) from
suitably manipulated cells or tissues.
[0073] The polypeptide may be used to identify membrane bound or
soluble receptors, if any, through standard receptor binding
techniques known in the art. These include, but are not limited to,
ligand binding and crosslinking assays in which the polypeptide is
labeled with a radioactive isotope (for instance, .sup.125I),
chemically modified (for instance, biotinylated), or fused to a
peptide sequence suitable for detection or purification, and
incubated with a source of the putative receptor (cells, cell
membranes, cell supernatants, tissue extracts, bodily fluids).
Other methods include biophysical techniques such as surface
plasmon resonance and spectroscopy. These screening methods may
also be used to identify agonists and antagonists of the
polypeptide which compete with the binding of the polypeptide to
its receptors, if any. Standard methods for conducting such assays
are well understood in the art.
[0074] Examples of potential polypeptide antagonists include
antibodies or, in some cases, oligonucleotides or proteins which
are closely related to the ligands, substrates, receptors, enzymes,
etc., as the case may be, of the polypeptide, e.g., a fragment of
the ligands, substrates, receptors, enzymes, etc.; or small
molecules which bind to the polypeptide of the present invention
but do not elicit a response, so that the activity of the
polypeptide is prevented.
[0075] Thus, in another aspect, the present invention relates to a
screening kit for identifying agonists, antagonists, ligands,
receptors, substrates, enzymes, etc. for polypeptides of the
present invention; or compounds which decrease or enhance the
production of such polypeptides, which comprises:
[0076] (a) a polypeptide of the present invention;
[0077] (b) a recombinant cell expressing a polypeptide of the
present invention;
[0078] (c) a cell membrane expressing a polypeptide of the present
invention; or
[0079] (d) antibody to a polypeptide of the present invention;
[0080] which polypeptide is preferably that of SEQ ID NO:2.
[0081] It will be appreciated that in any such kit, (a), (b), (c)
or (d) may comprise a substantial component.
[0082] It will be readily appreciated by the skilled artisan that a
polypeptide of the present invention may also be used in a method
for the structure-based design of an agonist, antagonist or
inhibitor of the polypeptide, by:
[0083] (a) determining in the first instance the three-dimensional
structure of the polypeptide;
[0084] (b) deducing the three-dimensional structure for the likely
reactive or binding site(s) of an agonist, antagonist or
inhibitor;
[0085] (c) synthesizing candidate compounds that are predicted to
bind to or react with the deduced binding or reactive site; and
[0086] (d) testing whether the candidate compounds are indeed
agonists, antagonists or inhibitors.
[0087] It will be further appreciated that this will normally be an
iterative process.
[0088] In a further aspect, the present invention provides methods
of treating abnormal conditions such as, for instance, cancer,
pulmonary disease, cardiovascular diseases, inflammatory diseases,
renal disease, pain, psychiatric disorders including depression and
schizophrenia, neurodegenerative disease including Alzheimer's,
stroke and head trauma and neurological disorders including
migraine, related to either an excess of, or an under-expression
of, h-TREK1 polypeptide activity.
[0089] If the activity of the polypeptide is in excess, several
approaches are available. One approach comprises administering to a
subject in need thereof an inhibitor compound (antagonist) as
hereinabove described, optionally in combination with a
pharmaceutically acceptable carrier, in an amount effective to
inhibit the function of the polypeptide, such as, for example, by
blocking the binding of ligands, substrates, receptors, enzymes,
etc., or by inhibiting a second signal, and thereby alleviating the
abnormal condition. In another approach, soluble forms of the
polypeptides still capable of binding the ligand, substrate,
enzymes, receptors, etc. in competition with endogenous polypeptide
may be administered. Typical examples of such competitors include
fragments of the h-TREK1 polypeptide.
[0090] In still another approach, expression of the gene encoding
endogenous h-TREK1 polypeptide can be inhibited using expression
blocking techniques. Known such techniques involve the use of
antisense sequences, either internally generated or externally
administered (see, for example, O'Connor, J Neurochem (1991) 56:560
in Oligodeoxynucleotides as Antisense Inhibitors of Gene
Expression, CRC Press, Boca Raton, Fla. (1988)). Alternatively,
oligonucleotides which form triple helices ("triplexes") with the
gene can be supplied (see, for example, Lee et al., Nucleic Acids
Res (1979) 6:3073; Cooney et al., Science (1988) 241:456; Dervan et
al., Science (1991) 251:1360). These oligomers can be administered
per se or the relevant oligomers can be expressed in vivo.
Synthetic antisense or triplex oligonucleotides may comprise
modified bases or modified backbones. Examples of the latter
include methylphosphonate, phosphorothioate or peptide nucleic acid
backbones. Such backbones are incorporated in the antisense or
triplex oligonucleotide in order to provide protection from
degradation by nucleases and are well known in the art. Antisense
and triplex molecules synthesized with these or other modified
backbones also form part of the present invention.
[0091] In addition, expression of the human h-TREK1 polypeptide may
be prevented by using ribozymes specific to the human h-TREK1 mRNA
sequence. Ribozymes are catalytically active RNAs that can be
natural or synthetic (see for example Usman, N, et al., Curr. Opin.
Struct. Biol (1996) 6(4), 527-33.) Synthetic ribozymes can be
designed to specifically cleave human h-TREK1 mRNAs at selected
positions thereby preventing translation of the human h-TREK1 mRNAs
into functional polypeptide. Ribozymes may be synthesized with a
natural ribose phosphate backbone and natural bases, as normally
found in RNA molecules. Alternatively the ribosymes may be
synthesized with non-natural backbones to provide protection from
ribonuclease degradation, for example, 2'-O-methyl RNA, and may
contain modified bases.
[0092] For treating abnormal conditions related to an
under-expression ofh-TREK1 and its activity, several approaches are
also available. One approach comprises administering to a subject a
therapeutically effective amount of a compound which activates a
polypeptide of the present invention, i.e., an agonist as described
above, in combination with a pharmaceutically acceptable carrier,
to thereby alleviate the abnormal condition. Alternatively, gene
therapy may be employed to effect the endogenous production of
h-TREK1 by the relevant cells in the subject. For example, a
polynucleotide of the invention may be engineered for expression in
a replication defective retroviral vector, as discussed above. The
retroviral expression construct may then be isolated and introduced
into a packaging cell transduced with a retroviral plasmid vector
containing RNA encoding a polypeptide of the present invention such
that the packaging cell now produces infectious viral particles
containing the gene of interest. These producer cells may be
administered to a subject for engineering cells in vivo and
expression of the polypeptide in vivo. For an overview of gene
therapy, see Chapter 20, Gene Therapy and other Molecular
Genetic-based Therapeutic Approaches, (and references cited
therein) in Human Molecular Genetics, T Strachan and A P Read, BIOS
Scientific Publishers Ltd (1996). Another approach is to administer
a therapeutic amount of a polypeptide of the present invention in
combination with a suitable pharmaceutical carrier.
[0093] In a further aspect, the present invention provides for
pharmaceutical compositions comprising a therapeutically effective
amount of a polypeptide, such as the soluble form of a polypeptide
of the present invention, agonist/antagonist peptide or small
molecule compound, in combination with a pharmaceutically
acceptable carrier or excipient. Such carriers include, but are not
limited to, saline, buffered saline, dextrose, water, glycerol,
ethanol, and combinations thereof. The invention further relates to
pharmaceutical packs and kits comprising one or more containers
filled with one or more of the ingredients of the aforementioned
compositions of the invention. Polypeptides and other compounds of
the present invention may be employed alone or in conjunction with
other compounds, such as therapeutic compounds.
[0094] The composition will be adapted to the route of
administration, for instance by a systemic or an oral route.
Preferred forms of systemic administration include injection,
typically by intravenous injection. Other injection routes, such as
subcutaneous, intramuscular, or intraperitoneal, can be used.
Alternative means for systemic administration include transmucosal
and transdermal administration using penetrants such as bile salts
or fusidic acids or other detergents. In addition, if a polypeptide
or other compounds of the present invention can be formulated in an
enteric or an encapsulated formulation, oral administration may
also be possible. Administration of these compounds may also be
topical and/or localized, in the form of salves, pastes, gels, and
the like.
[0095] The dosage range required depends on the choice of peptide
or other compounds of the present invention, the route of
administration, the nature of the formulation, the nature of the
subject's condition, and the judgment of the attending
practitioner. Suitable dosages, however, are in the range of
0.1-100 .mu.g/kg of subject. Wide variations in the needed dosage,
however, are to be expected in view of the variety of compounds
available and the differing efficiencies of various routes of
administration. For example, oral administration would be expected
to require higher dosages than administration by intravenous
injection. Variations in these dosage levels can be adjusted using
standard empirical routines for optimization, as is well understood
in the art.
[0096] Polypeptides used in treatment can also be generated
endogenously in the subject, in treatment modalities often referred
to as "gene therapy" as described above. Thus, for example, cells
from a subject may be engineered with a polynucleotide, such as a
DNA or RNA, to encode a polypeptide ex vivo, and for example, by
the use of a retroviral plasmid vector. The cells are then
introduced into the subject.
[0097] Polynucleotide and polypeptide sequences form a valuable
information resource with which to identify further sequences of
similar homology. This is most easily facilitated by storing the
sequence in a computer readable medium and then using the stored
data to search a sequence database using well known searching
tools, such as those in the GCG and Lasergene software packages.
Accordingly, in a further aspect, the present invention provides
for a computer readable medium having stored thereon a
polynucleotide comprising the sequence of SEQ ID NO:1 and/or a
polypeptide sequence encoded thereby.
[0098] The following definitions are provided to facilitate
understanding of certain terms used frequently hereinbefore.
[0099] "Antibodies" as used herein includes polyclonal and
monoclonal antibodies, chimeric, single chain, and humanized
antibodies, as well as Fab fragments, including the products of an
Fab or other immunoglobulin expression library.
[0100] "Isolated" means altered "by the hand of man" from the
natural state. If an "isolated" composition or substance occurs in
nature, it has been changed or removed from its original
environment, or both. For example, a polynucleotide or a
polypeptide naturally present in a living animal is not "isolated,"
but the same polynucleotide or polypeptide separated from the
coexisting materials of its natural state is "isolated", as the
term is employed herein.
[0101] "Polynucleotide" generally refers to any polyribonucleotide
or polydeoxribonucleotide, which may be unmodified RNA or DNA or
modified RNA or DNA. "Polynucleotides" include, without limitation,
single- and double-stranded DNA, DNA that is a mixture of single-
and double-stranded regions, single- and double-stranded RNA, and
RNA that is mixture of single- and double-stranded regions, hybrid
molecules comprising DNA and RNA that may be single-stranded or,
more typically, double-stranded or a mixture of single- and
double-stranded regions. In addition, "polynucleotide" refers to
triple-stranded regions comprising RNA or DNA or both RNA and DNA.
The term "polynucleotide" also includes DNAs or RNAs containing one
or more modified bases and DNAs or RNAs with backbones modified for
stability or for other reasons. "Modified" bases include, for
example, tritylated bases and unusual bases such as inosine. A
variety of modifications may be made to DNA and RNA; thus,
"polynucleotide" embraces chemically, enzymatically or
metabolically modified forms of polynucleotides as typically found
in nature, as well as the chemical forms of DNA and RNA
characteristic of viruses and cells. "Polynucleotide" also embraces
relatively short polynucleotides, often referred to as
oligonucleotides.
[0102] "Polypeptide" refers to any peptide or protein comprising
two or more amino acids joined to each other by peptide bonds or
modified peptide bonds, i.e., peptide isosteres. "Polypeptide"
refers to both short chains, commonly referred to as peptides,
oligopeptides or oligomers, and to longer chains, generally
referred to as proteins. Polypeptides may contain amino acids other
than the 20 gene-encoded amino acids. "Polypeptides" include amino
acid sequences modified either by natural processes, such as
post-translational processing, or by chemical modification
techniques which are well known in the art. Such modifications are
well described in basic texts and in more detailed monographs, as
well as in a voluminous research literature. Modifications may
occur anywhere in a polypeptide, including the peptide backbone,
the amino acid side-chains and the amino or carboxyl termini. It
will be appreciated that the same type of modification may be
present to the same or varying degrees at several sites in a given
polypeptide. Also, a given polypeptide may contain many types of
modifications. Polypeptides may be branched as a result of
ubiquitination, and they may be cyclic, with or without branching.
Cyclic, branched and branched cyclic polypeptides may result from
post-translation natural processes or may be made by synthetic
methods. Modifications include acetylation, acylation,
ADP-ribosylation, amidation, biotinylation, covalent attachment of
flavin, covalent attachment of a heme moiety, covalent attachment
of a nucleotide or nucleotide derivative, covalent attachment of a
lipid or lipid derivative, covalent attachment of
phosphotidylinositol, cross-linking, cyclization, disulfide bond
formation, demethylation, formation of covalent cross-links,
formation of cystine, formation of pyroglutamate, formylation,
gamma-carboxylation, glycosylation, GPI anchor formation,
hydroxylation, iodination, methylation, myristoylation, oxidation,
proteolytic processing, phosphorylation, prenylation, racemization,
selenoylation, sulfation, transfer-RNA mediated addition of amino
acids to proteins such as arginylation, and ubiquitination (see,
for instance, Proteins--Structure and Molecular Properties, 2nd
Ed., T. E. Creighton, W. H. Freeman and Company, New York, 1993;
Wold, F., Post-translational Protein Modifications: Perspectives
and Prospects, pgs. 1-12 in Post-translational Covalent
Modification of Proteins, B. C. Johnson Ed., Academic Press, New
York, 1983; Seifter et al., "Analysis for protein modifications and
nonprotein cofactors", Meth Enzymol (1990) 182:626-646 and Rattan
et al., "Protein Synthesis: Post-translational Modifications and
Aging", Ann NY Acad Sci (1992) 663:48-62).
[0103] "Variant" refers to a polynucleotide or polypeptide that
differs from a reference polynucleotide or polypeptide, but retains
essential properties. A typical variant of a polynucleotide differs
in nucleotide sequence from another, reference polynucleotide.
Changes in the nucleotide sequence of the variant may or may not
alter the amino acid sequence of a polypeptide encoded by the
reference polynucleotide. Nucleotide changes may result in amino
acid substitutions, additions, deletions, fusions and truncations
in the polypeptide encoded by the reference sequence, as discussed
below. A typical variant of a polypeptide differs in amino acid
sequence from another, reference polypeptide. Generally,
differences are limited so that the sequences of the reference
polypeptide and the variant are closely similar overall and, in
many regions, identical. A variant and reference polypeptide may
differ in amino acid sequence by one or more substitutions,
additions, deletions in any combination. A substituted or inserted
amino acid residue may or may not be one encoded by the genetic
code. A variant of a polynucleotide or polypeptide may be a
naturally occurring such as an allelic variant, or it may be a
variant that is not known to occur naturally. Non-naturally
occurring variants of polynucleotides and polypeptides may be made
by mutagenesis techniques or by direct synthesis.
[0104] "Identity," as known in the art, is a relationship between
two or more polypeptide sequences or two or more polynucleotide
sequences, as determined by comparing the sequences. In the art,
"identity" also means the degree of sequence relatedness between
polypeptide or polynucleotide sequences, as the case may be, as
determined by the match between strings of such sequences.
"Identity" and "similarity" can be readily calculated by known
methods, including but not limited to those described in
(Computational Molecular Biology, Lesk, A. M., ed., Oxford
University Press, New York, 1988; Biocomputing: Informatics and
Genome Projects, Smith, D. W., ed., Academic Press, New York, 1993;
Computer Analysis of Sequence Data, Part I, Griffin, A. M., and
Griffin, H. G., eds., Humana Press, New Jersey, 1994; Sequence
Analysis in Molecular Biology, von Heinje, G., Academic Press,
1987; and Sequence Analysis Primer, Gribskov, M. and Devereux, J.,
eds., M Stockton Press, New York, 1991; and Carillo, H., and
Lipman, D., SIAM J. Applied Math., 48: 1073 (1988). Preferred
methods to determine identity are designed to give the largest
match between the sequences tested. Methods to determine identity
and similarity are codified in publicly available computer
programs. Preferred computer program methods to determine identity
and similarity between two sequences include, but are not limited
to, the GCG program package (Devereux, J., et al., Nucleic Acids
Research 12(1): 387 (1984)), BLASTP, BLASTN, and FASTA (Atschul, S.
F. et al., J. Molec. Biol. 215: 403-410 (1990). The BLAST X program
is publicly available from NCBI and other sources (BLAST Manual,
Altschul, S., et al., NCBI NLM NIH Bethesda, Md. 20894; Altschul,
S., et al., J. Mol. Biol. 215: 403-410 (1990). The well known Smith
Waterman algorithm may also be used to determine identity.
[0105] Preferred parameters for polypeptide sequence comparison
include the following:
[0106] 1) Algorithm: Needleman and Wunsch, J. Mol Biol. 48: 443-453
(1970) Comparison matrix: BLOSSUM62 from Hentikoff and Hentikoff,
Proc. Natl. Acad. Sci. USA. 89:10915-10919(1992)
[0107] Gap Penalty: 12
[0108] Gap Length Penalty: 4
[0109] A program useful with these parameters is publicly available
as the "gap" program from Genetics Computer Group, Madison Wis. The
aforementioned parameters are the default parameters for peptide
comparisons (along with no penalty for end gaps).
[0110] Preferred parameters for polynucleotide comparison include
the following:
[0111] 1) Algorithm: Needleman and Wunsch, J. Mol Biol. 48: 443-453
(1970)
[0112] Comparison matrix: matches=+10, mismatch=0
[0113] Gap Penalty: 50
[0114] Gap Length Penalty: 3
[0115] Available as: The "gap" program from Genetics Computer
Group, Madison Wis. These are the default parameters for nucleic
acid comparisons.
[0116] By way of example, a polynucleotide sequence of the present
invention may be identical to the reference sequence of SEQ ID
NO:1, that is be 100% identical, or it may include up to a certain
integer number of nucleotide alterations as compared to the
reference sequence. Such alterations are selected from the group
consisting of at least one nucleotide deletion, substitution,
including transition and transversion, or insertion, and wherein
said alterations may occur at the 5' or 3' terminal positions of
the reference nucleotide sequence or anywhere between those
terminal positions, interspersed either individually among the
nucleotides in the reference sequence or in one or more contiguous
groups within the reference sequence. The number of nucleotide
alterations is determined by multiplying the total number of
nucleotides in SEQ ID NO:1 by the numerical percent of the
respective percent identity(divided by 100) and subtracting that
product from said total number of nucleotides in SEQ ID NO:1,
or:
n.sub.n.ltoreq.x.sub.n-(x.sub.n.multidot.y),
[0117] wherein n.sub.n is the number of nucleotide alterations,
x.sub.n is the total number of nucleotides in SEQ ID NO:1, and y
is, for instance, 0.70 for 70%, 0.80 for 80%, 0.85 for 85%, 0.90
for 90%, 0.95 for 95%,etc., and wherein any non-integer product of
x.sub.n and y is rounded down to the nearest integer prior to
subtracting it from x.sub.n. Alterations of a polynucleotide
sequence encoding the polypeptide of SEQ ID NO:2 may create
nonsense, missense or frameshift mutations in this coding sequence
and thereby alter the polypeptide encoded by the polynucleotide
following such alterations.
[0118] Similarly, a polypeptide sequence of the present invention
may be identical to the reference sequence of SEQ ID NO:2, that is
be 100% identical, or it may include up to a certain integer number
of amino acid alterations as compared to the reference sequence
such that the % identity is less than 100%. Such alterations are
selected from the group consisting of at least one amino acid
deletion, substitution, including conservative and non-conservative
substitution, or insertion, and wherein said alterations may occur
at the amino- or carboxy-terminal positions of the reference
polypeptide sequence or anywhere between those terminal positions,
interspersed either individually among the amino acids in the
reference sequence or in one or more contiguous groups within the
reference sequence. The number of amino acid alterations for a
given % identity is determined by multiplying the total number of
amino acids in SEQ ID NO:2 by the numerical percent of the
respective percent identity(divided by 100) and then subtracting
that product from said total number of amino acids in SEQ ID NO:2,
or:
n.sub.a.ltoreq.x.sub.a-(x.sub.a.multidot.y),
[0119] wherein n.sub.a is the number of amino acid alterations,
x.sub.a is the total number of amino acids in SEQ ID NO:2, and y
is, for instance 0.70 for 70%, 0.80 for 80%, 0.85 for 85% etc., and
wherein any non-integer product of x.sub.a and y is rounded down to
the nearest integer prior to subtracting it from x.sub.a.
[0120] "Homolog" is a generic term used in the art to indicate a
polynucleotide or polypeptide sequence possessing a high degree of
sequence relatedness to a subject sequence. Such relatedness may be
quantified by determining the degree of identity and/or similarity
between the sequences being compared as hereinbefore described.
Falling within this generic term are the terms "ortholog", meaning
a polynucleotide or polypeptide that is the functional equivalent
of a polynucleotide or polypeptide in another species, and
"paralog" meaning a functionally similar sequence when considered
within the same species.
[0121] "Fusion protein" refers to a protein encoded by two, often
unrelated, fused genes or fragments thereof. In one example, EP-A-0
464 discloses fusion proteins comprising various portions of
constant region of immunoglobulin molecules together with another
human protein or part thereof. In many cases, employing an
immunoglobulin Fc region as a part of a fusion protein is
advantageous for use in therapy and diagnosis resulting in, for
example, improved pharmacokinetic properties [see, e.g., EP-A 0232
262]. On the other hand, for some uses it would be desirable to be
able to delete the Fc part after the fusion protein has been
expressed, detected and purified.
[0122] All publications, including but not limited to patents and
patent applications, cited in this specification are herein
incorporated by reference as if each individual publication were
specifically and individually indicated to be incorporated by
reference herein as though fully set forth.
EXAMPLES
Example 1
Preparation of Oocytes Expressing h-TREK1
[0123] Xenopus laevis oocyte removal and dissociation were
performed and injections of cDNA for h-TREK1 were made into the
nuclei of defolliculated oocytes (0.5-1.5 ng/oocyte). After
injection the oocytes were incubated at 22.degree. C. in modified
Barth's solution (MBS) plus gentamycin and used for
electrophysiological recordings within 1-3 days.
Example 2
Electrophysiological Analysis
[0124] For electrophysiological recordings oocytes were placed in a
recording chamber and continuously perfused with a solution
containing in mM: NaCl 93, KCl 5, HEPES 5, MgCl.sub.2 l and
CaCl.sub.2 1.8. Electrodes were low resistance (0.5-3M.OMEGA.) and
were filled with 3M KCl.
[0125] The resting membrane potential of oocytes expressing h-TREK1
was--72.1+/-3.5 mV compared with--40.2+/-3.5 mV for uninjected
oocytes. Expression of h-TREK1 channels therefore drives the
resting potential towards a more negative value nearer the
equilibrium potential for potassium. This indicates a role for this
channel in controlling resting membrane potential and therefore
excitability of expressing cells.
[0126] To determine whether the main conducting ion was potassium,
currents were evoked in response to 500 ms voltage steps from a
holding potential of -80 mV in extracellular solutions containing a
range of concentrations of potassium. Current-voltage curves were
shifted to the right in the presence of increasing concentrations
of potassium indicating that potassium is the main conducting ion
(FIG. 1). Furthermore no change in the reversal potential was
observed when NaCl was replaced with NMDG.
[0127] The currents recorded from h-TREK1 expressing oocytes were
also found to be potentiated by arachidonic acid (FIG. 2).
Increases in the cellular free concentration of arachidonic acid
are known to occur in pathological conditions including epilepsy,
stroke and brain ischaemia.
1 SEQUENCE INFORMATION SEQ ID NO:1
GAATAAGAATGGCGGCACCTGACTTGCTGGATCCTAAATCTGCCGCTCAG AACTCCAAAC
CGAGGCTCTCGTTTTCCACGAAACCCACAGTGCTTGCTTCCCGGGT- GGAG AGTGACACGA
CCATTAATGTTATGAAATGGAAGACG- GTCTCCACGATATTCCTGGTGGTT GTCCTCTATC
TGATCATCGGAGCCACCGTGTTCAAAGCATTGGAGCAGCCTCATGAGATT TCACAGAGGA
CCACCATTGTGATCCAGAAGCAAACATTCATATCCCAACATTCCTG- TGTC AATTCGACGG
AGCTGGATGAACTCATTCAGCAAATA- GTGGCAGCAATAAATGCAGGGATT ATACCGTTAG
GAAACACCTCCAATCAAATCAGTCACTGGGATTTGGGAAGTTCCTTCTTC TTTGCTGGCA
CTGTTATTACAACCATAGGATTTGGAAACATCTCACCACGCACAGA- AGGC GGCAAAATAT
TCTGTATCATCTATGCCTTACTGGGA- ATTCCCCTCTTTGGTTTTCTCTTG GCTGGAGTTG
GAGATCAGCTAGGCACCATATTTGGAAAAGGAATTGCCAAAGTGGAAGAT ACGTTTATTA
AGTGGAATGTTAGTCAGACCAAGATTCGCATCATCTCAACAATCAT- ATTT ATACTATTTG
GCTGTGTACTCTTTGTGGCTCTGCCT- GCGATCATATTCAAACACATAGAA GGCTGGAGTG
CCCTGGACGCCATTTATTTTGTGGTTATCACTCTAACAACTATTGGATTT GGTGACTACG
TTGCAGGTGGATCCGATATTGAATATCTGGACTTCTATAAGCCTGT- CGTG TGGTTCTGGA
TCCTTGTAGGGCTTGCTTACTTTGCT- GCTGTCCTGAGCATGATTGGAGAT TGGCTCCGAG
TGATATCTAAAAAGACAAAAGAAGAGGTGGGAGAGTTCAGAGCACACGCT GCTGAGTGGA
CAGCCAACGTCACAGCCGAATTCAAAGAAACCAGGAGGCGACTGAG- TGTG GAGATTTATG
ACAAGTTCCAGCGGGCCACCTCCATC- AAGCGGAAGCTCTCGGCAGAACTG GCTGGAAACC
ACAATCAGGAGCTGACTCCTTGTAGGAGGACCCTGTCAGTGAACCACCTG ACCAGCGAGA
GGGATGTCTTGCCTCCCTTACTGAAGACTGAGAGTATCTATCTGAA- TGGT TTGACGCCAC
ACTGTGCTGGTGAAGAGATTGCTGTG- ATTGAGAACATCAAATAGCC
[0128]
2 SEQ ID NO:2 MAAPDLLDPKSAAQNSKPRLSFSTKPTVLASRVESDTTINVMKWKT- VSTI
FLVVVLYLII GATVFKALEQPHEISQRTTIVIQKQT- FISQHSCVNSTELDELIQQIVAAI
NAGIIPLGNT SNQISHWDLGSSFFFAGTVITTIGFGNISPRTEGGKIFCIIYALLGIPLF
GFLLAGVGDQ LGTIFGKGIAKVEDTFIKWNVSQTKIRIISTIIFILFGCVLFVALP- AIIF
KHIEGWSALE AIYFVVITLTTIGFGDYVAGGSDIEY- LDFYKPVVWFWILVGLAYFAAVLS
MIGDWLRVIS KKTKEEVGEFRAHAAEWTANVTAEFKETRRRLSVEIYDKFQRATSIKRKL
SAELAGNHNQ ELTPCRRTLSVNHLTSERDVLPPLLKTESIYLNGLTPHCAGEEIAV- IENI
K
[0129]
3 SEQ ID NO:3 AACACCTCCAATCAAATCAGTCACTGGGATTTGGGAAGTTCCTTCT-
TCTTTGCTGGCACTGTTATTACAACC ATAGGATTTGGAAACATCTCACCACGCACAG-
AAGGCGGCAAAATATTCTGTATCATCTATGCCTTACTGGGA
ATTCCCCTCTTTGGTTTTCTCTTGGCTGGAGTTGGAGATCAGCTAGGCACCATATTTGGAAAAGGAATTGCC
AAAGTGGAAGATACGTTTATTAAGTGGAATGTTAGTCAGACCAAGATTCGCATCATC-
TCAACAATCATATTT ATACTATTTGGCTGTGTACTCTTTGTGGCTCTG
[0130]
4 SEQ ID NO:4 Q: NSSNQVSHWDLGSSFFFAGTVITTIGFGNISPRTEGGKIFCII-
YALLGIPLFGFLLAGVGDQLGTIF N+SNQ+SHWDLGSSFFFAGTVITTIGFGNIS-
PRTEGGKIFCIIYALLGIPLFGFLLAGVGDQLGTIF DB:
NTSNQISHWDLGSSFFFAGTVITTIGFGNISPRTEGGKIFCIIYALLGIPLFGFLLAGVGDQLGTIF
Q: GKGIAKVEDTFIKWNVSQTKIRIISTIIFILFGCVLFVAL
GKGIAKVEDTFIKWNVSQTKIRIISTIIFILFGCVLFVAL DB:
GKGIAKVEDTFIKWNVSQTKIRIISTIIFILFGCVLFVAL
[0131]
5 SEQ D NO:5 AGAGCGGCGAGGCGAGGGGAGAGTGGTGCTACGGGCCAGGCGGGCCA- CCC
CGGGCCACAC CCCCACCTTGCGGGCGCCCGGCGGGGC- TCGAGCCAGGCGGGGCGCCTCAC
AAAGACATGC GAAGAGGGGCTGCAGTGATCACCCCCTCGCTGAGCCCCGGGGCAGAGCCC
AGCCGCCGGC CGAGCGCACGGAGCCACGGGCCGAGCGCACCCAGGGCCCGCGCGGG- ACCC
CAGGCGGCCA CGCAATCGGGGTGACCCATCGCGCGC- GGGGGCGTCTTCGTCCCATCCCAA
CTTGGCCTCG GCCTCGCCTTCTGCCCAGCCTGCCACCGCTGGTCTCTTCTCCTTCCGGCG
ATTTCGTTTC TTCTCACGTTCCCCCTTGTATACCCTTCCGGCTTCCAGCCCCGTTT- TCCC
CACCTTGTAA AACAAAGCGGGGGAAAATGCCTACCC- GTGCAGCTCGGAGCGCGCAGCCTG
TCTTGGAATA AGGATGGCGGCCCCTGACTTGCTGGATCCCAAGTCTGCTGCTCAGAACTC
CAAACCGAGG CTCTCATTCTCTTCAAAACCCACCGTGCTTGCTTCCCGGGTGGAGA- GTGA
CTCGGCCATT AATGTTATGAAATGGAAGACAGTCTC- CACGATTTTCCTGGTGGTCGTCCT
CTACCTGATC ATCGGAGCCGCGGTGTTCAAGGCATTGGAGCAGCCTCAGGAGATTTCCCA
GAGGACCACC ATTGTGATCCAGAAGCAGACCTTCATAGCCCAGCATGCCTGCGTCA- ACTC
CACCGAGCTG GACGAACTCATCCAGCAAATAGTGGC- AGCAATAAACGCAGGGATTATCCC
CTTAGGAAAC AGCTCCAATCAAGTTAGTCACTGGGACCTCGGAAGCTCTTTCTTCTTTGC
TGGTACTGTT ATCACAACCATAGGATTTGGAAACATCTCCCCACGAACTGAAGGTG- GAAA
AATATTCTGC ATCATCTATGCCTTGCTGGGAATTCC- CCTCTTTGGCTTTCTACTGGCTGG
GGTTGGTGAT CAGCTAGGAACTATATTTGGAAAAGGAATTGCCAAAGTGGAAGACACATT
TATTAAGTGG AATGTTAGTCAGACGAAGATTCGTATCATCTCCACCATCATCTTCA- TCCT
GTTTGGCTGT GTCCTCTTTGTGGCTCTCCCTGCGGT- CATATTCAAGCACATAGAAGGCTG
GAGCGCCCTG GACGCTATCTATTTTGTGGTTATCACTCTGACGACCATTGGATTTGGAGA
CTACGTGGCA GGTGGATCAGACATTGAATATCTGGACTTCTACAAGCCTGTGGTGT- GGTT
CTGGATCCTC GTTGGGCTGGCCTACTTTGCAGCTGT- TCTGAGCATGATTGGGGACTGGCT
ACGGGTGATC TCTAAGAAGACGAAGGAAGAGGTGGGAGAGTTCAGAGCGCATGCCGCTGA
GTGGACAGCC AATGTCACGGCCGAGTTCAAGGAAACGAGGAGGCGGCTGAGCGTGG- AGAT
CTACGACAAG TTCCAGCGTGCCACATCCGTGAAGCG- GAAGCTCTCCGCAGAGCTGGCGGG
CAACCACAAC CAGGAACTGACTCCGTGTATGAGGACCCTGTCTGTGAACCACCTGACCAG
CGAGAGGGAA GTCCTGCCTCCCTTGCTGAAGGCTGAGAGCATCTATCTGAACGGTC- TGAC
ACCACACTGT GCTGGTGAGGACATAGCTGTCATTGA- GAACATGAAGTAGCCCTCTCTTGG
AAGAGTCTGA GGTGGAGCCATAGGGAAGGGCTTCTCTAGGCTCTTTGTGACTGTTGCCGG
TAGCATTTAA ACATTGTGCATGGTGACCTCAAAGGGAAAGCAAATAGAAAACACCC- ATCT
GGTCACCTTA CATCCAGGGAGGGTGTTGTCCCGAGG- CGGCACTCTGAGGATGCCGTGTGC
TGTCCGCTGA GTGCTGAGTGATGGACAGGCAGTGTCTGATGCCTTTTGTGCCCAGACTGT
TTCCCCTCCC CCTCTCTCCTAACG
[0132]
6 SEQ ID NO:6 MAAPDLLDPKSAAQNSKPRLSFSSKPTVLASRVESDSAINVMKWKT- VSTI
FLVVVLYLII GAAVFKALEQPQEISQRTTIVIQKQT- FIAQHACVNSTELDELIQQIVAAI
NAGIIPLGNS SNQVSHWDLGSSFFFAGTVITTIGFGNISPRTEGGKIFCIIYALLGIPLF
GFLLAGVGDQ LGTIFGKGIAKVEDTFIKWNVSQTKIRIISTIIFILFGCVLFVALP- AVIF
KHIEGWSALD AIYFVVITLTTIGFGDYVAGGSDIEY- LDFYKPVVWFWILVGLAYFAAVLS
MIGDWLRVIS KKTKEEVGEFRAHAAEWTANVTAEFKETRRRLSVEIYDKFQRATSVKRKL
SAELAGNHNQ ELTPCMRTLSVNHLTSEREVLPPLLKAESIYLNGLTPHCAGEDIAV- IENN
K
[0133]
Sequence CWU 1
1
6 1 1246 DNA HOMO SAPIENS 1 gaataagaat ggcggcacct gacttgctgg
atcctaaatc tgccgctcag aactccaaac 60 cgaggctctc gttttccacg
aaacccacag tgcttgcttc ccgggtggag agtgacacga 120 ccattaatgt
tatgaaatgg aagacggtct ccacgatatt cctggtggtt gtcctctatc 180
tgatcatcgg agccaccgtg ttcaaagcat tggagcagcc tcatgagatt tcacagagga
240 ccaccattgt gatccagaag caaacattca tatcccaaca ttcctgtgtc
aattcgacgg 300 agctggatga actcattcag caaatagtgg cagcaataaa
tgcagggatt ataccgttag 360 gaaacacctc caatcaaatc agtcactggg
atttgggaag ttccttcttc tttgctggca 420 ctgttattac aaccatagga
tttggaaaca tctcaccacg cacagaaggc ggcaaaatat 480 tctgtatcat
ctatgcctta ctgggaattc ccctctttgg ttttctcttg gctggagttg 540
gagatcagct aggcaccata tttggaaaag gaattgccaa agtggaagat acgtttatta
600 agtggaatgt tagtcagacc aagattcgca tcatctcaac aatcatattt
atactatttg 660 gctgtgtact ctttgtggct ctgcctgcga tcatattcaa
acacatagaa ggctggagtg 720 ccctggacgc catttatttt gtggttatca
ctctaacaac tattggattt ggtgactacg 780 ttgcaggtgg atccgatatt
gaatatctgg acttctataa gcctgtcgtg tggttctgga 840 tccttgtagg
gcttgcttac tttgctgctg tcctgagcat gattggagat tggctccgag 900
tgatatctaa aaagacaaaa gaagaggtgg gagagttcag agcacacgct gctgagtgga
960 cagccaacgt cacagccgaa ttcaaagaaa ccaggaggcg actgagtgtg
gagatttatg 1020 acaagttcca gcgggccacc tccatcaagc ggaagctctc
ggcagaactg gctggaaacc 1080 acaatcagga gctgactcct tgtaggagga
ccctgtcagt gaaccacctg accagcgaga 1140 gggatgtctt gcctccctta
ctgaagactg agagtatcta tctgaatggt ttgacgccac 1200 actgtgctgg
tgaagagatt gctgtgattg agaacatcaa atagcc 1246 2 411 PRT HOMO SAPIENS
2 Met Ala Ala Pro Asp Leu Leu Asp Pro Lys Ser Ala Ala Gln Asn Ser 1
5 10 15 Lys Pro Arg Leu Ser Phe Ser Thr Lys Pro Thr Val Leu Ala Ser
Arg 20 25 30 Val Glu Ser Asp Thr Thr Ile Asn Val Met Lys Trp Lys
Thr Val Ser 35 40 45 Thr Ile Phe Leu Val Val Val Leu Tyr Leu Ile
Ile Gly Ala Thr Val 50 55 60 Phe Lys Ala Leu Glu Gln Pro His Glu
Ile Ser Gln Arg Thr Thr Ile 65 70 75 80 Val Ile Gln Lys Gln Thr Phe
Ile Ser Gln His Ser Cys Val Asn Ser 85 90 95 Thr Glu Leu Asp Glu
Leu Ile Gln Gln Ile Val Ala Ala Ile Asn Ala 100 105 110 Gly Ile Ile
Pro Leu Gly Asn Thr Ser Asn Gln Ile Ser His Trp Asp 115 120 125 Leu
Gly Ser Ser Phe Phe Phe Ala Gly Thr Val Ile Thr Thr Ile Gly 130 135
140 Phe Gly Asn Ile Ser Pro Arg Thr Glu Gly Gly Lys Ile Phe Cys Ile
145 150 155 160 Ile Tyr Ala Leu Leu Gly Ile Pro Leu Phe Gly Phe Leu
Leu Ala Gly 165 170 175 Val Gly Asp Gln Leu Gly Thr Ile Phe Gly Lys
Gly Ile Ala Lys Val 180 185 190 Glu Asp Thr Phe Ile Lys Trp Asn Val
Ser Gln Thr Lys Ile Arg Ile 195 200 205 Ile Ser Thr Ile Ile Phe Ile
Leu Phe Gly Cys Val Leu Phe Val Ala 210 215 220 Leu Pro Ala Ile Ile
Phe Lys His Ile Glu Gly Trp Ser Ala Leu Asp 225 230 235 240 Ala Ile
Tyr Phe Val Val Ile Thr Leu Thr Thr Ile Gly Phe Gly Asp 245 250 255
Tyr Val Ala Gly Gly Ser Asp Ile Glu Tyr Leu Asp Phe Tyr Lys Pro 260
265 270 Val Val Trp Phe Trp Ile Leu Val Gly Leu Ala Tyr Phe Ala Ala
Val 275 280 285 Leu Ser Met Ile Gly Asp Trp Leu Arg Val Ile Ser Lys
Lys Thr Lys 290 295 300 Glu Glu Val Gly Glu Phe Arg Ala His Ala Ala
Glu Trp Thr Ala Asn 305 310 315 320 Val Thr Ala Glu Phe Lys Glu Thr
Arg Arg Arg Leu Ser Val Glu Ile 325 330 335 Tyr Asp Lys Phe Gln Arg
Ala Thr Ser Ile Lys Arg Lys Leu Ser Ala 340 345 350 Glu Leu Ala Gly
Asn His Asn Gln Glu Leu Thr Pro Cys Arg Arg Thr 355 360 365 Leu Ser
Val Asn His Leu Thr Ser Glu Arg Asp Val Leu Pro Pro Leu 370 375 380
Leu Lys Thr Glu Ser Ile Tyr Leu Asn Gly Leu Thr Pro His Cys Ala 385
390 395 400 Gly Glu Glu Ile Ala Val Ile Glu Asn Ile Lys 405 410 3
321 DNA HOMO SAPIENS 3 aacacctcca atcaaatcag tcactgggat ttgggaagtt
ccttcttctt tgctggcact 60 gttattacaa ccataggatt tggaaacatc
tcaccacgca cagaaggcgg caaaatattc 120 tgtatcatct atgccttact
gggaattccc ctctttggtt ttctcttggc tggagttgga 180 gatcagctag
gcaccatatt tggaaaagga attgccaaag tggaagatac gtttattaag 240
tggaatgtta gtcagaccaa gattcgcatc atctcaacaa tcatatttat actatttggc
300 tgtgtactct ttgtggctct g 321 4 107 PRT HOMO SAPIENS 4 Asn Ser
Ser Asn Gln Val Ser His Trp Asp Leu Gly Ser Ser Phe Phe 1 5 10 15
Phe Ala Gly Thr Val Ile Thr Thr Ile Gly Phe Gly Asn Ile Ser Pro 20
25 30 Arg Thr Glu Gly Gly Lys Ile Phe Cys Ile Ile Tyr Ala Leu Leu
Gly 35 40 45 Ile Pro Leu Phe Gly Phe Leu Leu Ala Gly Val Gly Asp
Gln Leu Gly 50 55 60 Thr Ile Phe Gly Lys Gly Ile Ala Lys Val Glu
Asp Thr Phe Ile Lys 65 70 75 80 Trp Asn Val Ser Gln Thr Lys Ile Arg
Ile Ile Ser Thr Ile Ile Phe 85 90 95 Ile Leu Phe Gly Cys Val Leu
Phe Val Ala Leu 100 105 5 1994 DNA HOMO SAPIENS 5 agagcggcga
ggcgagggga gagtggtgct acgggccagg cgggccaccc cgggccacac 60
ccccaccttg cgggcgcccg gcggggctcg agccaggcgg ggcgcctcac aaagacatgc
120 gaagaggggc tgcagtgatc accccctcgc tgagccccgg ggcagagccc
agccgccggc 180 cgagcgcacg gagccacggg ccgagcgcac ccagggcccg
cgcgggaccc caggcggcca 240 cgcaatcggg gtgacccatc gcgcgcgggg
gcgtcttcgt cccatcccaa cttggcctcg 300 gcctcgcctt ctgcccagcc
tgccaccgct ggtctcttct ccttccggcg atttcgtttc 360 ttctcacgtt
cccccttgta tacccttccg gcttccagcc ccgttttccc caccttgtaa 420
aacaaagcgg gggaaaatgc ctacccgtgc agctcggagc gcgcagcctg tcttggaata
480 aggatggcgg cccctgactt gctggatccc aagtctgctg ctcagaactc
caaaccgagg 540 ctctcattct cttcaaaacc caccgtgctt gcttcccggg
tggagagtga ctcggccatt 600 aatgttatga aatggaagac agtctccacg
attttcctgg tggtcgtcct ctacctgatc 660 atcggagccg cggtgttcaa
ggcattggag cagcctcagg agatttccca gaggaccacc 720 attgtgatcc
agaagcagac cttcatagcc cagcatgcct gcgtcaactc caccgagctg 780
gacgaactca tccagcaaat agtggcagca ataaacgcag ggattatccc cttaggaaac
840 agctccaatc aagttagtca ctgggacctc ggaagctctt tcttctttgc
tggtactgtt 900 atcacaacca taggatttgg aaacatctcc ccacgaactg
aaggtggaaa aatattctgc 960 atcatctatg ccttgctggg aattcccctc
tttggctttc tactggctgg ggttggtgat 1020 cagctaggaa ctatatttgg
aaaaggaatt gccaaagtgg aagacacatt tattaagtgg 1080 aatgttagtc
agacgaagat tcgtatcatc tccaccatca tcttcatcct gtttggctgt 1140
gtcctctttg tggctctccc tgcggtcata ttcaagcaca tagaaggctg gagcgccctg
1200 gacgctatct attttgtggt tatcactctg acgaccattg gatttggaga
ctacgtggca 1260 ggtggatcag acattgaata tctggacttc tacaagcctg
tggtgtggtt ctggatcctc 1320 gttgggctgg cctactttgc agctgttctg
agcatgattg gggactggct acgggtgatc 1380 tctaagaaga cgaaggaaga
ggtgggagag ttcagagcgc atgccgctga gtggacagcc 1440 aatgtcacgg
ccgagttcaa ggaaacgagg aggcggctga gcgtggagat ctacgacaag 1500
ttccagcgtg ccacatccgt gaagcggaag ctctccgcag agctggcggg caaccacaac
1560 caggaactga ctccgtgtat gaggaccctg tctgtgaacc acctgaccag
cgagagggaa 1620 gtcctgcctc ccttgctgaa ggctgagagc atctatctga
acggtctgac accacactgt 1680 gctggtgagg acatagctgt cattgagaac
atgaagtagc cctctcttgg aagagtctga 1740 ggtggagcca tagggaaggg
cttctctagg ctctttgtga ctgttgccgg tagcatttaa 1800 acattgtgca
tggtgacctc aaagggaaag caaatagaaa acacccatct ggtcacctta 1860
catccaggga gggtgttgtc ccgaggcggc actctgagga tgccgtgtgc tgtccgctga
1920 gtgctgagtg atggacaggc agtgtctgat gccttttgtg cccagactgt
ttcccctccc 1980 cctctctcct aacg 1994 6 411 PRT HOMO SAPIENS 6 Met
Ala Ala Pro Asp Leu Leu Asp Pro Lys Ser Ala Ala Gln Asn Ser 1 5 10
15 Lys Pro Arg Leu Ser Phe Ser Ser Lys Pro Thr Val Leu Ala Ser Arg
20 25 30 Val Glu Ser Asp Ser Ala Ile Asn Val Met Lys Trp Lys Thr
Val Ser 35 40 45 Thr Ile Phe Leu Val Val Val Leu Tyr Leu Ile Ile
Gly Ala Ala Val 50 55 60 Phe Lys Ala Leu Glu Gln Pro Gln Glu Ile
Ser Gln Arg Thr Thr Ile 65 70 75 80 Val Ile Gln Lys Gln Thr Phe Ile
Ala Gln His Ala Cys Val Asn Ser 85 90 95 Thr Glu Leu Asp Glu Leu
Ile Gln Gln Ile Val Ala Ala Ile Asn Ala 100 105 110 Gly Ile Ile Pro
Leu Gly Asn Ser Ser Asn Gln Val Ser His Trp Asp 115 120 125 Leu Gly
Ser Ser Phe Phe Phe Ala Gly Thr Val Ile Thr Thr Ile Gly 130 135 140
Phe Gly Asn Ile Ser Pro Arg Thr Glu Gly Gly Lys Ile Phe Cys Ile 145
150 155 160 Ile Tyr Ala Leu Leu Gly Ile Pro Leu Phe Gly Phe Leu Leu
Ala Gly 165 170 175 Val Gly Asp Gln Leu Gly Thr Ile Phe Gly Lys Gly
Ile Ala Lys Val 180 185 190 Glu Asp Thr Phe Ile Lys Trp Asn Val Ser
Gln Thr Lys Ile Arg Ile 195 200 205 Ile Ser Thr Ile Ile Phe Ile Leu
Phe Gly Cys Val Leu Phe Val Ala 210 215 220 Leu Pro Ala Val Ile Phe
Lys His Ile Glu Gly Trp Ser Ala Leu Asp 225 230 235 240 Ala Ile Tyr
Phe Val Val Ile Thr Leu Thr Thr Ile Gly Phe Gly Asp 245 250 255 Tyr
Val Ala Gly Gly Ser Asp Ile Glu Tyr Leu Asp Phe Tyr Lys Pro 260 265
270 Val Val Trp Phe Trp Ile Leu Val Gly Leu Ala Tyr Phe Ala Ala Val
275 280 285 Leu Ser Met Ile Gly Asp Trp Leu Arg Val Ile Ser Lys Lys
Thr Lys 290 295 300 Glu Glu Val Gly Glu Phe Arg Ala His Ala Ala Glu
Trp Thr Ala Asn 305 310 315 320 Val Thr Ala Glu Phe Lys Glu Thr Arg
Arg Arg Leu Ser Val Glu Ile 325 330 335 Tyr Asp Lys Phe Gln Arg Ala
Thr Ser Val Lys Arg Lys Leu Ser Ala 340 345 350 Glu Leu Ala Gly Asn
His Asn Gln Glu Leu Thr Pro Cys Met Arg Thr 355 360 365 Leu Ser Val
Asn His Leu Thr Ser Glu Arg Glu Val Leu Pro Pro Leu 370 375 380 Leu
Lys Ala Glu Ser Ile Tyr Leu Asn Gly Leu Thr Pro His Cys Ala 385 390
395 400 Gly Glu Asp Ile Ala Val Ile Glu Asn Met Lys 405 410
* * * * *