U.S. patent number 11,278,620 [Application Number 16/210,140] was granted by the patent office on 2022-03-22 for anti-lag3 antibodies and antigen-binding fragments.
This patent grant is currently assigned to MERCK SHARP & DOHME CORP.. The grantee listed for this patent is Merck Sharp & Dohme Corp.. Invention is credited to Rene De Waal Malefyt, Laurence Fayadat-Dilman, Linda Liang, Gopalan Raghunathan.
United States Patent |
11,278,620 |
Liang , et al. |
March 22, 2022 |
Anti-LAG3 antibodies and antigen-binding fragments
Abstract
The present invention includes antibodies and antigen-binding
fragments thereof that specifically bind to human or cynomolgous
monkey LAG3 as well as immunoglobulin chains thereof and
polynucleotides encoding the same along with injection devices
comprising such antibodies or fragments. Vaccines including such
antibodies and fragments as well as compositions comprising the
antibodies and fragments (e.g., including anti-PD1 antibodies) are
included in the invention. Methods for treating or preventing
cancer or infection using such compositions are also provided. In
addition, methods for recombinant expression of the antibodies and
fragments are part of the present invention.
Inventors: |
Liang; Linda (Mountain View,
CA), Fayadat-Dilman; Laurence (Sunnyvale, CA), De Waal
Malefyt; Rene (Sunnyvale, CA), Raghunathan; Gopalan (San
Diego, CA) |
Applicant: |
Name |
City |
State |
Country |
Type |
Merck Sharp & Dohme Corp. |
Rahway |
NJ |
US |
|
|
Assignee: |
MERCK SHARP & DOHME CORP.
(Rahway, NJ)
|
Family
ID: |
1000006188484 |
Appl.
No.: |
16/210,140 |
Filed: |
December 5, 2018 |
Prior Publication Data
|
|
|
|
Document
Identifier |
Publication Date |
|
US 20190083615 A1 |
Mar 21, 2019 |
|
Related U.S. Patent Documents
|
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
Issue Date |
|
|
15482355 |
Apr 7, 2017 |
10188730 |
|
|
|
15305011 |
|
|
|
|
|
PCT/US2015/045481 |
Aug 17, 2015 |
|
|
|
|
62171319 |
Jun 5, 2015 |
|
|
|
|
62039081 |
Aug 19, 2014 |
|
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
A61K
39/39566 (20130101); A61K 45/06 (20130101); C07K
16/2818 (20130101); A61K 39/395 (20130101); C07K
16/2803 (20130101); C07K 16/2896 (20130101); C07K
2317/50 (20130101); C07K 2317/24 (20130101); C07K
2317/32 (20130101); C07K 2317/33 (20130101); C07K
2317/34 (20130101); A61K 2039/507 (20130101); C07K
2317/41 (20130101); C07K 2317/76 (20130101); A61K
2039/505 (20130101); C07K 2317/92 (20130101) |
Current International
Class: |
A61K
39/395 (20060101); C07K 16/28 (20060101); A61K
45/06 (20060101); A61K 39/00 (20060101) |
References Cited
[Referenced By]
U.S. Patent Documents
Foreign Patent Documents
|
|
|
|
|
|
|
0510079 |
|
Jul 1991 |
|
EP |
|
0758383 |
|
Nov 1995 |
|
EP |
|
1897548 |
|
Mar 2008 |
|
EP |
|
2044949 |
|
Apr 2009 |
|
EP |
|
2320940 |
|
May 2011 |
|
EP |
|
2659893 |
|
Feb 2014 |
|
EP |
|
2792365 |
|
Oct 2014 |
|
EP |
|
WO199110682 |
|
Jul 1991 |
|
WO |
|
WO199530750 |
|
Nov 1995 |
|
WO |
|
WO199823741 |
|
Jun 1996 |
|
WO |
|
WO199703695 |
|
Feb 1997 |
|
WO |
|
WO1998023748 |
|
Jun 1998 |
|
WO |
|
WO1998058059 |
|
Dec 1998 |
|
WO |
|
WO2003031655 |
|
Apr 2003 |
|
WO |
|
2004078928 |
|
Sep 2004 |
|
WO |
|
WO2008132601 |
|
Nov 2008 |
|
WO |
|
2010019570 |
|
Feb 2010 |
|
WO |
|
WO2011109789 |
|
Sep 2011 |
|
WO |
|
2012177624 |
|
Dec 2012 |
|
WO |
|
2013003761 |
|
Jan 2013 |
|
WO |
|
WO2013066761 |
|
May 2013 |
|
WO |
|
WO2013079945 |
|
Jun 2013 |
|
WO |
|
WO2013192215 |
|
Dec 2013 |
|
WO |
|
2014008218 |
|
Jan 2014 |
|
WO |
|
2014030049 |
|
Feb 2014 |
|
WO |
|
WO2014028560 |
|
Feb 2014 |
|
WO |
|
WO2014030052 |
|
Feb 2014 |
|
WO |
|
2014140180 |
|
Sep 2014 |
|
WO |
|
WO2014144791 |
|
Sep 2014 |
|
WO |
|
WO2014163684 |
|
Oct 2014 |
|
WO |
|
WO2014179664 |
|
Nov 2014 |
|
WO |
|
WO2014209804 |
|
Dec 2014 |
|
WO |
|
WO201516718 |
|
Feb 2015 |
|
WO |
|
2015042246 |
|
Mar 2015 |
|
WO |
|
WO2015048312 |
|
Apr 2015 |
|
WO |
|
WO2015069571 |
|
May 2015 |
|
WO |
|
WO2015069770 |
|
May 2015 |
|
WO |
|
WO2015085210 |
|
Jun 2015 |
|
WO |
|
WO2015091970 |
|
Jun 2015 |
|
WO |
|
WO2015092382 |
|
Jun 2015 |
|
WO |
|
WO2015112534 |
|
Jul 2015 |
|
WO |
|
WO2015116539 |
|
Aug 2015 |
|
WO |
|
2015138920 |
|
Sep 2015 |
|
WO |
|
2015200119 |
|
Dec 2015 |
|
WO |
|
WO2015200828 |
|
Dec 2015 |
|
WO |
|
WO2016123285 |
|
Aug 2016 |
|
WO |
|
WO2016126858 |
|
Aug 2016 |
|
WO |
|
2016168716 |
|
Oct 2016 |
|
WO |
|
2016200782 |
|
Dec 2016 |
|
WO |
|
2017019894 |
|
Feb 2017 |
|
WO |
|
Other References
Avice, Marie-Noelle et al., Lymphocyte Activation Gene-3, a MHC
Class II Ligand Expressed on Activated T Cells, Stimulates
TNF-alpha and IL-12 Production by Monocytes and Dendritic Cells, J.
Immunol., 1999, pp. 2748-2753, vol. 162. cited by applicant .
Al'tshuler, Poluchenie rekombinatnykh antitel i sposoby
uvelicheniya ikh affinnosti, Uspekhi biologicheskoj khimii, 2010,
207, t.50. cited by applicant .
Baixeras et al., Characterization of the Lymphocyte Activation
Gene3-Encoded Protein A New Ligand for Human Leukocyte Antigen
Class II Antigens, J. Exp. Med, 1992, 327-337, 176. cited by
applicant .
Bruniquel et al., Regulation of Expression of the Human Lymphocyte
Activation Gene-3 LAG-3 Molecule, Immunogenetics, 1998, Section 2,
pp. 116-124, 48. cited by applicant .
Creg J. Workman et al., LAG-3 Regulates Plasmacytoid Dendritic Cell
Homeostasis, The Journal of Immunology, 2009, 1885-1891, 182. cited
by applicant .
Demeure et al. , Role of LAG-3/MHC Class II Interactions in
Cell-Cell Contacts, Eur. J. Cancer, 2001, Issue 13, pp. 1709-1718,
37. cited by applicant .
Depascalis, R et al., Grafting of "Abbreviated"
Complementarity-Determining Regions Containing
Specificity-Determining Residues Essential for Ligand Contact to
Engineer a Less Immunogenic Humanized Monoclonal Antibody, The
Journal of Immunology, 2002, pp. 3076-3084, 169. cited by applicant
.
Freeman & Sharpe, A new therapeutic strategy for malaria:
targeting T cell Exhaustion, Nat. Immunol., 2012, 113-115, 13(2).
cited by applicant .
Grosso et al., LAG-3 Regulates CD8+ T Cell Accumulation and
Effector Function in Murine Self-and Tumor-Tolerance Systems, J.
Clin. Invest., 2007, Section 11, pp. 3383-3392, 117. cited by
applicant .
Hannier et al., CD3/TCR Complex-Associated Lymphocyte Activation
Gene-3 Molecules Inhibit CD3/TCR Signaling, J. Immunol., 1998,
4058-4065, 161. cited by applicant .
Huard et al., Cellular expression and tissue distribution of the
human LAG-3-encoded protein, an MHC class II ligand,
Immunogenetics, 1994, 213-217, 39. cited by applicant .
Huard et al., Characterization of the major histocompatibility
complex class II binding site on LAG-3 protein, Proc. Nat. Acad.
Sci. USA, 1997, 5744-5749, 94. cited by applicant .
Huard et al., T Cell Major Histocompatibility, Eur. J. Immunol.,
1996, Issue 5, pp. 1180-1186, 26. cited by applicant .
Huard, B et al., Lymphocyte-activation gene 3/major
histocompatibility complex class II interaction modulates the
antigenic response of CD4+ T lymphocytes, Eur. J. Immunol., 1994,
pp. 3216-3221, 24. cited by applicant .
International Search Report of PCT/US2015/045481 dated Oct. 9,
2015, 14 pages. cited by applicant .
Kojko, R., Immunologiya: uchebnoe posobie, Moskva, izdatel'skij
tsentr, Akademiya, 2008, 61-63. cited by applicant .
MacCallum, RM et al., Antibody-antigen interactions: Contact
analysis and binding site topography, J. Mol. Biol., 1996, pp.
732-745, 262. cited by applicant .
Malgorzata Kisielow et al., Expression of lymphocyte activation
gene 3 (LAG-3) on B cells is induced by T cells, European Journal
of Immunology, 2005, 2081-2088, 35. cited by applicant .
Miyazaki et al., LAG-3 T Helper Cells in CD4 Deficient Mice, Int.
Immunol., 1996, Issue 5, pp. 725-729, 8. cited by applicant .
Pardoll & Drake, Immunotherapy earns its spot in the ranks of
cancer therapy, J. Exp. Med., 2012, 201-209, 209 (2). cited by
applicant .
Phan et al., PNAS Cancer Regression and Autoimmunity Induced by
Cytotoxic T Lymphocyte associated antigen for Blockade, Patients
with Metastic Melanoma, 2003, pp. 8372-838377, NA. cited by
applicant .
S.-R. Woo et al., Immune Inhibitory Molecules LAG-3 and PD-1
Synergistically Regulate T-Cell Function to Promote Tumoral Immune
Escape, Cancer Research, Dec. 20, 2011, 917-927, 72-4. cited by
applicant .
Shawn D. Blackburn et al., Coregulation of CD8+ T cell exhaustion
by multiple inhibitory receptors during chronic viral infection,
Nature Immunology, Jan. 2009, 29-37, 10-1. cited by applicant .
Sierro et al., The CD4 like Molecule LAG-3, Expert Opin. Ther.
Targets, 2011, Section 1, pp. 91-101, 15. cited by applicant .
Susanne Andreae et al., Maturation and Activation of Dendritic
Cells Induced by Lymphocyte Activation Gene-3 (CD223), The Journal
of Immunology, 2002, 3874-3880, 168. cited by applicant .
Triebel et al., LAG-3 A Novel Lymphocyte Activation Gene, J. Exp.
Med., 1990, Issue 5, pp. 1393-1405, 171. cited by applicant .
Triebel et al., LAG-3 A Regulator of T-cell and CD Responses,
Trends Immunol., 2003, Issue 12, pp. 619-622, 24. cited by
applicant .
Workman et al., LAG-3 CD223 Regulates the Expansion of Activated T
Cells, Eur. J. Immunol., 2003, pp. 970-979, 33. cited by applicant
.
Workman et al., Phenotypic Analysis of the Murine CD-4 Related
Glycoprotein, Eur. J. Immunol., 2002, pp. 2255-2263, 32. cited by
applicant .
Gerald B. Dermer, Another Anniversary on the war on Cancer,
Bio/Technology, 1994, 320, 12. cited by applicant .
Gura, T , "Cancer Models: Systems for Identifying New Drugs are
often faulty", Science Magazine, 1997, pp. 1041-1042, vol. 278,
Issue 5340. cited by applicant .
U.S. Appl. No. 16/966,100, Inventor Mingmei Cai, et al., Applicant
Merck Sharp & Dohme Corp., filed Feb. 1, 2018. cited by
applicant .
U.S. Appl. No. 17/274,531, Inventor Elliot K. Chartash, et al.,
Applicant Merck Sharp & Dohme Corp., filed Mar. 9, 2021. cited
by applicant .
U.S. Appl. No. 17/289,810, Inventor Anson Kunjachan Abraham, et
al., Applicant Merck Sharp & Dohme Corp., filed Apr. 29, 2021.
cited by applicant .
U.S. Appl. No. 15/482,355, filed Apr. 7, 2017. cited by
applicant.
|
Primary Examiner: Belyavskyi; Michail A
Attorney, Agent or Firm: Su; Li Cocuzzo; Anna
Parent Case Text
This Application is a divisional of U.S. application Ser. No.
15/482,355, issued as U.S. Pat. No. 10,188,730, which is a
continuation of U.S. application Ser. No. 15/305,011, filed Oct.
18, 2016, which is a U.S. National Phase application under 35
U.S.C. .sctn. 371 of PCT/US15/45481, filed Aug. 17, 2015, which
claims priority to U.S. Provisional Patent Application No.
62/171,319, filed Jun. 5, 2015; and claims priority to U.S.
Provisional Patent Application No. 62/039,081, filed Aug. 19, 2014;
each of which is herein incorporated by reference in its
entirety.
The instant application contains a Sequence Listing which has been
submitted electronically in ASCII format and is hereby incorporated
by reference in its entirety. Said ASCII copy, created on Dec. 4,
2018, is named 23791USDIV2-SEQTXT-5 Dec. 2018 and is 968 kilobytes
in size.
Claims
We claim:
1. An antibody or antigen-binding fragment thereof that
specifically binds human Lymphocyte Activation Gene-3 (LAG3)
comprising a light chain variable domain and a heavy chain variable
domain which is the product of a method comprising: a. culturing a
host cell comprising a polynucleotide encoding the light chain
variable domain and a polynucleotide encoding the heavy chain
variable domain, or a polynucleotide encoding both the light chain
variable domain and the heavy chain variable domain, of the
antibody or antigen-binding fragment thereof in a culture medium
under conditions wherein the antibody or antigen-binding fragment
thereof is expressed; wherein the light chain variable domain
comprises: CDR-L1 that comprises the amino acid sequence:
KASQSLDYEGDSDMN (SEQ ID NO: 38); CDR-L2 that comprises the amino
acid sequence: GASNLES (SEQ ID NO: 39); and CDR-L3 that comprises
the amino acid sequence: QQSTEDPRT (SEQ ID NO: 40); and the heavy
chain variable domain comprises: CDR-H1 that comprises the amino
acid sequence: DYNVD (SEQ ID NO: 33); CDR-H2 that comprises the
amino acid sequence: DINPNX.sub.1GGTIYX.sub.2QKFX.sub.3X.sub.4 (SEQ
ID NO: 446), wherein, X.sub.1=N, S or Q X.sub.2=A or S X.sub.3=Q or
K, and X.sub.4=E or G; and CDR-H3 that comprises the amino acid
sequence: NYRWFGAMDH (SEQ ID NO: 35); and b. recovering the
antibody or antigen-binding fragment thereof from the host cell or
culture medium.
2. The antibody or antigen-binding fragment of claim 1 that
comprises: (1) a light chain variable domain comprising: CDR-L1
that comprises the amino acid sequence: KASQSLDYEGDSDMN (SEQ ID NO:
38); CDR-L2 that comprises the amino acid sequence: GASNLES (SEQ ID
NO: 39); and CDR-L3 that comprises the amino acid sequence:
QQSTEDPRT (SEQ ID NO: 40); and a heavy chain variable domain
comprising: CDR-H1 that comprises the amino acid sequence: DYNVD
(SEQ ID NO: 33); CDR-H2 that comprises the amino acid sequence:
DINPNNGGTIYAQKFQE (SEQ ID NO: 458); and CDR-H3 that comprises the
amino acid sequence: NYRWFGAMDH (SEQ ID NO: 35); or (2) a light
chain variable domain comprising: CDR-L1 that comprises the amino
acid sequence: KASQSLDYEGDSDMN (SEQ ID NO: 38); CDR-L2 that
comprises the amino acid sequence: GASNLES (SEQ ID NO: 39); and
CDR-L3 that comprises the amino acid sequence: QQSTEDPRT (SEQ ID
NO: 40); and a heavy chain variable domain comprising: CDR-H1 that
comprises the amino acid sequence: DYNVD (SEQ ID NO: 33); CDR-H2
that comprises the amino acid sequence: DINPNSGGTIYAQKFQE (SEQ ID
NO: 456); and CDR-H3 that comprises the amino acid sequence:
NYRWFGAMDH (SEQ ID NO: 35); or (3) a light chain variable domain
comprising: CDR-L1 that comprises the amino acid sequence:
KASQSLDYEGDSDMN (SEQ ID NO: 38); CDR-L2 that comprises the amino
acid sequence: GASNLES (SEQ ID NO: 39); and CDR-L3 that comprises
the amino acid sequence: QQSTEDPRT (SEQ ID NO: 40); and a heavy
chain variable domain comprising: CDR-H1 that comprises the amino
acid sequence: DYNVD (SEQ ID NO: 33); CDR-H2 that comprises the
amino acid sequence: DINPNQGGTIYAQKFQE (SEQ ID NO: 455); and CDR-H3
that comprises the amino acid sequence: NYRWFGAMDH (SEQ ID NO: 35);
or (4) a light chain variable domain comprising: CDR-L1 that
comprises the amino acid sequence: KASQSLDYEGDSDMN (SEQ ID NO: 38);
CDR-L2 that comprises the amino acid sequence: GASNLES (SEQ ID NO:
39); and CDR-L3 that comprises the amino acid sequence: QQSTEDPRT
(SEQ ID NO: 40); and a heavy chain variable domain comprising:
CDR-H1 that comprises the amino acid sequence: DYNVD (SEQ ID NO:
33); CDR-H2 that comprises the amino acid sequence:
DINPNGGGTIYAQKFQE (SEQ ID NO: 454); and CDR-H3 that comprises the
amino acid sequence: NYRWFGAMDH (SEQ ID NO: 35).
3. The antibody or antigen-binding fragment of claim 1 that
comprises: (1) a light chain variable domain comprising the amino
acid sequence set forth in amino acids 21-131 of SEQ ID NO: 126,
and a heavy chain variable domain comprising the amino acid
sequence set forth in amino acids 1-119 of SEQ ID NO: 106; or (2) a
light chain variable domain comprising the amino acid sequence set
forth in amino acids 21-131 of SEQ ID NO: 126, and a heavy chain
variable domain comprising the amino acid sequence set forth in
amino acids 1-119 of SEQ ID NO: 108; or (3) a light chain variable
domain comprising the amino acid sequence set forth in amino acids
21-131 of SEQ ID NO: 126, and a heavy chain variable domain
comprising the amino acid sequence set forth in amino acids 1-119
of SEQ ID NO: 112; or (4) a light chain variable domain comprising
the amino acid sequence set forth in amino acids 21-131 of SEQ ID
NO: 126, and a heavy chain variable domain comprising the amino
acid sequence set forth in amino acids 1-119 of SEQ ID NO: 122.
4. The antibody or antigen-binding fragment of claim 1 that
comprises: (1) a light chain comprising the amino acid sequence set
forth in amino acids 21-238 of SEQ ID NO: 126, and a heavy chain
comprising the amino acid sequence set forth in SEQ ID NO: 106; or
(2) a light chain comprising the amino acid sequence set forth in
amino acids 21-238 of SEQ ID NO: 126, and a heavy chain comprising
the amino acid sequence set forth in SEQ ID NO: 108; or (3) a light
chain comprising the amino acid sequence set forth in amino acids
21-238 of SEQ ID NO: 126, and a heavy chain comprising the amino
acid sequence set forth in SEQ ID NO: 112; or (4) a light chain
comprising the amino acid sequence set forth in amino acids 21-238
of SEQ ID NO: 126, and a heavy chain comprising the amino acid
sequence set forth in SEQ ID NO: 114; or (5) a light chain
comprising the amino acid sequence set forth in amino acids 21-238
of SEQ ID NO: 126, and a heavy chain comprising the amino acid
sequence set forth in SEQ ID NO: 118; or (6) a light chain
comprising the amino acid sequence set forth in amino acids 21-238
of SEQ ID NO: 126, and a heavy chain comprising the amino acid
sequence set forth in SEQ ID NO: 120; or (7) a light chain
comprising the amino acid sequence set forth in amino acids 21-238
of SEQ ID NO: 126, and a heavy chain comprising the amino acid
sequence set forth in SEQ ID NO: 122.
5. The antibody or antigen-binding fragment of claim 1 that is
humanized.
6. The antibody or antigen-binding fragment of claim 2 that is
humanized.
7. The antibody or antigen-binding fragment-of claim 3, wherein the
host cell is a Chinese hamster ovary cell.
8. The antibody or antigen-binding fragment-of claim 4, wherein the
host cell is a Chinese hamster ovary cell.
Description
FIELD OF THE INVENTION
The present invention relates to anti-LAG3 antibodies as well as
use of the antibodies of the present invention in the treatment of
diseases such as cancer and infection.
BACKGROUND OF THE INVENTION
LAG3 (CD223) is a cell surface molecule expressed on activated T
cells (Huard et al. Immunogenetics 39:213-217, 1994), NK cells
(Triebel et al. J Exp Med 171:1393-1405, 1990), B cells (Kisielow
et al. Eur J Immunol 35:2081-2088, 2005), and plasmacytoid
dendritic cells (Workman et al. J Immunol 182:1885-1891, 2009) that
plays an important role in the function of these lymphocyte
subsets. In addition, the interaction between LAG3 and its major
ligand, Class II MHC, is thought to play a role in modulating
dendritic cell function (Andreae et al. J Immunol 168:3874-3880,
2002). Recent preclinical studies have documented a role for LAG-3
in CD8 T-cell exhaustion (Blackburn et al. Nat Immunol 10:29-37,
2009).
As with chronic viral infection, tumor antigen-specific CD4.sup.+
and CD8.sup.+ T cells display impaired effector function and an
exhausted phenotype characterized by decreased production of
pro-inflammatory cytokines and hyporesponsiveness to antigenic
re-stimulation. This is mediated by cell extrinsic mechanisms, such
as regulatory T-cells (Treg), and cell intrinsic mechanisms, such
as inhibitory molecules that are upregulated on exhausted,
tumor-infiltrating lymphocytes (TIL). These inhibitory mechanisms
represent a formidable barrier to effective antitumor immunity.
LAG--is expressed on tolerized TILs suggesting that they contribute
to tumor-mediated immune suppression. Inhibition of LAG3 may lead
to enhanced activation of antigen-specific T cells from which a
therapeutic benefit may be gained. There is a need in the art for
high efficacy therapeutic antibodies which antagonize the activity
of LAG3 which can be used to generate a robust immune response to
tumors.
SUMMARY OF THE INVENTION
The present invention provides an antibody or antigen-binding
fragment thereof (e.g., an antibody, an antigen-binding fragment,
monoclonal antibodies, polyclonal antibodies, a multispecific
antibody, a humanized antibody, an isolated antibody or
antigen-binding fragment thereof, a humanized antagonist antibody,
a fully human antibody, a chimeric antibody and a camelized single
domain antibody) that specifically binds LAG3 (e.g., human and/or
Macaqa fascicularis, e.g., SEQ ID NOs: 443 or 445) comprising: a
heavy chain immunoglobulin variable region having at least 78.99%
amino acid sequence identity to amino acids 1-119 of SEQ ID NO:
106; and/or a light chain immunoglobulin variable region having at
least 78.38% amino acid sequence identity to amino acids 1-111 of
SEQ ID NO: 224.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention comprises
the light and heavy chain immunoglobulin (e.g., heavy and light
chain variable domains or heavy and light chain CDRs) of Ab1, Ab2,
Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 or Ab9 as set forth herein.
The present invention provides an antibody or antigen-binding
fragment thereof that specifically binds LAG3 (e.g., human or
cynomolgous monkey LAG3) comprising (a) the CDR1, CDR2, and CDR3 of
a V.sub.L domain of an immunoglobulin chain that comprises the
amino acid sequence set forth in SEQ ID NO: 7, 17, 27, 37, 57, 59,
61, 63, 65, 101, 126, 130, 132, 136, 138, 208, 210, 224, 226, 228,
230, 232, 241, 257, 259, 261, 263, 351, 369, 371, 373, 375, 401,
403, 405, 426, 427, 450-453 or 459-461; and/or (b) the CDR1, CDR2,
and CDR3 of a V.sub.H domain of an immunoglobulin chain that
comprises the amino acid sequence set forth in SEQ ID NO: 2, 12,
22, 32, 45, 47, 49, 51, 53, 55, 67, 69, 71, 73, 75, 77, 79, 81, 83,
85, 87, 89, 91, 93, 95, 97, 99, 103, 106, 108, 110, 112, 114, 116,
118, 120, 122, 124, 128, 134, 140, 142, 144, 146, 148, 150, 152,
154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178,
180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204,
206, 212, 214, 216, 218, 220, 222, 234, 235, 237, 239, 243, 245,
247, 249, 251, 253, 255, 265, 267, 269, 271, 273, 275, 277, 279,
281, 283, 285, 287, 289, 291, 293, 295, 297, 299, 301, 303, 305,
307, 309, 311, 313, 315, 317, 319, 321, 323, 325, 327, 329, 331,
333, 335, 337, 339, 341, 343, 345, 347, 349, 353, 355, 357, 359,
361, 363, 365, 367, 377, 379, 381, 383, 385, 387, 389, 391, 393,
395, 397, 399, 406-419, 434-442, 448, 449, 462, 463 or 464.
The present invention also provides an antibody or antigen-binding
fragment thereof that specifically binds LAG3 (e.g., human or
cynomolgous monkey) comprising (1) a light chain variable domain
comprising CDR-L1 that comprises the amino acid sequence:
KASQSLDYEGDSDMN (SEQ ID NO: 38); CDR-L2 that comprises the amino
acid sequence: GASNLES (SEQ ID NO: 39); and CDR-L3 that comprises
the amino acid sequence: QQSTEDPRT (SEQ ID NO: 40); and/or a heavy
chain variable domain comprising: CDR-H1 that comprises the amino
acid sequence: DYNVD (SEQ ID NO: 33); CDR-H2 that comprises the
amino acid sequence: DINPNNGGTIYAQKFQE (SEQ ID NO: 458); and CDR-H3
that comprises the amino acid sequence: NYRWFGAMDH (SEQ ID NO: 35);
or (2) a light chain variable domain comprising CDR-L1 that
comprises the amino acid sequence: KASQSLDYEGDSDMN (SEQ ID NO: 38);
CDR-L2 that comprises the amino acid sequence: GASNLES (SEQ ID NO:
39); and CDR-L3 that comprises the amino acid sequence: QQSTEDPRT
(SEQ ID NO: 40); and/or a heavy chain variable domain comprising
CDR-H1 that comprises the amino acid sequence: DYNVD (SEQ ID NO:
33); CDR-H2 that comprises the amino acid sequence:
DINPNSGGTIYAQKFQE (SEQ ID NO: 456); and CDR-H3 that comprises the
amino acid sequence: NYRWFGAMDH (SEQ ID NO: 35); or (3) a light
chain variable domain comprising: CDR-L1 that comprises the amino
acid sequence: KASQSLDYEGDSDMN (SEQ ID NO: 38); CDR-L2 that
comprises the amino acid sequence: GASNLES (SEQ ID NO: 39); and
CDR-L3 that comprises the amino acid sequence: QQSTEDPRT (SEQ ID
NO: 40); and/or a heavy chain variable domain comprising CDR-H1
that comprises the amino acid sequence: DYNVD (SEQ ID NO: 33);
CDR-H2 that comprises the amino acid sequence: DINPNDGGTIYAQKFQE
(SEQ ID NO: 457); and CDR-H3 that comprises the amino acid
sequence: NYRWFGAMDH (SEQ ID NO: 35); or (4) a light chain variable
domain comprising CDR-L1 that comprises the amino acid sequence:
KASQSLDYEGDSDMN (SEQ ID NO: 38); CDR-L2 that comprises the amino
acid sequence: GASNLES (SEQ ID NO: 39); and CDR-L3 that comprises
the amino acid sequence: QQSTEDPRT (SEQ ID NO: 40); and/or a heavy
chain variable domain comprising: CDR-H1 that comprises the amino
acid sequence: DYNVD (SEQ ID NO: 33); CDR-H2 that comprises the
amino acid sequence: DINPNQGGTIYAQKFQE (SEQ ID NO: 455); and CDR-H3
that comprises the amino acid sequence: NYRWFGAMDH (SEQ ID NO: 35);
or (5) a light chain variable domain comprising CDR-L1 that
comprises the amino acid sequence: KASQSLDYEGDSDMN (SEQ ID NO: 38);
CDR-L2 that comprises the amino acid sequence: GASNLES (SEQ ID NO:
39); and CDR-L3 that comprises the amino acid sequence: QQSTEDPRT
(SEQ ID NO: 40); and/or a heavy chain variable domain comprising:
CDR-H1 that comprises the amino acid sequence: DYNVD (SEQ ID NO:
33); CDR-H2 that comprises the amino acid sequence:
DINPNGGGTIYAQKFQE (SEQ ID NO: 454); and CDR-H3 that comprises the
amino acid sequence: NYRWFGAMDH (SEQ ID NO: 35).
In an embodiment of the invention, the antibody or antigen-binding
fragment thereof that specifically binds LAG3 (e.g., human or
cynomolgous monkey LAG3) comprises the CDRs of various light and/or
heavy chain variable regions and having at least 90% overall amino
acid sequence identity to the variable region, i.e., variability in
the chain occurs outside the CDRs, e.g., (1) a light chain
immunoglobulin comprising CDR-L1, CDR-L2 and CDR-L3 of the
immunoglobulin comprising the amino acid sequence of SEQ ID NO: 126
or amino acids 21-131 thereof, and having at least 90% amino acid
sequence identity to the amino acid sequence set forth in SEQ ID
NO: 126 or amino acids 21-131 thereof, and/or a heavy chain
immunoglobulin comprising CDR-H1, CDR-H2 and CDR-H3 of the
immunoglobulin comprising the amino acid sequence of SEQ ID NO: 106
or amino acids 1-119 thereof, and having at least 90% amino acid
sequence identity to the amino acid sequence set forth in SEQ ID
NO: 106 or amino acids 1-119 thereof; (2) a light chain
immunoglobulin comprising CDR-L1, CDR-L2 and CDR-L3 of the
immunoglobulin comprising the amino acid sequence of SEQ ID NO: 126
or amino acids 21-131 thereof, and having at least 90% amino acid
sequence identity to the amino acid sequence set forth in SEQ ID
NO: 126 or amino acids 21-131 thereof, and/or a heavy chain
immunoglobulin comprising CDR-H1, CDR-H2 and CDR-H3 of the
immunoglobulin comprising the amino acid sequence of SEQ ID NO: 108
or amino acids 1-119 thereof, and having at least 90% amino acid
sequence identity to the amino acid sequence set forth in SEQ ID
NO: 108 or amino acids 1-119 thereof; (3) a light chain
immunoglobulin comprising CDR-L1, CDR-L2 and CDR-L3 of the
immunoglobulin comprising the amino acid sequence of SEQ ID NO: 126
or amino acids 21-131 thereof, and having at least 90% amino acid
sequence identity to the amino acid sequence set forth in SEQ ID
NO: 126 or amino acids 21-131 thereof, and/or a heavy chain
immunoglobulin comprising CDR-H1, CDR-H2 and CDR-H3 of the
immunoglobulin comprising the amino acid sequence of SEQ ID NO: 110
or amino acids 1-119 thereof, and having at least 90% amino acid
sequence identity to the amino acid sequence set forth in SEQ ID
NO: 110 or amino acids 1-119 thereof; (4) a light chain
immunoglobulin comprising CDR-L1, CDR-L2 and CDR-L3 of the
immunoglobulin comprising the amino acid sequence of SEQ ID NO: 126
or amino acids 21-131 thereof, and having at least 90% amino acid
sequence identity to the amino acid sequence set forth in SEQ ID
NO: 126 or amino acids 21-131 thereof, and/or a heavy chain
immunoglobulin comprising CDR-H1, CDR-H2 and CDR-H3 of the
immunoglobulin comprising the amino acid sequence of SEQ ID NO: 112
or amino acids 1-119 thereof, and having at least 90% amino acid
sequence identity to the amino acid sequence set forth in SEQ ID
NO: 112 or amino acids 1-119 thereof; (5) a light chain
immunoglobulin comprising CDR-L1, CDR-L2 and CDR-L3 of the
immunoglobulin comprising the amino acid sequence of SEQ ID NO: 126
or amino acids 21-131 thereof, and having at least 90% amino acid
sequence identity to the amino acid sequence set forth in SEQ ID
NO: 126 or amino acids 21-131 thereof, and/or a heavy chain
immunoglobulin comprising CDR-H1, CDR-H2 and CDR-H3 of the
immunoglobulin comprising the amino acid sequence of SEQ ID NO: 114
or amino acids 1-119 thereof, and having at least 90% amino acid
sequence identity to the amino acid sequence set forth in SEQ ID
NO: 114 or amino acids 1-119 thereof; (6) a light chain
immunoglobulin comprising CDR-L1, CDR-L2 and CDR-L3 of the
immunoglobulin comprising the amino acid sequence of SEQ ID NO: 126
or amino acids 21-131 thereof, and having at least 90% amino acid
sequence identity to the amino acid sequence set forth in SEQ ID
NO: 126 or amino acids 21-131 thereof, and/or a heavy chain
immunoglobulin comprising CDR-H1, CDR-H2 and CDR-H3 of the
immunoglobulin comprising the amino acid sequence of SEQ ID NO: 116
or amino acids 1-119 thereof, and having at least 90% amino acid
sequence identity to the amino acid sequence set forth in SEQ ID
NO: 116 or amino acids 1-119 thereof; (7) a light chain
immunoglobulin comprising CDR-L1, CDR-L2 and CDR-L3 of the
immunoglobulin comprising the amino acid sequence of SEQ ID NO: 126
or amino acids 21-131 thereof, and having at least 90% amino acid
sequence identity to the amino acid sequence set forth in SEQ ID
NO: 126 or amino acids 21-131 thereof, and/or a heavy chain
immunoglobulin comprising CDR-H1, CDR-H2 and CDR-H3 of the
immunoglobulin comprising the amino acid sequence of SEQ ID NO: 118
or amino acids 1-119 thereof, and having at least 90% amino acid
sequence identity to the amino acid sequence set forth in SEQ ID
NO: 118 or amino acids 1-119 thereof; (8) a light chain
immunoglobulin comprising CDR-L1, CDR-L2 and CDR-L3 of the
immunoglobulin comprising the amino acid sequence of SEQ ID NO: 126
or amino acids 21-131 thereof, and having at least 90% amino acid
sequence identity to the amino acid sequence set forth in SEQ ID
NO: 126 or amino acids 21-131 thereof, and/or a heavy chain
immunoglobulin comprising CDR-H1, CDR-H2 and CDR-H3 of the
immunoglobulin comprising the amino acid sequence of SEQ ID NO: 120
or amino acids 1-119 thereof, and having at least 90% amino acid
sequence identity to the amino acid sequence set forth in SEQ ID
NO: 120 or amino acids 1-119 thereof; and/or (9) a light chain
immunoglobulin comprising CDR-L1, CDR-L2 and CDR-L3 of the
immunoglobulin comprising the amino acid sequence of SEQ ID NO: 126
or amino acids 21-131 thereof, and having at least 90% amino acid
sequence identity to the amino acid sequence set forth in SEQ ID
NO: 126 or amino acids 21-131 thereof, and/or a heavy chain
immunoglobulin comprising CDR-H1, CDR-H2 and CDR-H3 of the
immunoglobulin comprising the amino acid sequence of SEQ ID NO: 122
or amino acids 1-119 thereof, and having at least 90% amino acid
sequence identity to the amino acid sequence set forth in SEQ ID
NO: 122 or amino acids 1-119 thereof. In an embodiment of the
invention, the antibody or antigen-binding fragment comprises the
various mature light and/or mature heavy chain immunoglobulin
variable regions and having at least 90% overall amino acid
sequence identity to the unprocessed immunoglobulin variable region
(including the signal sequence), i.e., variability occurs outside
the mature immunoglobulin chain sequences.
The present invention provides an antibody or antigen-binding
fragment thereof that specifically binds LAG3 (e.g., human or
cynomolgous monkey LAG3) that comprises a mature or unprocessed
V.sub.L domain or light chain immunoglobulin of SEQ ID NO: 7, 17,
27, 37, 57, 59, 61, 63, 65, 101, 126, 130, 132, 136, 138, 208, 210,
224, 226, 228, 230, 232, 241, 257, 259, 261, 263, 351, 369, 371,
373, 375, 401, 403, 405, 426, 427, 451-453 or 459-461; and/or a
mature or unprocessed V.sub.H domain or heavy chain immunoglobulin
of SEQ ID NO: 2, 12, 22, 32, 45, 47, 49, 51, 53, 55, 67, 69, 71,
73, 75, 77, 79, 81, 83, 85, 87, 89, 91, 93, 95, 97, 99, 103, 106,
108, 110, 112, 114, 116, 118, 120, 122, 124, 128, 134, 140, 142,
144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168,
170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194,
196, 198, 200, 202, 204, 206, 212, 214, 216, 218, 220, 222, 234,
235, 237, 239, 243, 245, 247, 249, 251, 253, 255, 265, 267, 269,
271, 273, 275, 277, 279, 281, 283, 285, 287, 289, 291, 293, 295,
297, 299, 301, 303, 305, 307, 309, 311, 313, 315, 317, 319, 321,
323, 325, 327, 329, 331, 333, 335, 337, 339, 341, 343, 345, 347,
349, 353, 355, 357, 359, 361, 363, 365, 367, 377, 379, 381, 383,
385, 387, 389, 391, 393, 395, 397, 399, 406-419, 434-442, 448, 449,
462, 463 or 464. In an embodiment of the invention, the antibody or
antigen-binding fragment thereof comprises: (1) a light chain
variable domain comprising: CDR-L1 that comprises the amino acid
sequence: KASQSLDYEGDSDMN (SEQ ID NO: 38); CDR-L2 that comprises
the amino acid sequence: GASNLES (SEQ ID NO: 39); and CDR-L3 that
comprises the amino acid sequence: QQSTEDPRT (SEQ ID NO: 40);
and/or a heavy chain variable domain comprising: CDR-H1 that
comprises the amino acid sequence: DYNVD (SEQ ID NO: 33); CDR-H2
that comprises the amino acid sequence: DINPNNGGTIYAQKFQE (SEQ ID
NO: 458); and CDR-H3 that comprises the amino acid sequence:
NYRWFGAMDH (SEQ ID NO: 35); or (2) a light chain variable domain
comprising: CDR-L1 that comprises the amino acid sequence:
KASQSLDYEGDSDMN (SEQ ID NO: 38); CDR-L2 that comprises the amino
acid sequence: GASNLES (SEQ ID NO: 39); and CDR-L3 that comprises
the amino acid sequence: QQSTEDPRT (SEQ ID NO: 40); and/or a heavy
chain variable domain comprising: CDR-H1 that comprises the amino
acid sequence: DYNVD (SEQ ID NO: 33); CDR-H2 that comprises the
amino acid sequence: DINPNSGGTIYAQKFQE (SEQ ID NO: 456); and CDR-H3
that comprises the amino acid sequence: NYRWFGAMDH (SEQ ID NO: 35);
or (3) a light chain variable domain comprising: CDR-L1 that
comprises the amino acid sequence: KASQSLDYEGDSDMN (SEQ ID NO: 38);
CDR-L2 that comprises the amino acid sequence: GASNLES (SEQ ID NO:
39); and CDR-L3 that comprises the amino acid sequence: QQSTEDPRT
(SEQ ID NO: 40); and/or a heavy chain variable domain comprising:
CDR-H1 that comprises the amino acid sequence: DYNVD (SEQ ID NO:
33); CDR-H2 that comprises the amino acid sequence:
DINPNDGGTIYAQKFQE (SEQ ID NO: 457); and CDR-H3 that comprises the
amino acid sequence: NYRWFGAMDH (SEQ ID NO: 35); or (4) a light
chain variable domain comprising: CDR-L1 that comprises the amino
acid sequence: KASQSLDYEGDSDMN (SEQ ID NO: 38); CDR-L2 that
comprises the amino acid sequence: GASNLES (SEQ ID NO: 39); and
CDR-L3 that comprises the amino acid sequence: QQSTEDPRT (SEQ ID
NO: 40); and/or a heavy chain variable domain comprising: CDR-H1
that comprises the amino acid sequence: DYNVD (SEQ ID NO: 33);
CDR-H2 that comprises the amino acid sequence: DINPNQGGTIYAQKFQE
(SEQ ID NO: 455); and CDR-H3 that comprises the amino acid
sequence: NYRWFGAMDH (SEQ ID NO: 35); or (5) a light chain variable
domain comprising: CDR-L1 that comprises the amino acid sequence:
KASQSLDYEGDSDMN (SEQ ID NO: 38); CDR-L2 that comprises the amino
acid sequence: GASNLES (SEQ ID NO: 39); and CDR-L3 that comprises
the amino acid sequence: QQSTEDPRT (SEQ ID NO: 40); and/or a heavy
chain variable domain comprising: CDR-H1 that comprises the amino
acid sequence: DYNVD (SEQ ID NO: 33); CDR-H2 that comprises the
amino acid sequence: DINPNGGGTIYAQKFQE (SEQ ID NO: 454); and CDR-H3
that comprises the amino acid sequence: NYRWFGAMDH (SEQ ID NO: 35).
In an embodiment of the invention, the antibody or fragment is
glycosylated with engineered yeast N-linked glycans or CHO N-linked
glycans. Optionally, any of the anti-LAG3 antibodies or
antigen-binding fragments thereof of the invention are
characterized by one or more of the following properties: Inhibits
LAG3 binding to MHC class II molecules; Competes with MHC class II
molecules for LAG3 binding; Binds the extraloop of LAG3; Binds LAG3
with a K.sub.D of about 10.sup.-9M to about 2.times.10.sup.-12M;
Binds to native LAG3 on the surface of activated CD4+ and/or CD8+
T-cells; Binds to human and/or cynomolgous monkey LAG3; Inhibits
LAG3 homodimerization; Stimulates antigen-specific T-cell
production of IL-2; labels tonsil tissue; does not label brain,
heart, kidney, liver, lung, pancreas, and/or pituitary tissue;
binds to human LAG3 by contacting residues QEGAPAQL (amino acids
35-42 of SEQ ID NO: 443) and RPARRADAGEYRAAVH (amino acids 137-152
of SEQ ID NO: 443) and, optionally, residues DERGRQRGDFSLW (amino
acids 123-135 of SEQ ID NO: 443) of LAG3; or residues SPTIPLQDL
(amino acids 45-53 of SEQ ID NO: 443) and, optionally DERGRQRGDFSL
(amino acids 123-134 of SEQ ID NO: 443) of LAG3; or residues
HPLAPGPHPAAPSSWGPRPRRYTVL (amino acids 78-102 of SEQ ID NO: 443) of
LAG3; and/or by protecting hydrogens on the amide backbone of such
residues from exchange with a deuterium. The present invention also
provides any such antibody or fragment in a pharmaceutically
acceptable carrier or diluent. In an embodiment of the invention,
the anti-LAG3 antibody or fragment is immobilized to a solid
substrate. In an embodiment of the invention the anti-LAG3 antibody
or antigen-binding fragment thereof is Ab1, Ab2, Ab3, Ab4, Ab5,
Ab6, Ab7, Ab8 or Ab9 (as set forth herein).
The present invention also provides a complex comprising an
anti-LAG3 antibody or fragment discussed herein (e.g., 4A10, 19E8,
11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8
and/or Ab9) complexed with LAG3 (e.g., human or cynomolgous monkey)
or a fragment thereof or with a secondary antibody (e.g.,
detectably labeled secondary antibody) that binds specifically to
the anti-LAG3 antibody or fragment. In an embodiment of the
invention, the antibody or fragment is in vitro (e.g., is
immobilized to a solid substrate) or is in the body of a subject.
In an embodiment of the invention, the LAG3 is in vitro (e.g., is
immobilized to a solid substrate) or is on the surface of a cell or
is in the body of a subject.
The present invention further provides a composition comprising a
plurality of anti-LAG3 antibodies or antigen-binding fragments of
the present invention which are isolated, monoclonal antibodies or
antigen-binding fragments thereof, e.g., which are humanized, e.g.,
humanized antagonistic antibodies and antigen-binding fragments
thereof.
The present invention also provides a composition comprising
anti-LAG3 antibodies or antigen-binding fragments thereof as
discussed herein in association with a further therapeutic agent
(e.g., a monoclonal antibody or antigen-binding fragment thereof or
an organic small molecule) such as an inhibitor of an
immunomodulatory receptor, an anti-emetic, an MTOR (mammalian
target of rapamycin) inhibitor, a cytotoxic agent, a platinum
agent, an EGFR (epidermal growth factor receptor) inhibitor, a VEGF
(vascular epidermal growth factor) inhibitor, a microtubule
stabilizer, a taxane, a CD20 inhibitor, a CD52 inhibitor, a CD30
inhibitor, a RANK (Receptor activator of nuclear factor kappa-B)
inhibitor, a RANKL (Receptor activator of nuclear factor kappa-B
ligand) inhibitor, an ERK inhibitor, a MAP Kinase inhibitor, an AKT
inhibitor, a MEK inhibitor, a PI3K inhibitor, a HER1 inhibitor, a
HER2 inhibitor, a HER3 inhibitor, a HER4 inhibitor, a Bcl2
inhibitor, a CD22 inhibitor, a CD79b inhibitor, an ErbB2 inhibitor,
and/or a farnesyl protein transferase inhibitor. In an embodiment
of the invention, the further therapeutic agent is an anti-PD1
antibody or an antigen-binding fragment thereof, pembrolizumab,
nivolumab, CT-011, anti-CTLA4 antibody or an antigen-binding
fragment thereof, anti-TIM3 antibody or an antigen-binding fragment
thereof, anti-CS1 antibody or an antigen-binding fragment thereof,
elotuzumab, anti-KIR2DL1/2/3 antibody or an antigen-binding
fragment thereof, lirilumab, anti-CD137 antibody or an
antigen-binding fragment thereof, urelumab, anti-GITR antibody or
an antigen-binding fragment thereof, TRX518, anti-PD-L1 antibody or
an antigen-binding fragment thereof, BMS-936559, MSB0010718C,
MPDL3280A, anti-PD-L2 antibody or an antigen-binding fragment
thereof, anti-ILT1 antibody or an antigen-binding fragment thereof,
anti-ILT2 antibody or an antigen-binding fragment thereof,
anti-ILT3 antibody or an antigen-binding fragment thereof,
anti-ILT4 antibody or an antigen-binding fragment thereof,
anti-ILT5 antibody or an antigen-binding fragment thereof,
anti-ILT6 antibody or an antigen-binding fragment thereof,
anti-ILT7 antibody or an antigen-binding fragment thereof,
anti-ILT8 antibody or an antigen-binding fragment thereof,
anti-CD40 antibody or an antigen-binding fragment thereof,
anti-OX40 antibody or an antigen-binding fragment thereof,
anti-CD137 antibody or an antigen-binding fragment thereof,
anti-KIR2DL1 antibody or an antigen-binding fragment thereof,
anti-KIR2DL2/3 antibody or an antigen-binding fragment thereof,
anti-KIR2DL4 antibody or an antigen-binding fragment thereof,
anti-KIR2DL5A antibody or an antigen-binding fragment thereof,
anti-KIR2DL5B antibody or an antigen-binding fragment thereof,
anti-KIR3DL1 antibody or an antigen-binding fragment thereof,
anti-KIR3DL2 antibody or an antigen-binding fragment thereof,
anti-KIR3DL3 antibody or an antigen-binding fragment thereof,
anti-NKG2A antibody or an antigen-binding fragment thereof,
anti-NKG2C antibody or an antigen-binding fragment thereof, and/or
an anti-NKG2E antibody or an antigen-binding fragment thereof, or
any small organic molecule inhibitor of such targets; IL-10,
anti-IL10, anti-TSLP and/or PEGylated IL-10. In an embodiment of
the invention, the further therapeutic agent is 13-cis-retinoic
acid, 3-[5-(methylsulfonylpiperadinemethyl)-indolyl]-quinolone,
4-hydroxytamoxifen, 5-deooxyuridine, 5'-deoxy-5-fluorouridine,
5-fluorouracil, 6-mecaptopurine, 7-hydroxystaurosporine, A-443654,
abirateroneacetate, abraxane, ABT-578, acolbifene, ADS-100380,
aflibercept, ALT-110, altretamine, amifostine, aminoglutethimide,
amrubicin, amsacrine, anagrelide, anastrozole, angiostatin,
AP-23573, ARQ-197, arzoxifene, AS-252424, AS-605240, asparaginase,
AT-9263, ATI3387, atrasentan, axitinib, AZD1152, Bacillus
Calmette-Guerin (BCG) vaccine, batabulin, BC-210, BGJ398,
besodutox, bevacizumab, bicalutamide, Bio111, BIO140, BKM120,
bleomycin, BMS-214662, BMS-247550, BMS-275291, BMS-310705,
bortezimib, buserelin, busulfan, calcitriol, camptothecin,
canertinib, capecitabine, carboplatin, carmustine, CC8490,
cediranib, CG-1521, CG-781, chlamydocin, chlorambucil, chlorotoxin,
cilengitide, cimitidine, cisplatin, cladribine, clodronate,
cobimetnib, COL-3, CP-724714, cyclophosphamide, cyproterone,
cyproteroneacetate, cytarabine, cytosinearabinoside, dabrafenib,
dacarbazine, dacinostat, dactinomycin, dalotuzumab, danusertib,
dasatanib, daunorubicin, decatanib, deguelin, denileukin,
deoxycoformycin, depsipeptide, diarylpropionitrile,
diethylstilbestrol, diftitox, DNE03, docetaxel, dovitinib,
doxorubicin, droloxifene, edotecarin, yttrium-90
labeled-edotreotide, edotreotide, EKB-569, EMD121974, encorafenib,
endostatin, enzalutamide, enzastaurin, epirubicin, epithilone B,
ERA-923, erbitux, erlotinib, estradiol, estramustine, etoposide,
everolimus, exemestane, ficlatuzumab, finasteride, flavopiridol,
floxuridine, fludarabine, fludrocortisone, fluoxymesterone,
flutamide, FOLFOX regimen, fulvestrant, galeterone, ganetespib,
gefitinib, gemcitabine, gimatecan, goserelin, goserelin acetate,
gossypol, GSK461364, GSK690693, HMR-3339,
hydroxyprogesteronecaproate, hydroxyurea, IC87114, idarubicin,
idoxyfene, ifosfamide, IM862, imatinib, IMC-1C11, INCB24360,
INC280, INO1001, interferon, interleukin-12, ipilimumab,
irinotecan, JNJ-16241199, ketoconazole, KRX-0402, lapatinib,
lasofoxifene, LEE011, letrozole, leucovorin, leuprolide, leuprolide
acetate, levamisole, liposome entrapped paclitaxel, lomustine,
lonafarnib, lucanthone, LY292223, LY292696, LY293646, LY293684,
LY294002, LY3009120, LY317615, marimastat, mechlorethamine,
medroxyprogesteroneacetate, megestrolacetate, MEK162, melphalan,
mercaptopurine, mesna, methotrexate, mithramycin, mitomycin,
mitotane, mitoxantrone, tozasertib, MLN8054, natitoclax, neovastat,
neratinib, neuradiab, nilotinib, nilutimide, nolatrexed,
NVP-BEZ235, oblimersen, octreotide, ofatumumab, oregovomab,
ornatuzumab, orteronel, oxaliplatin, paclitaxel, palbociclib,
pamidronate, panitumumab, pazopanib, PD0325901, PD184352,
PEG-interferon, pemetrexed, pentostatin, perifosine,
phenylalaninemustard, PI-103, pictilisib, PIK-75, pipendoxifene,
PKI-166, plicamycin, PLX8394, porfimer, prednisone, procarbazine,
progestins, PX-866, R-763, raloxifene, raltitrexed, razoxin,
ridaforolimus, rituximab, romidepsin, RTA744, rubitecan, scriptaid,
Sdx102, seliciclib, selumetinib, semaxanib, SF1126, sirolimus,
SN36093, sorafenib, spironolactone, squalamine, SR13668,
streptozocin, SU6668, suberoylanalide hydroxamic acid, sunitinib,
synthetic estrogen, talampanel, talimogene laherparepvec,
tamoxifen, temozolomide, temsirolimus, teniposide, tesmilifene,
testosterone, tetrandrine, TGX-221, thalidomide, 6-thioguanine,
thiotepa, ticilimumab, tipifarnib, tivozanib, TKI-258, TLK286,
topotecan, toremifene citrate, trabectedin, trametinib,
trastuzumab, tretinoin, trichostatin A, triciribinephosphate
monohydrate, triptorelin pamoate, TSE-424, uracil mustard, valproic
acid, valrubicin, vandetanib, vatalanib, VEGF trap, vemurafenib,
vinblastine, vincristine, vindesine, vinorelbine, vitaxin,
vitespan, vorinostat, VX-745, wortmannin, Xr311, zanolimumab,
ZK186619, ZK-304709, ZM336372, ZSTK474, casopitant, netupitant,
palonosetron, aprepitant, diphenhydramine, hydroxyzine,
metoclopramide, lorazepam, alprazolam, haloperidol, droperidol,
dronabinol, dexamethasone, methylprednisolone, prochlorperazine,
granisetron, ondansetron, dolasetron, tropisetron, GCSF, PEG-GCSF,
erythropoietin, epoetin alfa and darbepoetin alfa. In an embodiment
of the invention, the anti-LAG3 antibody or antigen-binding
fragment thereof is in association with pembrolizumab. In an
embodiment of the invention, the anti-LAG3 antibody or
antigen-binding fragment thereof is in association with novolumab.
In an embodiment of the invention, the anti-LAG3 antibody or
antigen-binding fragment thereof is in association with CT-011. In
an embodiment of the invention, the anti-LAG3 antibody or
antigen-binding fragment thereof is in association with
BMS-936559.
The present invention also provides a polypeptide comprising an
amino acid sequence selected from the group consisting of 2, 3, 4,
5, 7, 8, 9, 10, 12, 13, 14, 15, 17, 18, 19, 20, 22, 23, 24, 25, 27,
28, 29, 30, 32, 33, 34, 35, 37, 38, 39, 40, 45, 47, 49, 51, 53, 55,
57, 59, 61, 63, 65, 67, 69, 71, 73, 75, 77, 79, 81, 83, 85, 87, 89,
91, 93, 95, 97, 99, 101, 103, 106, 108, 110, 112, 114, 116, 118,
120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144,
146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170,
172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196,
198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222,
224, 226, 228, 230, 232, 234, 235, 237, 239, 241, 243, 245, 247,
249, 251, 253, 255, 257, 259, 261, 263, 265, 267, 269, 271, 273,
275, 277, 279, 281, 283, 285, 287, 289, 291, 293, 295, 297, 299,
301, 303, 305, 307, 309, 311, 313, 315, 317, 319, 321, 323, 325,
327, 329, 331, 333, 335, 337, 339, 341, 343, 345, 347, 349, 351,
353, 355, 357, 359, 361, 363, 365, 367, 369, 371, 373, 375, 377,
379, 381, 383, 385, 387, 389, 391, 393, 395, 397, 399, 401, 403,
405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417,
418, 419, 426, 427, 434, 435, 436, 437, 438, 439, 440, 441, 442,
446, 448, 449, 451, 452, 453, 454, 455, 456, 457, 458, 459, 460,
461, 462, 463 and 464 for example, SEQ ID NOs: 2, 7, 12, 17, 22,
27, 32 and 37; or a mature fragment thereof. The present invention
also provides a polynucleotide encoding any of such polypeptides,
e.g., comprising a nucleotide sequence selected from the group
consisting of SEQ ID NOs: 1, 6, 11, 16, 21, 26, 31, 36, 46, 48, 50,
52, 54, 56, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82,
84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 105, 107, 109, 111,
113, 115, 117, 119, 121, 123, 125, 127, 129, 131, 133, 135, 137,
139, 141, 143, 145, 147, 149, 151, 153, 155, 157, 159, 161, 163,
165, 167, 169, 171, 173, 175, 177, 179, 181, 183, 185, 187, 189,
191, 193, 195, 197, 199, 201, 203, 205, 207, 209, 211, 213, 215,
217, 219, 221, 223, 225, 227, 229, 231, 233, 236, 238, 240, 242,
244, 246, 248, 250, 252, 254, 256, 258, 260, 262, 264, 266, 268,
270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294,
296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320,
322, 324, 326, 328, 330, 332, 334, 336, 338, 340, 342, 344, 346,
348, 350, 352, 354, 356, 358, 360, 362, 364, 366, 368, 370, 372,
374, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394, 396, 398,
400, 402 and 404; or a mature fragment thereof. Also included in
the present invention is a vector (e.g., a plasmid) comprising the
polynucleotide. A host cell (e.g., mammalian, bacterial, Chinese
hamster ovary (CHO), lower eukaryotic, fungal, yeast, Pichia,
Pichia pastoris) is also part of the present invention wherein the
host cell comprises an antibody, fragment, polypeptide,
polynucleotide and/or vector set forth herein.
The present invention also provides vaccines comprising an antibody
or fragment set forth herein, an antigen (e.g., viral peptide
antigen, virus-like particle, tumor peptide antigen) and a
pharmaceutically acceptable carrier.
The prevent invention also provides a vessel (e.g., plastic or
glass vial) or an injection device (e.g., a syringe such as a
pre-filled syringe or an autoinjector) comprising any antibody,
fragment, polypeptide, polynucleotide, vector, composition or
vaccine discussed herein.
The present invention also provides a method of treating a cancer
(e.g., osteosarcoma, rhabdomyosarcoma, neuroblastoma, kidney
cancer, leukemia, renal transitional cell cancer, bladder cancer,
Wilm's cancer, ovarian cancer, pancreatic cancer, breast cancer,
prostate cancer, bone cancer, lung cancer, gastric cancer,
colorectal cancer, cervical cancer, synovial sarcoma, head and neck
cancer, squamous cell carcinoma, multiple myeloma, renal cell
cancer, retinoblastoma, hepatoblastoma, hepatocellular carcinoma,
melanoma, rhabdoid tumor of the kidney, Ewing's sarcoma,
chondrosarcoma, brain cancer, glioblastoma, meningioma, pituitary
adenoma, vestibular schwannoma, a primitive neuroectodermal tumor,
medulloblastoma, astrocytoma, anaplastic astrocytoma,
oligodendroglioma, ependymoma, choroid plexus papilloma,
polycythemia vera, thrombocythemia, idiopathic myelfibrosis, soft
tissue sarcoma, thyroid cancer, endometrial cancer, carcinoid
cancer or liver cancer, breast cancer or gastric cancer) in a
subject, comprising administering to the subject a effective amount
of an anti-LAG3 antibody or antigen-binding fragment or vaccine
discussed herein optionally, in association with a further
therapeutic agent or a therapeutic procedure (e.g., surgical
tumorectomy or anti-cancer radiation therapy).
The present invention also provides a method of administering an
anti-LAG3 antibody, fragment, composition, polypeptide, vaccine or
polynucleotide discussed herein, or a pharmaceutical composition
thereof, to a subject comprising injecting the antibody, fragment,
polypeptide, vaccine or polynucleotide into the body of the subject
using an injection device; and, optionally, also administering a
further therapeutic agent to the subject.
The present invention also provides a method of producing an
anti-LAG3 antibody or antigen-binding fragment thereof or
polypeptide discussed herein comprising: a. culturing a host cell
comprising a polynucleotide encoding the polypeptide or an
immunoglobulin chain of the antibody or fragment in culture medium
under conditions favorable to expression of the polynucleotide; and
b. optionally, recovering the antibody, fragment or polypeptide
from the host cell and/or culture medium. In an embodiment of the
invention, the method comprises the step of introducing the
polynucleotide into the host cell, e.g., by transformation or
transfection.
The present invention also provides a method for detecting the
presence of a LAG3 peptide or a fragment thereof in a sample
comprising contacting the sample with an anti-LAG3 antibody or
fragment discussed herein and detecting the presence of a complex
between the antibody or fragment and the peptide; wherein detection
of the complex indicates the presence of the LAG3 peptide.
BRIEF DESCRIPTION OF THE FIGURES
FIG. 1. Binding of anti-human LAG3 clones to human and cynomolgus
monkey LAG3 expressing CHO-K1 cells.
FIG. 2. Binding of LAG3 clones to cynomolgous monkey and human
primary T-cells.
FIG. 3. Three-dimensional structure of human LAG3. The location of
the antibody 22D2, 11C9 and 4A10 epitopes are indicated.
FIG. 4 (a-c1). Heat map indicating regions in human LAG3 which are
strongly or weakly protected from deuteration by antibody binding.
(a) and (a-1) human LAG3/22D2 Difference heatmap; (b) and (b-1)
human LAG3/11C9 Difference heatmap; (c) and (c-1) human LAG3/4A10
Difference heatmap.
FIG. 5 (a-b). Combined heatmaps indicating (a) and (a-1) regions on
human LAG3 which are protected from deuteration by 22D2, 11C9 and
4A10 binding and (b) the location in human LAG3 mediating MHC2
binding.
FIG. 6. Predominant N-linked glycans for monoclonal antibodies
produced in Chinese hamster ovary cells (CHO N-linked glycans) and
in engineered yeast cells (engineered yeast N-linked glycans):
squares: N-acetylglucosamine (GlcNac); circles: mannose (Man);
diamonds: galactose (Gal); triangles: fucose (Fuc).
FIG. 7. Effect of anti-human LAG-3 antibody treatment+/-anti-PD-1
treatment on IL-2 production in SEB stimulated human PBMCs. PBMC
were activated by SEB for 3 days and IL-2 concentration in culture
supernatants was determined by MSD. Donor 090: SEB 60 ng/mL, Donor
089: SEB 30 ng/mL. Anti-PD1 was used at 10 .mu.g/mL.
FIG. 8. Effect of hu22D2 treatment+/-anti-PD-1 treatment on
IFN-.gamma. and TNF.alpha. production in MLR stimulated human
PBMCs. PBMC were activated with allogeneic monocyte-derived DC for
7 days and IFN-.gamma. and TNF-.alpha. concentration in culture
supernatants was determined by MSD. Anti-PD-1 was used at 3
.mu.g/mL. Isotype was used at 200 nM.
FIG. 9. Antigen-capture assay analysis of concentration of unbound
and partially bound anti-LAG3 antibody Ab6 in cynomolgous monkey
subjects over time at various doses (0.03 mg/kg; 0.3 mg/kg; 1
mg/kg; 10 mg/kg; 30 mg/kg).
FIG. 10. Universal assay analysis of concentration of total
anti-LAG3 antibody Ab6 in cynomolgous monkey subjects over time at
various doses (0.03 mg/kg; 0.3 mg/kg; 1 mg/kg; 10 mg/kg; 30
mg/kg).
FIG. 11. The dose-normalized concentration data of Ab6 over time in
cynomolgous monkey subjects at various doses (0.03 mg/kg; 0.3
mg/kg; 1 mg/kg; 10 mg/kg; 30 mg/kg).
FIG. 12. Target related clearance (Vmax, Km) evaluation of various
does of anti-LAG3 antibody Ab6 at various doses.
DETAILED DESCRIPTION
The present invention provides antibodies and antigen-binding
fragments thereof that have exceptionally high affinity for human
LAG3 and cynomolgous monkey LAG3, e.g., Ab1, Ab2, Ab3, Ab4, Ab5,
Ab6, Ab7, Ab8 or Ab9 as well as uses thereof and methods of making
the same as is discussed herein. For example, affinity (K.sub.D)
for human LAG3 by KinExA assay was measured to be as high as 2 pM
and affinity for cynomolgous LAG3 is in the low double digit pM
range. A particularly low isoelectric point (e.g., about 6.3) makes
some of these antibodies unique. Moreover, though some antibodies
bind LAG3 primarily outside the extraloop region, they exhibit the
ability to block LAG3/MCH class II binding. Furthermore, the
anti-LAG3 antibodies of the present invention have a high degree of
specificity for binding to LAG3 over other related proteins. Such
antibodies and fragments set forth herein may be useful, for
example, for treatment of various cancers and infectious
diseases.
Abbreviations
Throughout the detailed description and examples of the invention
the following abbreviations will be used: ADCC Antibody-dependent
cellular cytotoxicity CDC Complement-dependent cytotoxicity CDR
Complementarity determining region in the immunoglobulin variable
regions, defined using the Kabat numbering system CHO Chinese
hamster ovary EC50 concentration resulting in 50% efficacy or
binding ELISA Enzyme-linked immunosorbant assay FR Antibody
framework region: the immunoglobulin variable regions excluding the
CDR regions. HRP Horseradish peroxidase IC50 concentration
resulting in 50% inhibition IgG Immunoglobulin G Kabat An
immunoglobulin alignment and numbering system pioneered by Elvin A.
Kabat ((1991) Sequences of Proteins of Immunological Interest, 5th
Ed. Public Health Service, National Institutes of Health, Bethesda,
Md.) mAb or Mab or MAb Monoclonal antibody PCR Polymerase chain
reaction V region The segment of IgG chains which is variable in
sequence between different antibodies. It extends to Kabat residue
109 in the light chain and 113 in the heavy chain. VH
Immunoglobulin heavy chain variable region VK Immunoglobulin kappa
light chain variable region
Definitions
So that the invention may be more readily understood, certain
technical and scientific terms are specifically defined below.
Unless specifically defined elsewhere in this document, all other
technical and scientific terms used herein have the meaning
commonly understood by one of ordinary skill in the art to which
this invention belongs.
As used herein, including the appended claims, the singular forms
of words such as "a," "an," and "the," include their corresponding
plural references unless the context clearly dictates
otherwise.
LAG3
The term "LAG3", with respect to the polypeptide to which
antibodies and antigen-binding fragments of the present invention
bind, refers to human and cynomolgous monkey, e.g., Macaca
fascicularis or Macaca mulatta LAG3 as well as fragments thereof
such as the mature fragment thereof lacking the signal peptide.
In an embodiment of the invention, the amino acid sequence of human
LAG3 (Lymphocyte Activation Gene-3) comprises the amino acid
sequence:
TABLE-US-00001 (SEQ ID NO: 443) MWEAQFLGLL FLQPLWVAPV KPLQPGAEVP
VVWAQEGAPA QLPCSPTIPL QDLSLLRRAG VTWQHQPDSG PPAAAPGHPL APGPHPAAPS
SWGPRPRRYT VLSVGPGGLR SGRLPLQPRV QLDERGRQRG DFSLWLRPAR RADAGEYRAA
VHLRDRALSC RLRLRLGQAS MTASPPGSLR ASDWVILNCS FSRPDRPASV HWFRNRGQGR
VPVRESPHHH LAESFLFLPQ VSPMDSGPWG CILTYRDGFN VSIMYNLTVL GLEPPTPLTV
YAGAGSRVGL PCRLPAGVGT RSFLTAKWTP PGGGPDLLVT GDNGDFTLRL EDVSQAQAGT
YTCHIHLQEQ QLNATVTLAI ITVTPKSFGS PGSLGKLLCE VTPVSGQERF VWSSLDTPSQ
RSFSGPWLEA QEAQLLSQPW QCQLYQGERL LGAAVYFTEL SSPGAQRSGR APGALPAGHL
LLFLILGVLS LLLLVTGAFG FHLWRRQWRP RRFSALEQGI HPPQAQSKIE ELEQEPEPEP
EPEPEPEPEP EPEQL;
see also Uniprot accession no. P18627.
In an embodiment of the invention, the amino acid sequence of mouse
LAG3 comprises the amino acid sequence:
TABLE-US-00002 (SEQ ID NO: 444) MREDLLLGFL LLGLLWEAPV VSSGPGKELP
VVWAQEGAPV HLPCSLKSPN LDPNFLRRGG VIWQHQPDSG QPTPIPALDL HQGMPSPRQP
APGRYTVLSV APGGLRSGRQ PLHPHVQLEE RGLQRGDFSL WLRPALRTDA GEYHATVRLP
NRALSCSLRL RVGQASMIAS PSGVLKLSDW VLLNCSFSRP DRPVSVHWFQ GQNRVPVYNS
PRHFLAETFL LLPQVSPLDS GTWGCVLTYR DGFNVSITYN LKVLGLEPVA PLTVYAAEGS
RVELPCHLPP GVGTPSLLIA KWTPPGGGPE LPVAGKSGNF TLHLEAVGLA QAGTYTCSIH
LQGQQLNATV TLAVITVTPK SFGLPGSRGK LLCEVTPASG KERFVWRPLN NLSRSCPGPV
LEIQEARLLA ERWQCQLYEG QRLLGATVYA AESSSGAHSA RRISGDLKGG HLVLVLILGA
LSLFLLVAGA FGFHWWRKQL LLRRFSALEH GIQPFPAQRK IEELERELET EMGQEPEPEP
EPQLEPEPRQ L;
See also Uniprot accession no. Q61790
In an embodiment of the invention, the amino acid sequence of
cynomolgous monkey LAG3 comprises the amino acid sequence:
TABLE-US-00003 (SEQ ID NO: 445) MWEAQFLGLL FLQPLWVAPV KPPQPGAEIS
VVWAQEGAPA QLPCSPTIPL QDLSLLRRAG VTWQHQPDSG PPAXAPGHPP VPGHRPAAPY
SWGPRPRRYT VLSVGPGGLR SGRLPLQPRV QLDERGRQRG DFSLWLRPAR RADAGEYRAT
VHLRDRALSC RLRLRVGQAS MTASPPGSLR TSDWVILNCS FSRPDRPASV HWFRSRGQGR
VPVQGSPHHH LAESFLFLPH VGPMDSGLWG CILTYRDGFN VSIMYNLTVL GLEPATPLTV
YAGAGSRVEL PCRLPPAVGT QSFLTAKWAP PGGGPDLLVA GDNGDFTLRL EDVSQAQAGT
YICHIRLQGQ QLNATVTLAI ITVTPKSFGS PGSLGKLLCE VTPASGQEHF VWSPLNTPSQ
RSFSGPWLEA QEAQLLSQPW QCQLHQGERL LGAAVYFTEL SSPGAQRSGR APGALRAGHL
PLFLILGVLF LLLLVTGAFG FHLWRRQWRP RRFSALEQGI HPPQAQSKIE ELEQEPELEP
EPELERELGP EPEPGPEPEP EQL;
See also NCBI reference number XP_005570011.1
The mature sequence of human, mouse and cynomolgous monkey LAG3,
i.e. the sequence after removal of the signal peptide, comprises
amino acids 1-28 of SEQ ID NO: 443, 444 or 445.
LAG3 sequences may differ, for example, by having, for example,
conserved mutations or mutations in non-conserved regions, e.g.,
wherein the LAG3 has substantially the same biological function as
the LAG3 of SEQ ID NOs: 443 or 445. For example, biological
functions of LAG3 are to bind to major histocompatibility complex
(MEW) class II molecules and to form homodimers.
A particular LAG3 sequence will generally be at least 90% identical
in amino acid sequence to LAG3 of SEQ ID NOs: 443 or 445 or other
isoforms. In certain cases, a LAG3 may be at least 95%, or even at
least 96%, 97%, 98% or 99% identical to a LAG3 of SEQ ID NOs: 443
or 445, or other isoforms or variants. In certain embodiments, a
LAG3 sequence will display no more than 10 amino acid differences
from the LAG3 of any of SEQ ID NOs: 443 or 445, or other isoforms
or variants. In certain embodiments, the LAG3 may display no more
than 5, or even no more than 4, 3, 2, or 1 amino acid difference
from a LAG3 of SEQ ID NOs: 443 or 445, or other isoforms or
variants. Percent identity can be determined as described
herein.
Anti-LAG3 Antibodies and Antigen-Binding Fragments Thereof
The present invention provides antibodies or antigen-binding
fragments thereof that specifically bind LAG3 (e.g., human and/or
cynomolgous monkey, e.g., Macaca fascicularis or Macaca mulatta
LAG3), for example, 4A10, 19E8, 11C9, 22D2, e.g., Ab1, Ab2, Ab3,
Ab4, Ab5, Ab6, Ab7, Ab8 or Ab9, and uses of such antibodies or
fragments. In an embodiment of the invention, the antibody or
fragment is an antibody.
As used herein, an anti-LAG3 antibody or antigen-binding fragment
thereof refers to an antibody or antigen-binding fragment thereof
that specifically binds to human or cynomolgous monkey LAG3. An
antibody binds specifically to a polypeptide comprising a given
sequence (in this case an epitope of human or cynomolgous monkey
LAG3) if it binds to polypeptides comprising the LAG3 sequence with
a K.sub.D of about 1 nM or a higher affinity (e.g., 1 nM-2 pM, 1
nM, 100 pM, 10 pM or 2 pM), but does not bind to proteins lacking
the sequence. For example, an antibody or antigen-binding fragment
that specifically binds to a polypeptide comprising human or
cynomolgous monkey LAG3 may bind to a FLAG.RTM.-tagged form of
human or cynomolgous monkey LAG3 but will not bind to other
FLAG.RTM.-tagged proteins that lack LAG3 epitopes.
The present invention includes anti-LAG3 antibodies and methods of
use thereof. As used herein, the term "antibody" refers to any form
of antibody that exhibits the desired biological activity. Thus, it
is used in the broadest sense and specifically covers, but is not
limited to, monoclonal antibodies (including full length monoclonal
antibodies), polyclonal antibodies, multispecific antibodies (e.g.,
bispecific antibodies), humanized antibodies, fully human
antibodies, chimeric antibodies and camelized single domain
antibodies.
The present invention includes parental anti-LAG3 antibodies and
antigen-binding fragments thereof and methods of use thereof
"Parental antibodies and antigen-binding fragments thereof" are
antibodies and fragments which may be modified for an intended use,
such as humanization of an antibody for use as a human therapeutic
antibody or fragment.
The present invention includes anti-LAG3 antigen-binding fragments
and methods of use thereof. As used herein, unless otherwise
indicated, "antibody fragment" or "antigen-binding fragment" refers
to antigen-binding fragments of antibodies, i.e. antibody fragments
that retain the ability to bind specifically to the antigen bound
by the full-length antibody, e.g. fragments that retain one or more
CDR regions. Examples of antigen-binding fragments include, but are
not limited to, Fab, Fab', F(ab').sub.2, and Fv fragments;
diabodies; single-chain antibody molecules, e.g., sc-Fv; nanobodies
and multispecific antibodies formed from antibody fragments.
The present invention includes anti-LAG3 Fab fragments and methods
of use thereof. A "Fab fragment" is comprised of one light chain
and the C.sub.H1 and variable regions of one heavy chain. The heavy
chain of a Fab molecule cannot form a disulfide bond with another
heavy chain molecule. An "Fab fragment" can be the product of
papain cleavage of an antibody.
The present invention includes anti-LAG3 antibodies and
antigen-binding fragments thereof which comprise an Fc region and
methods of use thereof. An "Fc" region contains two heavy chain
fragments comprising the C.sub.H1 and C.sub.H2 domains of an
antibody. The two heavy chain fragments are held together by two or
more disulfide bonds and by hydrophobic interactions of the
C.sub.H3 domains.
The present invention includes anti-LAG3 Fab' fragments and methods
of use thereof. A "Fab' fragment" contains one light chain and a
portion or fragment of one heavy chain that contains the V.sub.H
domain and the C.sub.H1 domain and also the region between the
C.sub.H1 and C.sub.H2 domains, such that an interchain disulfide
bond can be formed between the two heavy chains of two Fab'
fragments to form a F(ab').sub.2 molecule.
The present invention includes anti-LAG3 F(ab').sub.2 fragments and
methods of use thereof. A "F(ab').sub.2 fragment" contains two
light chains and two heavy chains containing a portion of the
constant region between the C.sub.H1 and C.sub.H2 domains, such
that an interchain disulfide bond is formed between the two heavy
chains. A F(ab').sub.2 fragment thus is composed of two Fab'
fragments that are held together by a disulfide bond between the
two heavy chains. An "F(ab').sub.2 fragment" can be the product of
pepsin cleavage of an antibody.
The present invention includes anti-LAG3 Fv fragments and methods
of use thereof. The "Fv region" comprises the variable regions from
both the heavy and light chains, but lacks the constant
regions.
The present invention includes anti-LAG3 scFv fragments and methods
of use thereof. The term "single-chain Fv" or "scFv" antibody
refers to antibody fragments comprising the V.sub.H and V.sub.L
domains of an antibody, wherein these domains are present in a
single polypeptide chain. Generally, the Fv polypeptide further
comprises a polypeptide linker between the V.sub.H and V.sub.L
domains which enables the scFv to form the desired structure for
antigen-binding. For a review of scFv, see Pluckthun (1994) THE
PHARMACOLOGY OF MONOCLONAL ANTIBODIES, vol. 113, Rosenburg and
Moore eds. Springer-Verlag, New York, pp. 269-315. See also,
International Patent Application Publication No. WO88/01649 and
U.S. Pat. Nos. 4,946,778 and 5,260,203.
The present invention includes anti-LAG3 domain antibodies and
methods of use thereof. A "domain antibody" is an immunologically
functional immunoglobulin fragment containing only the variable
region of a heavy chain or the variable region of a light chain. In
some instances, two or more V.sub.H regions are covalently joined
with a peptide linker to create a bivalent domain antibody. The two
V.sub.H regions of a bivalent domain antibody may target the same
or different antigens.
The present invention includes anti-LAG3 bivalent antibodies and
methods of use thereof. A "bivalent antibody" comprises two
antigen-binding sites. In some instances, the two binding sites
have the same antigen specificities. However, bivalent antibodies
may be bispecific (see below).
The present invention includes anti-LAG3 camelized single domain
antibodies and methods of use thereof. In certain embodiments,
antibodies herein also include camelized single domain antibodies.
See, e.g., Muyldermans et al. (2001) Trends Biochem. Sci. 26:230;
Reichmann et al. (1999) J. Immunol. Methods 231:25; WO 94/04678; WO
94/25591; U.S. Pat. No. 6,005,079). In one embodiment, the present
invention provides single domain antibodies comprising two V.sub.H
domains with modifications such that single domain antibodies are
formed.
The present invention includes anti-LAG3 diabodies and methods of
use thereof. As used herein, the term "diabodies" refers to small
antibody fragments with two antigen-binding sites, which fragments
comprise a heavy chain variable domain (V.sub.H) connected to a
light chain variable domain (V.sub.L) in the same polypeptide chain
(V.sub.H-V.sub.L or V.sub.L-V.sub.H). By using a linker that is too
short to allow pairing between the two domains on the same chain,
the domains are forced to pair with the complementary domains of
another chain and create two antigen-binding sites. Diabodies are
described more fully in, e.g., EP 404,097; WO 93/11161; and
Holliger et al. (1993) Proc. Natl. Acad. Sci. USA 90: 6444-6448.
For a review of engineered antibody variants generally see Holliger
and Hudson (2005) Nat. Biotechnol. 23:1126-1136.
Typically, an antibody or antigen-binding fragment of the invention
which is modified in some way retains at least 10% of its LAG3
(e.g., human and/or cynomolgous monkey, e.g., Macaca fascicularis
or Macaca mulatta LAG3) binding activity (when compared to the
parental antibody) when that activity is expressed on a molar
basis. Preferably, an antibody or antigen-binding fragment of the
invention retains at least 20%, 50%, 70%, 80%, 90%, 95% or 100% or
more of the LAG3 (e.g., human and/or cynomolgous monkey, e.g.,
Macaca fascicularis or Macaca mulatta LAG3) binding affinity as the
parental antibody. It is also intended that an antibody or
antigen-binding fragment of the invention can include conservative
or non-conservative amino acid substitutions (referred to as
"conservative variants" or "function conserved variants" of the
antibody) that do not substantially alter its biologic
activity.
The present invention includes isolated anti-LAG3 antibodies and
antigen-binding fragments thereof (e.g., 4A10, 19E8, 11C9 and/or
22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) and
methods of use thereof as well as isolated polypeptide
immunoglobulin chains thereof and isolated polynucleotides encoding
such polypeptides and isolated vectors including such
polynucleotides. "Isolated" antibodies or antigen-binding fragments
thereof, polypepotides, polynucleotides and vectors, are at least
partially free of other biological molecules from the cells or cell
culture from which they are produced. Such biological molecules
include nucleic acids, proteins, lipids, carbohydrates, or other
material such as cellular debris and growth medium. An isolated
antibody or antigen-binding fragment may further be at least
partially free of expression system components such as biological
molecules from a host cell or of the growth medium thereof.
Generally, the term "isolated" is not intended to refer to a
complete absence of such biological molecules or to an absence of
water, buffers, or salts or to components of a pharmaceutical
formulation that includes the antibodies or fragments.
The present invention includes monoclonal anti-LAG3 antibodies and
antigen-binding fragments thereof as well as monoclonal
compositions comprising a plurality of isolated monoclonal
antibodies. The term "monoclonal antibody", as used herein, refers
to a population of substantially homogeneous antibodies, i.e., the
antibody molecules comprising the population are identical in amino
acid sequence except for possible naturally occurring mutations
that may be present in minor amounts. A "plurality" of such
monoclonal antibodies and fragments in a composition refers to a
concentration of identical (i.e., as discussed above, in amino acid
sequence except for possible naturally occurring mutations that may
be present in minor amounts) antibodies and fragments which is
above that which would normally occur in nature, e.g., in the blood
of a host organism such as a mouse or a human. In contrast,
conventional (polyclonal) antibody preparations typically include a
multitude of different antibodies having different amino acid
sequences in their variable domains, particularly their CDRs, that
are often specific for different epitopes. The modifier
"monoclonal" indicates the character of the antibody as being
obtained from a substantially homogeneous population of antibodies,
and is not to be construed as requiring production of the antibody
by any particular method. For example, the monoclonal antibodies to
be used in accordance with the present invention may be made by the
hybridoma method first described by Kohler et al. (1975) Nature
256: 495, or may be made by recombinant DNA methods (see, e.g.,
U.S. Pat. No. 4,816,567). The "monoclonal antibodies" may also be
isolated from phage antibody libraries using the techniques
described in Clackson et al. (1991) Nature 352: 624-628 and Marks
et al. (1991) J. Mol. Biol. 222: 581-597, for example. See also
Presta (2005) J. Allergy Clin. Immunol. 116:731.
The present invention includes anti-LAG3 chimeric antibodies (e.g.,
human constant domain/mouse variable domain) and methods of use
thereof. As used herein, a "chimeric antibody" is an antibody
having the variable domain from a first antibody and the constant
domain from a second antibody, where the first and second
antibodies are from different species. (U.S. Pat. No. 4,816,567;
and Morrison et al., (1984) Proc. Natl. Acad. Sci. USA 81:
6851-6855). Typically, the variable domains are obtained from an
antibody from an experimental animal (the "parental antibody"),
such as a rodent, and the constant domain sequences are obtained
from human antibodies, so that the resulting chimeric antibody will
be less likely to elicit an adverse immune response in a human
subject than the parental (e.g., mouse) antibody.
The present invention includes anti-LAG3 humanized antibodies and
antigen-binding fragments thereof (e.g., mouse antibodies that have
been humanized) and methods of use thereof. As used herein, the
term "humanized antibody" refers to forms of antibodies that
contain sequences from both human and non-human (e.g., mouse or
rat) antibodies. In general, the humanized antibody will comprise
substantially all of at least one, and typically two, variable
domains, in which all or substantially all of the hypervariable
loops correspond to those of a non-human immunoglobulin, and all or
substantially all of the framework (FR) regions are those of a
human immunoglobulin sequence. The humanized antibody may
optionally comprise at least a portion of a human immunoglobulin
constant region (Fc).
The present invention includes anti-LAG3 fully human antibodies and
antigen-binding fragments thereof and methods of use thereof. The
term "fully human antibody" refers to an antibody that comprises
human immunoglobulin protein sequences only. A fully human antibody
may contain murine carbohydrate chains if produced in a mouse, in a
mouse cell, or in a hybridoma derived from a mouse cell. Similarly,
"mouse antibody" refers to an antibody that comprises mouse
immunoglobulin sequences only. Alternatively, a fully human
antibody may contain rat carbohydrate chains if produced in a rat,
in a rat cell, or in a hybridoma derived from a rat cell.
Similarly, "rat antibody" refers to an antibody that comprises rat
immunoglobulin sequences only. In an embodiment of the invention,
an fully human anti-LAG3 antibody or antigen-binding fragment
thereof is the product of isolation from a transgenic animal, e.g.,
a mouse (e.g., a HUMAB mouse, see e.g., U.S. Pat. Nos. 5,545,806;
5,569,825; 5,625,126; 5,633,425; 5,661,016; 5,770,429; 5,789,650;
5,814,318; 5,874,299 and 5,877,397; and Harding, et al., (1995)
Ann. NY Acad. Sci. 764:536 546; or a XENOMOUSE, see e.g., Green et
al., 1999, J. Immunol. Methods 231:11-23), which has been
genetically modified to have fully human immunoglobulin genes; or
the product of isolation from a phage or virus which expresses the
immunoglobulin chains of the anti-LAG3 fully human antibody or
antigen-binding fragment thereof.
In general, the basic antibody structural unit comprises a
tetramer. Each tetramer includes two identical pairs of polypeptide
chains, each pair having one "light" (about 25 kDa) and one "heavy"
chain (about 50-70 kDa). The amino-terminal portion of each chain
includes a variable region of about 100 to 110 or more amino acids
primarily responsible for antigen recognition. The carboxy-terminal
portion of the heavy chain may define a constant region primarily
responsible for effector function. Typically, human light chains
are classified as kappa and lambda light chains. Furthermore, human
heavy chains are typically classified as mu, delta, gamma, alpha,
or epsilon, and define the antibody's isotype as IgM, IgD, IgG,
IgA, and IgE, respectively. Within light and heavy chains, the
variable and constant regions are joined by a "J" region of about
12 or more amino acids, with the heavy chain also including a "D"
region of about 10 more amino acids. See generally, Fundamental
Immunology Ch. 7 (Paul, W., ed., 2nd ed. Raven Press, N.Y.
(1989).
In an embodiment of the invention, anti-LAG3 antibodies of the
present invention comprise a full tetrameric structure having two
light chains and two heavy chains, including constant regions.
The variable regions of each light/heavy chain pair form the
antibody binding site. Thus, in general, an intact antibody has two
binding sites. Except in bifunctional or bispecific antibodies, the
two binding sites are, in general, the same.
Typically, the variable domains of both the heavy and light chains
comprise three hypervariable regions, also called complementarity
determining regions (CDRs), located within relatively conserved
framework regions (FR). The CDRs are usually aligned by the
framework regions, enabling binding to a specific epitope. In
general, from N-terminal to C-terminal, both light and heavy chains
variable domains comprise FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4.
The assignment of amino acids to each domain is, generally, in
accordance with the definitions of Sequences of Proteins of
Immunological Interest, Kabat, et al.; National Institutes of
Health, Bethesda, Md.; 5.sup.th ed.; NIH Publ. No. 91-3242 (1991);
Kabat (1978) Adv. Prot. Chem. 32:1-75; Kabat, et al., (1977) J.
Biol. Chem. 252:6609-6616; Chothia, et al., (1987) J Mol. Biol.
196:901-917 or Chothia, et al., (1989) Nature 342:878-883.
As used herein, the term "hypervariable region" refers to the amino
acid residues of an antibody or antigen-binding fragment thereof
that are responsible for antigen-binding. The hypervariable region
comprises amino acid residues from a "complementarity determining
region" or "CDR" (i.e. CDR-L1, CDR-L2 and CDR-L3 in the light chain
variable domain and CDR-H1, CDR-H2 and CDR-H3 in the heavy chain
variable domain). See Kabat et al. (1991) Sequences of Proteins of
Immunological Interest, 5th Ed. Public Health Service, National
Institutes of Health, Bethesda, Md.; Johnson et al. (2001) Nucleic
Acids Res. 2001; 29(1): 205-206 (defining the CDR regions of an
antibody by sequence); see also Chothia and Lesk (1987) J. Mol.
Biol. 196: 901-917; Chothia et al. Nature 342, 877 (1989), and
Tramontano et al. J. Mol. Biol. 215, 175 (1990) (defining the CDR
regions of an antibody by structure); see also Macallum et al. J
Mol Biol. 1996 Oct. 11; 262(5):732-45. As used herein, the term
"framework" or "FR" residues refers to those variable domain
residues other than the hypervariable region residues defined
herein as CDR residues.
The scope of the present invention, includes anti-LAG3 antibodies
and antigen-binding fragments thereof that specifically bind LAG3,
which have any combination of CDRs from the immunoglobulin light
chains of SEQ ID NOs: 7, 17, 27 and/or 37 and/or which have any
combination of CDRs from the immunoglobulin heavy chains of SEQ ID
NOs: 2, 12, 22 and 32 wherein the CDRs are as defined by Kabat and
Chothia (see above).
"Homology" refers to sequence similarity between two polynucleotide
sequences or between two polypeptide sequences when they are
optimally aligned. When a position in both of the two compared
sequences is occupied by the same base or amino acid monomer
subunit, e.g., if a position in each of two DNA molecules is
occupied by adenine, then the molecules are homologous at that
position. The percent of homology is the number of homologous
positions shared by the two sequences divided by the total number
of positions compared .times.100. For example, if 6 of 10 of the
positions in two sequences are matched or homologous when the
sequences are optimally aligned then the two sequences are 60%
homologous. Generally, the comparison is made when two sequences
are aligned to give maximum percent homology.
"Isolated nucleic acid molecules" or "isolated polynucleotides"
(e.g., DNA or RNA) is also not associated with all or a portion of
a polynucleotide in which the isolated polynucleotide is found in
nature, or is linked to a polynucleotide to which it is not linked
in nature. For purposes of this disclosure, it should be understood
that "a nucleic acid molecule comprising" a particular nucleotide
sequence does not encompass intact chromosomes. Isolated nucleic
acid molecules "comprising" specified nucleic acid sequences may
include, in addition to the specified sequences, coding sequences
for up to ten or even up to twenty or more other proteins or
portions or fragments thereof, or may include operably linked
regulatory sequences that control expression of the coding region
of the recited nucleic acid sequences, and/or may include vector
sequences. As is discussed below, the present invention includes
isolated polynucleotides encoding any of the immunoglobulin chains
discussed herein.
The phrase "control sequences" refers to DNA sequences necessary
for the expression of an operably linked coding sequence in a
particular host organism. The control sequences that are suitable
for prokaryotes, for example, include a promoter, optionally an
operator sequence, and a ribosome binding site. Eukaryotic cells
are known to use promoters, polyadenylation signals, and
enhancers.
A nucleic acid or polynucleotide is "operably linked" when it is
placed into a functional relationship with another nucleic acid
sequence. For example, DNA for a presequence or secretory leader is
operably linked to DNA for a polypeptide if it is expressed as a
preprotein that participates in the secretion of the polypeptide; a
promoter or enhancer is operably linked to a coding sequence if it
affects the transcription of the sequence; or a ribosome binding
site is operably linked to a coding sequence if it is positioned so
as to facilitate translation. Generally, but not always, "operably
linked" means that the DNA sequences being linked are contiguous,
and, in the case of a secretory leader, contiguous and in reading
phase. However, enhancers do not have to be contiguous. Linking is
accomplished by ligation at convenient restriction sites. If such
sites do not exist, the synthetic oligonucleotide adaptors or
linkers are used in accordance with conventional practice.
As used herein, the expressions "cell," and "cell line," are used
interchangeably and all such designations include progeny. Thus,
the words "transformants" and "transformed cells" include the
primary subject cell and cultures derived therefrom without regard
for the number of transfers. It is also understood that not all
progeny will have precisely identical DNA content, due to
deliberate or inadvertent mutations. Mutant progeny that have the
same function or biological activity as screened for in the
originally transformed cell are included. Where distinct
designations are intended, it will be clear from the context.
As used herein, "polymerase chain reaction" or "PCR" refers to a
procedure or technique in which specific nucleic acid sequences,
RNA and/or DNA, are amplified as described in, e.g., U.S. Pat. No.
4,683,195. Generally, sequence information from the ends of the
region of interest or beyond is used to design oligonucleotide
primers. These primers will be identical or similar in sequence to
opposite strands of the template to be amplified. The 5' terminal
nucleotides of the two primers can coincide with the ends of the
amplified material. PCR can be used to amplify specific RNA
sequences, specific DNA sequences from total genomic DNA, and cDNA
transcribed from total cellular RNA, bacteriophage or plasmid
sequences, etc. See generally Mullis et al. (1987) Cold Spring
Harbor Symp. Quant. Biol. 51:263; Erlich, ed., (1989) PCR
TECHNOLOGY (Stockton Press, N.Y.) As used herein, PCR is considered
to be one, but not the only, example of a nucleic acid polymerase
reaction method for amplifying a nucleic acid test sample
comprising the use of a known nucleic acid as a primer and a
nucleic acid polymerase to amplify or generate a specific piece of
nucleic acid.
As used herein, "germline sequence" refers to a sequence of
unrearranged immunoglobulin DNA sequences. Any suitable source of
unrearranged immunoglobulin sequences may be used. Human germline
sequences may be obtained, for example, from JOINSOLVER germline
databases on the website for the National Institute of Arthritis
and Musculoskeletal and Skin Diseases of the United States National
Institutes of Health. Mouse germline sequences may be obtained, for
example, as described in Giudicelli et al. (2005) Nucleic Acids
Res. 33:D256-D261.
Physical and Functional Properties of the Exemplary Anti-LAG3
Antibodies
The present invention provides anti-LAG3 antibodies and
antigen-binding fragments thereof (e.g., humanized antibodies such
as antagonist humanized antibodies) and methods of use of the
antibodies or antigen-binding fragments thereof in the treatment or
prevention of disease. In one embodiment, the invention provides
for mouse or humanized anti-LAG3 antibodies and antigen-binding
fragments thereof and methods of use of the antibodies or
antigen-binding fragments thereof in the treatment or prevention of
disease. In one embodiment, the invention provides for antagonistic
anti-LAG3 antibodies and methods of use of the antibodies or
antigen-binding fragments thereof in the treatment or prevention of
disease.
Herein, an anti-LAG3 antibody or antigen-binding fragment thereof
comprising a particular light chain and a particular heavy chain
may be referred to as "light chain/heavy chain"; for example, an
antibody comprising the 45AGX_22D2_VL3 light chain and the
Humanized.times.[LAG3_H] mAb.22D2 VH6 N54D heavy chain may be
referred to as "45AGX_22D2_VL3/Humanized.times.[LAG3_H] mAb.22D2
VH6 N54D".
An "anti-LAG3 antibody or antigen-binding fragment thereof" of the
present invention includes any antibody or antigen-binding fragment
thereof that is discussed herein (e.g., 4A10, 19E8, 11C9 and/or
22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9)
which specifically binds to LAG3 (e.g., human or cynomolgous monkey
LAG3). Such antibodies and fragments include humanized antibodies
and fragments having any combination of the mouse or humanized
light and heavy chains that are set forth herein or variants of
such chains which specifically bind LAG3. Such antibodies and
fragments include any antibody or fragment comprising any one or
more of the CDRs (e.g., CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2 and
CDR-H3) of the mouse or humanized chains set forth herein or
variants of such CDRs which specifically bind LAG3. Furthermore, an
anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention includes any antibody or antigen-binding fragment
thereof that binds to the same epitope in LAG3 to which the
antibodies and fragments discussed herein bind and any antibody or
antigen-binding fragment that cross-blocks (partially or fully) or
is cross-blocked (partially or fully) by an antibody or fragment
discussed herein for LAG3 binding; as well as any variant thereof.
A particular embodiment of the invention includes antibodies and
fragments comprising only mouse immunoglobulin chains or only
humanized immunoglobulin chains and/or wherein the immunoglobulin
chains or CDRs are all derived, directly or indirectly, from the
same original mouse clone, i.e., humanized 4A10 light chains paired
with humanized 4A10 heavy chains; humanized 19E8 light chains
paired with humanized 19E8 heavy chains; humanized 11C9 light
chains paired with humanized 11C9 heavy chains; or humanized 22D2
light chains paired with humanized 22D2 heavy chains; or mouse 4A10
light chains paired with mouse 4A10 heavy chains; mouse 19E8 light
chains paired with mouse 19E8 heavy chains; mouse 11C9 light chains
paired with mouse 11C9 heavy chains; or mouse 22D2 light chains
paired with mouse 22D2 heavy chains. These antibodies and fragments
are part of the present invention along with their uses, e.g., as
set forth herein.
The cross-blocking antibodies and antigen-binding fragments thereof
discussed herein can be identified based on their ability to block
any of the antibodies or fragments specifically set forth herein,
e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8, Ab9, 4A10, 19E8, 11C9
and/or 22D2, from binding to LAG3, in binding assays (e.g.,
bio-layer interferometry (BLI; for example FORTEBIO OCTET binding
assay; Pall ForteBio Corp; Menlo Park, Calif.), surface plasmon
resonance (SPR), BIACore, ELISA, flow cytometry). For example, in
an embodiment of the invention, when using BLI, the tip of a
fiber-optic probe is coated with ligand (e.g., LAG3) and acts as
the biosensor wherein binding of anti-LAG3 antibody or
antigen-binding fragment to the LAG3 alters the interference
pattern of white light reflected from the probe layer bound to LAG3
and an internal reference layer. The shift is indicative of
LAG3/anti-LAG3 binding. In an embodiment of the invention, the LAG3
coated tip is immersed in a solution of analyte containing antibody
or antigen-binding fragment, e.g., in the well of either a 96- or
384-well plate. In an embodiment of the invention, the plate is
shaken during reading to create orbital flow. To read the assay,
white light is directed down the length of the fiber. As mentioned
above, interference between light reflecting off the reference
layer and immobilized surfaces containing LAG3 of the tip creates a
distinctive pattern of light returning up the fiber. As molecules
bind to the immobilized sensor surface, that pattern changes in
proportion to the extent of binding. For example, assays can be
used in which a LAG3 (e.g., human LAG3) protein is immobilized on a
BLI probe or plate, a reference anti-LAG3 antibody or fragment
binds to LAG3 (e.g., at saturating concentration) and a test
anti-LAG3 antibody or fragment is added. The ability of the test
antibody to compete with the reference antibody for LAG3 binding is
then determined. In the BLI format, light interference of the LAG3
complex is monitored to determine if the test antibody effectively
competes with the reference antibody, e.g., nanometers of light
wavelength shift over time is monitored wherein a shift indicates
additional binding of the test antibody and a lack of
cross-blocking. In an embodiment of the invention, in the BLI
format, cross-blocking is qualitatively deemed to have occurred
between the antibodies if no additional binding of test antibody is
observed. In an embodiment of the invention, as a control,
cross-blocking of the reference antibody with itself is confirmed;
wherein the assay is determined to be operating correctly if the
reference antibody can cross-block itself from LAG3 binding. The
ability of a test antibody to inhibit the binding of, for example,
Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8, Ab9, 4A10, 19E8, 11C9
and/or 22D2, to LAG3 (e.g., human LAG3) demonstrates that the test
antibody can cross-block Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8,
Ab9, 4A10, 19E8, 11C9 and/or 22D2 for binding to LAG3 (e.g., human
LAG3) and thus, may, in some cases, bind to the same epitope on
LAG3 (e.g., human LAG3) as Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8,
Ab9, 4A10, 19E8, 11C9 and/or 22D2. As stated above, antibodies and
fragments that bind to the same epitope as any of the anti-LAG3
antibodies or fragments of the present invention also form part of
the present invention. In an embodiment of the invention, BLI is
conducted in a sandwich format wherein a reference anti-LAG3
antibody or antigen-binding fragment is immobilized to the probe
and then bound with LAG3. Test anti-LAG3 antibody or
antigen-binding fragment is then tested for the ability to block
binding of the references antibody or fragment.
"4A10", "19E8", "11C9" and "22D2" anti-LAG3 antibodies and
antigen-binding fragments thereof referred to herein comprise the
CDR-L1, CDR-L2 and CDR-L3 of the mouse immunoglobulin light chains
4A10, 19E8, 11C9 or 22D2 and variants thereof, respectively; as
well as CDR-H1, CDR-H2 and CDR-H3 of the mouse immunoglobulin heavy
chains 4A10, 19E8, 11C9 or 22D2, and variants thereof,
respectively. Such "4A10", "19E8", "11C9" and "22D2" antibodies and
fragments may be humanized antibodies or antigen-binding fragments
thereof such as Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 or Ab9.
Examples of the immunoglobulin chains of anti-LAG3 antibodies as
well as their CDRs include, but are not limited to:
TABLE-US-00004 4A10- V.sub.H sequence
ATGAAATGCAGCTGGGTCATCTTCTTCCTGATGGCAGTGGTTATAGGAATCAATTCAGAGGTTCAGCTGCTCCA-
GTC
TGGGGCAGAACTTGTGAGGTCAGGGGCCTCAGTCAAGTTGTCCTGCACAGCCTCTGGCTTCAACATTGAAGACT-
ACT
ATATGCACTGGATGAAACAGAGGCCTGAACAGGGCCTGGAGTGGATTGGATGGATTGATCCTGTGAATGGTGAT-
ACT
GAATATGCCCCGAAGTTCCAGGGCAAGGCCACTATGACTGCAGACACATCCTCCAACACAGCCTACCTACACCT-
CAA
CAGCCTGACATCTGAGGACACTGCCGTCTATTACTGTAATTTCTATGATGGTTACCTCTTTGCTTTCTGGGGCC-
AAG GGACCCTGGTCACTGTCTCTGCA (SEQ ID NO: 1; wherein the CDRs are
underscored and wherein the signal sequence is in bold font)
MKCSWVIFFLMAVVIGINSEVQLLQSGAELVRSGASVKLSCTASGFNIEDYYMHWMKQRPEQGLEWIGWIDPVN-
GDT EYAPKFQGKATMTADTSSNTAYLHLNSLTSEDTAVYYCNFYDGYLFAFWGQGTLVTVSA
(SEQ ID NO: 2; wherein the CDRs are underscored and wherein the
signal sequence is in bold font) CDR-H1: GFNIEDYYMH (SEQ ID NO: 3)
CDR-H2: WIDPVNGDTEYAPKFQG (SEQ ID NO: 4) CDR-H3: YDGYLFAF (SEQ ID
NO: 5) 4A10- V.sub.L sequence
ATGAGGTGCCTAGCTGAGTTCCTGGGGCTGCTTGTGCTCTGGATCCCTGGAGCCATTGGGGATATTGTGCTGAC-
TCA
GGCTGCACCCTCTGTACCTGTCACTCCTGGAGAGTCAGTGTCCATCTCCTGCAGGTCTAGTAAGAGTCTCCTGC-
ATA
GTGATGGCAACACTTATCTGTATTGGCTCCTGCAGAGGCCAGGCCAGTCTCCTCAGCTCCTGATATATCGGATG-
TCC
AACCTTGCCTCAGGGGTCCCAGACAGGTTCAGCGGCAGTGGGTCAGGAACTGTTTTCACACTGAGAATCAGCAG-
ACT
GGAGGCTGAGGATGTGGGTATTTATTACTGTATGCAACATCTAGAATATCCTTTCACGTTTGGAGGGGGGACCA-
AGC TGGAAATAAAA (SEQ ID NO: 6; wherein the CDRs are underscored and
wherein the signal sequence is in bold font)
MRCLAEFLGLLVLWIPGAIGDIVLTQAAPSVPVTPGESVSISCRSSKSLLHSDGNTYLYWLLQRPGQSPQLLIY-
RMS NLASGVPDRFSGSGSGTVFTLRISRLEAEDVGIYYCMQHLEYPFTFGGGTKLEIK (SEQ ID
NO: 7; wherein the CDRs are underscored and wherein the signal
sequence is in bold font) CDR-L1: RSSKSLLHSDGNTYLY (SEQ ID NO: 8)
CDR-L2: YRMSNLAS (SEQ ID NO: 9) CDR-L3: MQHLEYPFT (SEQ ID NO: 10)
19E8- V.sub.H sequence
ATGGGATGGAGCTGGATCTTTCTTTTCCTCCTGTCAGGAACTGCAGGTGTCCGTTGCCAGATCCGACTGCAGCA-
GTC
TGGACCTGAGCTGGTGAAGCCTGGGGCTTCAGTGAAGATATCCTGCAAGGCTTCTGGGTCCTCCTTCACTGACT-
ACT
ATATAAACTGGGTGAAGCAGAAGCCTGGACAGGGACTTGAGTGGATTGGATGGATTTATCCTGGAAGCGGTAAT-
TCT
ATCTACAATGAGAACTTCAAGGCCAAGGCCACATTGACTGTAGACACATCCTCCAGCACAGCCTACATGCATCT-
CAG
CAGCCTGACATCTGAGGACACTGCTGTCTATTTCTGTGCAAGAGAGGCTGATTACGACGATGCTTTGGACTACT-
GGG GTCAAGGAACCTCGGTCACCGTCTCCTCA (SEQ ID NO: 11; wherein the CDRs
are underscored and wherein the signal sequence is in bold font)
MGWSWIFLFLLSGTAGVRCQIRLQQSGPELVKPGASVKISCKASGSSFTDYYINWVKQKPGQGLEWIGWIYPGS-
GNS IYNENFKAKATLTVDTSSSTAYMHLSSLTSEDTAVYFCAREADYDDALDYWGQGTSVTVSS
(SEQ ID NO: 12; wherein the CDRs are underscored and wherein the
signal sequence is in bold font) CDR-H1: GSSFTDYYIN (SEQ ID NO: 13)
CDR-H2: WIYPGSGNSIYNENFKA (SEQ ID NO: 14) CDR-H3: EADYDDALDY (SEQ
ID NO: 15) 19E8- V.sub.L sequence
ATGGTATCCACACCTCAGTTCCTTGTATTTTTGCTTTTCTGGATTCCAGCCTCCAGAGGTCACATCTTGCTGAC-
TCA
GTCTCCAGCCATTCTGTCTGTGAGTCCAGGAGAAAGAGTCAGTTTCTCCTGCAGGGCCAGTCAGAGCATTGGCA-
CAA
GCATACACTGGTATCAGCAAAGAACAAATGGTTCTCCAAGGCTTCTCATAAAGTATGCTTCTGAGTCTATCTCT-
GGG
ATCCCTTCCAGGTTTAGTGGCAGTGGATCAGGGACAGATTTTACTCTTAGCATCAACAGTGTGGAGTCAGAAGA-
TAT
TGCAGATTATTACTGTCAACAAAGTAATAGCTGGCCAACGTACACGTTCGGAGGGGGGACCAAGCTGGAAATAA-
AA (SEQ ID NO: 16; wherein the CDRs are underscored and wherein the
signal sequence is in bold font)
MVSTPQFLVFLLFWIPASRGHILLTQSPAILSVSPGERVSFSCRASQSIGTSIHWYQQRTNG
SPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIADYYCQQSNS WPTYTEGGGTKLEIK
(SEQ ID NO: 17; wherein the CDRs are underscored and wherein the
signal sequence is in bold font) CDR-L1: RASQSIGTSIH (SEQ ID NO:
18) CDR-L2: YASESIS (SEQ ID NO: 19) CDR-L3: QQSNSWPTYT (SEQ ID NO:
20) 11C9- V.sub.H sequence
ATGAGATGGAGCTGTATCATCCTCTTCTTGGTAGCAACAGCTACAGGTGTCAACTCCCAGGTCCAACTGCAGCA-
GCC
TGGGGCTGAGCTTGTGATGCCTGGGGCTTCAGCGAAGATGTCCTGCAAGGCTTCTGGCTACACACTCACTGACT-
ACT
GGATGCACTGGGTGAAGCAGAGGCCTGGACAAGGCCTTGAGTGGATCGGAGCGATTGATATTTCTGATAGTTAT-
TCT
AGCTACAATCAAAAGTTCAAGGGCAAGGCCACATTGACTGTAGACGAATCCTCCAGCACAGCCTACATGCAGCT-
CAC
CAGCCTGACATCTGAGGACTCTGCGGTCTATTACTGTGCAAGATCCCCTTTCTACAATAGTAGAGGGGGGAACT-
ACT TTGACTACTGGGGCCAAGGCACCACTCTCACAGTCTCCTCA (SEQ ID NO: 21;
wherein the CDRs are underscored and wherein the signal sequence is
in bold font) MRWSCIILFLVATATGVNSQVQLQQPGAELVMPGASAKMSCKASGYTLTDYW
MHWVKQRPGQGLEWIGAIDISDSYSSYNQKFKGKATLTVDESSSTAYMQLTSLTSEDSAVYYCARSPFYNSRGG-
NYF DYWGQGTTLTVSS (SEQ ID NO: 22; wherein the CDRs are underscored
and wherein the signal sequence is in bold font) CDR-H1: GYTLTDYWMH
(SEQ ID NO: 23) CDR-H2: AIDISDSYSSYNQKFKG (SEQ ID NO: 24) CDR-H3:
SPFYNSRGGNYFDY (SEQ ID NO: 25) 11C9- V.sub.L sequence
ATGATGTCCTCTGCTCAGTTCCTTGGTCTCCTGTTGCTCTGTTTTCAAGGTACCAGATGTGATATCCAGATGAC-
ACA
GACTACATCCTCCCTGTCTGCCTCTCTGGGAGACAGAGTCACCATCAGTTGCAGGGCAAGTCAGGACATTAGCA-
ATT
ATTTAAACTGGTATCAGCAGAAACCAGATGGAACTGTTAAACTCCTGATCTACTACACATCAAGATTACACTCA-
GGA
GTCCCATCAAGGTTCAGTGGCAGTGGGTCTGGAACAGATTATTCTCTCACCATTAGCAACCTGGAGCAAGAAGA-
TAT
TGCCACTTACTTTTGCCAACAGGGTGATACGCTTCCTCCGTGGACGTTCGGTGGAGGCACCAAGCTGGAAATCA-
AA (SEQ ID NO: 26; wherein the CDRs are underscored and wherein the
signal sequence is in bold font)
MMSSAQFLGLLLLCFQGTRCDIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGTVKLLIYYTSRL-
HSG VPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGDTLPPWTFGGGTKLEIK (SEQ ID NO:
27; wherein the CDRs are underscored and wherein the signal
sequence is in bold font) CDR-L1: RASQDISNYLN (SEQ ID NO: 28)
CDR-L2: YTSRLHS (SEQ ID NO: 29) CDR-L3: QQGDTLPPWT (SEQ ID NO: 30)
22D2- V.sub.H sequence
ATGGGATGGACCTGGATCTTTCTCTTCTTCCTGTCAGGAACTGCAGGTGTCCTCTCTGAGGTCCTGCTGCTACA-
GTC
TGGACCTGAACTGGTGAAGCCTGGGACTTCAGTGAAAATCCCCTGCAAGGCTTCTGGATACACATTCACTGACT-
ACA
ACGTGGACTGGGTGAAGCAGCGCCATGGAAAGGGCCTTGAGTGGATTGGAGATATTAATCCAAACAATGGTGGT-
ACT
ATCTACAGTCAGAAATTCAAGGGCAAGGCCACATTGACTGTTGACAAGTCCTCCAGCACAGCCTTCATGGAGCT-
CCG
CAGCCTGACATCTGAGGACACTGCAGTCTATTTCTGTGCAAGGAACTATAGGTGGTTTGGTGCTATGGACCACT-
GGG GTCAAGGAACCTCAGTCACCGTCTCCTCAGCCAAAACAACAGCCCCATCGGTCTATCCACTG
(SEQ ID NO: 31; wherein the CDRs are underscored and wherein the
signal sequence is in bold font)
MGWTWIFLFFLSGTAGVLSEVLLLQSGPELVKPGTSVKIPCKASGYTFTDYNVDWVKQRHGKGLEWIGDINPN
NGGTIYSQKFKGKATLTVDKSSSTAFMELRSLTSEDTAVYFCARNYRWFGAMDHWGQGTSVTVSS
(SEQ ID NO: 32; wherein the CDRs are underscored and wherein the
signal sequence is in bold font) CDR-H1: DYNVD (SEQ ID NO: 33)
CDR-H2: DINPNNGGTIYSQKFKG (SEQ ID NO: 34) CDR-H3: NYRWFGAMDH (SEQ
ID NO: 35) 22D2- V.sub.L sequence
ATGGAGACAGACACAATCCTGCTATGGGTGCTGCTGCTCTGGGTTCCAGGTTCCACTGGTGACATTGTGTTGAC-
CCA
ATCTCCAGCTTCTTTGGCTGTGTCTCCAGGGCAGAGGGCCACCATTTCCTGCAAGGCCAGTCAAAGTCTTGATT-
ATG
AAGGTGATAGTGATATGAATTGGTACCAACAGAAACCAGGACAGCCACCCAGACTCCTCATCTCTGGTGCATCC-
AAT
CTAGAGTCTGGGATCCCAGCCAGGTTCAGTGGCAGTGGGTCTGGGACAGACTTCACTGTTAACATCCATCCTGT-
GGA
GGAGGAGGATGCTGCAACCTATTACTGTCAGCAAAGTACTGAGGATCCTCGGACGTTCGGTGGAGGCACCAAGC-
TGG
AAATCAAACGGGCTGATGCTGCACCAACTGTATCCATCTTCCCACCATCCAGTGAGCAGTTAACATCTGGAGGT-
GCC
TCAGTCGTGTGCTTCTTGAACAACTTCTACCCCAAAGACATCAATGTCAAGTGGAAGATTGATGGCAGTGAACG-
ACA AAATGGCG (SEQ ID NO: 36; wherein the CDRs are underscored and
wherein the signal sequence is in bold font)
METDTILLWVLLLWVPGSTGDIVLTQSPASLAVSPGQRATISCKASQSLDYEGDSDMNWYQQKPGQPPRLLISG-
ASN LESGIPARFSGSGSGTDFTVNIHPVEEEDAATYYCQQSTEDPRTFGGGTKLEIK (SEQ ID
NO: 37; wherein the CDRs are underscored and wherein the signal
sequence is in bold font) CDR-L1: KASQSLDYEGDSDMN (SEQ ID NO: 38)
CDR-L2: GASNLES (SEQ ID NO: 39) CDR-L3: QQSTEDPRT (SEQ ID NO:
40)
The 22D2 mouse parental heavy or light chains may be referred to
herein as LB145.22D2.E1.1D1. The 19E8 mouse parental heavy or light
chains may be referred to herein as LB148.19E8.G1.1A1. The 4A10
mouse parental heavy or light chains may be referred to herein as
LB148.4A10.1H1. The 11C9 mouse parental heavy or light chains may
be referred to herein as LB148.11C9.1C1.
The present invention also includes any anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibodies such
as antagonist humanized antibodies) comprising one or more of the
heavy and/or light chains (or variants thereof) or CDRs (or
variants thereof) or mature fragments of such chains (or variants
thereof) or variable domains thereof of such chains (or variants
thereof) which are set for the below. Light chains may be
designated with a "V.sub.L" or "VK" and heavy chains may be
designated with a "V.sub.H".
Mouse Immunoglobulin Chains
Chains set forth below having a "4A10", "19E8", "11C9" or "22D2"
designation may be referred to as such herein. As discussed herein,
the scope of the present invention includes anti-LAG3 antibodies
(e.g., humanized antibodies such as humanized antagonistic
antibodies) and antigen-binding fragments thereof comprising any
one or more (e.g., 3) light chain CDRs and/or any one or more
(e.g., 3) heavy chain CDRs from the immunoglobulin chains set forth
below; or any mature variable domain of a light immunoglobulin
chain and/or mature variable domain of a heavy immunoglobulin chain
set forth in SEQ ID NOs: 45-104.
Humanized Chains
In an embodiment of the invention, a humanized (e.g., humanized
antagonistic) anti-LAG3 antibody or antigen-binding fragment of the
invention comprises any combination of heavy and light mature,
variable domains of the following immunoglobulin chains. In an
embodiment of the invention, the 11C9 humanized light chains are
paired with the 11C9 humanized heavy chains; the 19E8 humanized
light chains are paired with the 19E8 humanized heavy chains; the
4A10 humanized light chains are paired with the 4A10 humanized
heavy chains; and the 22D2 humanized light chains are paired with
the 22D2 humanized heavy chains. In an embodiment of the invention,
a humanized anti-LAG3 antibody or antigen-binding fragment thereof
comprises a "45AGX_22D2_VL3" immunoglobulin variable domain light
chain, e.g., comprising the amino acid sequence of SEQ ID NO: 274
or a mature fragment thereof (e.g., amino acids 21-131 of SEQ ID
NO: 274); and a "Humanized.times.[LAG3_H] mAb.22D2 VH6 N54D" or
"Humanized.times.[LAG3_H] mAb.22D2 VH6 N54G" immunoglobulin
variable domain heavy chain comprising the amino acid sequence of
SEQ ID NO: 426 or SEQ ID NO: 427, respectively.
Chains set forth below having a "4A10", "19E8", "11C9" or "22D2"
designation may be referred to as such herein. As discussed herein,
the scope of the present invention includes anti-LAG3 antibodies
(e.g., humanized antibodies such as humanized antagonistic
antibodies) and antigen-binding fragments thereof comprising any
one or more (e.g., 3) light chain CDRs and/or any one or more
(e.g., 3) heavy chain CDRs from the immunoglobulin chains set forth
herein; or any mature or unprocessed V.sub.L domain or light chain
immunoglobulin and/or mature or unprocessed V.sub.H domain or heavy
chain immunoglobulin set forth herein. The scope of the present
invention also includes any of the humanized polypeptides or
polynucleotides or variable domains thereof having 1, 2, 3, 4, 5,
6, 7, 8, 9 or 10 point mutations or point deletions.
Specific embodiments of the invention include any humanized
anti-LAG3 antibodies and antigen-binding fragments thereof
comprising the immunoglobulin light and heavy chains set forth
below or any antibody or fragment having the light and heavy chain
CDRs thereof (e.g., IgG1 or IgG4). Such antibodies and fragments
may be referred to as any one of Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7,
Ab8 or Ab9 as follows: Ab1: humanized light chain 45AGX
Humanized.times.[LAG3_H] mAb (LB145.22D2.E1.D1 (VL3)) Kappa (PX)
(or the variable domain thereof) and humanized heavy chain 53AHH
Humanized.times.[LAG3_H] mAb (LB145.22D2.E1.D1 VH6) IgG1/Kappa (PX)
(or the variable domain thereof); for example comprising: a light
chain immunoglobulin comprising the amino acid sequence:
TABLE-US-00005 DIVMTQTPLSLSVTPGQPASISCKASQSLDYEGDSDMNWYLQKPGQPPQL
LIYGASNLESGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCQQSTEDPR
TFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKV
QWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEV
THQGLSSPVTKSFNRGEC (amino acids 21-238 of SEQ ID NO: 126);
and a heavy chain immunoglobulin comprising the amino acid
sequence:
TABLE-US-00006 (SEQ ID NO: 106)
QMQLVQSGPEVKKPGTSVKVSCKASGYTFTDYNVDWVRQARGQRLEWIGD
INPNNGGTIYAQKFQERVTITVDKSTSTAYMELSSLRSEDTAVYYCARNY
RWFGAMDHWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKD
YFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTY
ICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPK
DTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS
TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQV
YTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVL
DSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK;
or a light chain immunoglobulin variable domain comprising the
amino acid sequence:
TABLE-US-00007 DIVMTQTPLSLSVTPGQPASISCKASQSLDYEGDSDMNWYLQKPGQPPQL
LIYGASNLESGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCQQSTEDPR TFGGGTKVEIK
(amino acids 21-131 of SEQ ID NO: 126 (CDRs underscored));
and a heavy chain immunoglobulin variable domain comprising the
amino acid sequence:
TABLE-US-00008 QMQLVQSGPEVKKPGTSVKVSCKASGYTFTDYNVDWVRQARGQRLEWIGD
INPNNGGTIYAQKFQERVTITVDKSTSTAYMELSSLRSEDTAVYYCARNY
RWFGAMDHWGQGTTVTVSS (amino acids 1-119 of SEQ ID NO: 106 (CDRs
underscored));
or comprising the CDRs:
TABLE-US-00009 (SEQ ID NO: 38) CDR-L1: KASQSLDYEGDSDMN; (SEQ ID NO:
39) CDR-L2: GASNLES; (SEQ ID NO: 40) CDR-L3: QQSTEDPRT; (SEQ ID NO:
33) CDR-H1: DYNVD; (SEQ ID NO: 458) CDR-H2: DINPNNGGTIYAQKFQE; and
(SEQ ID NO: 35) CDR-H3: NYRWFGAMDH
Ab2: humanized light chain 45AGX Humanized.times.[LAG3_H] mAb
(LB145.22D2.E1.D1 (VL3)) Kappa (PX) (or the variable domain
thereof) and humanized heavy chain 56AHH Humanized.times.[LAG3_H]
mAb (LB145.22D2.E1.D1 VH6 N55S) IgG1/Kappa (PX) (or the variable
domain thereof); for example: comprising: a light chain
immunoglobulin comprising the amino acid sequence:
TABLE-US-00010 DIVMTQTPLSLSVTPGQPASISCKASQSLDYEGDSDMNWYLQKPGQPPQL
LIYGASNLESGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCQQSTEDPR
TFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKV
QWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEV
THQGLSSPVTKSFNRGEC (amino acids 21-238 of SEQ ID NO: 126);
and a heavy chain immunoglobulin comprising the amino acid
sequence:
TABLE-US-00011 (SEQ ID NO: 108)
QMQLVQSGPEVKKPGTSVKVSCKASGYTFTDYNVDWVRQARGQRLEWIGD
INPNSGGTIYAQKFQERVTITVDKSTSTAYMELSSLRSEDTAVYYCARNY
RWFGAMDHWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKD
YFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTY
ICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPK
DTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS
TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQV
YTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVL
DSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK;
or a light chain immunoglobulin variable domain comprising the
amino acid sequence:
TABLE-US-00012 DIVMTQTPLSLSVTPGQPASISCKASQSLDYEGDSDMNWYLQKPGQPPQL
LIYGASNLESGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCQQSTEDPR TFGGGTKVEIK
(amino acids 21-131 of SEQ ID NO: 126 (CDRs underscored));
and a heavy chain immunoglobulin variable domain comprising the
amino acid sequence:
TABLE-US-00013 QMQLVQSGPEVKKPGTSVKVSCKASGYTFTDYNVDWVRQARGQRLEWIGD
INPNSGGTIYAQKFQERVTITVDKSTSTAYMELSSLRSEDTAVYYCARNY
RWFGAMDHWGQGTTVTVSS (amino acids 1-119 of SEQ ID NO: 108 (CDRs
underscored));
or comprising the CDRs:
TABLE-US-00014 (SEQ ID NO: 38) CDR-L1: KASQSLDYEGDSDMN; (SEQ ID NO:
39) CDR-L2: GASNLES; (SEQ ID NO: 40) CDR-L3: QQSTEDPRT; (SEQ ID NO:
33) CDR-H1: DYNVD; (SEQ ID NO: 456) CDR-H2: DINPNSGGTIYAQKFQE; and
(SEQ ID NO: 35) CDR-H3: NYRWFGAMDH
Ab3: humanized light chain 45AGX Humanized.times.[LAG3_H] mAb
(LB145.22D2.E1.D1 (VL3)) Kappa (PX) (or the variable domain
thereof) and humanized heavy chain 54AHH Humanized.times.[LAG3_H]
mAb (LB145.22D2.E1.D1 VH6 N55D) IgG1/Kappa (PX) (or the variable
domain thereof); for example comprising: a light chain
immunoglobulin comprising the amino acid sequence:
TABLE-US-00015 DIVMTQTPLSLSVTPGQPASISCKASQSLDYEGDSDMNWYLQKPGQPPQL
LIYGASNLESGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCQQSTEDPR
TEGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNEYPREAKV
QWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEV
THQGLSSPVTKSFNRGEC (amino acids 21-238 of SEQ ID NO: 126);
a heavy chain immunoglobulin comprising the amino acid
sequence:
TABLE-US-00016 (SEQ ID NO: 110)
QMQLVQSGPEVKKPGTSVKVSCKASGYTFTDYNVDWVRQARGQRLEWIGD
INPNSGGTIYAQKFQERVTITVDKSTSTAYMELSSLRSEDTAVYYCARNY
RWFGAMDHWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKD
YFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTY
ICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPK
DTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS
TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQV
YTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVL
DSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK;
or a light chain immunoglobulin variable domain comprising the
amino acid sequence:
TABLE-US-00017 DIVMTQTPLSLSVTPGQPASISCKASQSLDYEGDSDMNWYLQKPGQPPQLL
IYGASNLESGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCQQSTEDPRTF GGGTKVEIK
(amino acids 21-131 of SEQ ID NO: 126 (CDRs underscored));
and a heavy chain immunoglobulin variable domain comprising the
amino acid sequence:
TABLE-US-00018 QMQLVQSGPEVKKPGTSVKVSCKASGYTFTDYNVDWVRQARGQRLEWIGD
INPNDGGTIYAQKFQERVTITVDKSTSTAYMELSSLRSEDTAVYYCARNY
RWFGAMDHWGQGTTVTVSS (amino acids 1-119 of SEQ ID NO: 110 (CDRs
underscored))
or comprising the CDRs:
TABLE-US-00019 CDR-L1: (SEQ ID NO: 38) KASQSLDYEGDSDMN; CDR-L2:
(SEQ ID NO: 39) GASNLES; CDR-L3: (SEQ ID NO: 40) QQSTEDPRT; CDR-H1:
(SEQ ID NO: 33) DYNVD; CDR-H2: (SEQ ID NO: 457) DINPNDGGTIYAQKFQE;
and CDR-H3: (SEQ ID NO: 35) NYRWFGAMDH
Ab4: humanized light chain 45AGX Humanized.times.[LAG3_H] mAb
(LB145.22D2.E1.D1 (VL3)) Kappa (PX) (or the variable domain
thereof) and humanized heavy chain 52AHH Humanized.times.[LAG3_H]
mAb (LB145.22D2.E1.D1 VH6 N55Q) IgG1/Kappa (PX) (or the variable
domain thereof); for example comprising: a light chain
immunoglobulin comprising the amino acid sequence:
TABLE-US-00020 DIVMTQTPLSLSVTPGQPASISCKASQSLDYEGDSDMNWYLQKPGQPPQL
LIYGASNLESGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCQQSTEDPR
TEGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNEYPREAKV
QWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEV
THQGLSSPVTKSFNRGEC (amino acids 21-238 of SEQ ID NO: 126);
and a heavy chain immunoglobulin comprising the amino acid
sequence:
TABLE-US-00021 (SEQ ID NO: 112)
QMQLVQSGPEVKKPGTSVKVSCKASGYTFTDYNVDWVRQARGQRLEWIGD
INPNQGGTIYAQKFQERVTITVDKSTSTAYMELSSLRSEDTAVYYCARNY
RWFGAMDHWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKD
YFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTY
ICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPK
DTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS
TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQV
YTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVL
DSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK;
or a light chain immunoglobulin variable domain comprising the
amino acid sequence:
TABLE-US-00022 DIVMTQTPLSLSVTPGQPASISCKASQSLDYEGDSDMNWYLQKPGQPPQLL
IYGASNLESGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCQQSTEDPRTF GGGTKVEIK
(amino acids 21-131 of SEQ ID NO: 126 (CDRs underscored));
and a heavy chain immunoglobulin variable domain comprising the
amino acid sequence:
TABLE-US-00023 QMQLVQSGPEVKKPGTSVKVSCKASGYTFTDYNVDWVRQARGQRLEWIGD
INPNQGGTIYAQKFQERVTITVDKSTSTAYMELSSLRSEDTAVYYCARNY
RWFGAMDHWGQGTTVTVSS (amino acids 1-119 of SEQ ID NO: 112 (CDRs
underscored));
or comprising the CDRs:
TABLE-US-00024 CDR-L1: (SEQ ID NO: 38) KASQSLDYEGDSDMN; CDR-L2:
(SEQ ID NO: 39) GASNLES; CDR-L3: (SEQ ID NO: 40) QQSTEDPRT; CDR-H1:
(SEQ ID NO: 33) DYNVD; CDR-H2: (SEQ ID NO: 455) DINPNQGGTIYAQKFQE;
and CDR-H3: (SEQ ID NO: 35) NYRWFGAMDH
Ab5: humanized light chain 45AGX Humanized.times.[LAG3_H] mAb
(LB145.22D2.E1.D1 (VL3)) Kappa (PX) (or the variable domain
thereof) and humanized heavy chain 57AHH Humanized.times.[LAG3_H]
mAb (LB145.22D2.E1.D1 VH6) IgG4 S228P (PX) (or the variable domain
thereof); for example comprising: a light chain immunoglobulin
comprising the amino acid sequence:
TABLE-US-00025 DIVMTQTPLSLSVTPGQPASISCKASQSLDYEGDSDMNWYLQKPGQPPQL
LIYGASNLESGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCQQSTEDPR
TEGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNEYPREAKV
QWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEV
THQGLSSPVTKSFNRGEC (amino acids 21-238 of SEQ ID NO: 126);
and
TABLE-US-00026 (SEQ ID NO: 114)
QMQLVQSGPEVKKPGTSVKVSCKASGYTFTDYNVDWVRQARGQRLEWIGD
INPNNGGTIYAQKFQERVTITVDKSTSTAYMELSSLRSEDTAVYYCARNY
RWFGAMDHWGQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKD
YFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTY
TCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTL
MISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYR
VVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTL
PPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD
GSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK;
or a light chain immunoglobulin variable domain comprising the
amino acid sequence:
TABLE-US-00027 DIVMTQTPLSLSVTPGQPASISCKASQSLDYEGDSDMNWYLQKPGQPPQLL
IYGASNLESGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCQQSTEDPRTF GGGTKVEIK
(amino acids 21-131 of SEQ ID NO: 126 (CDRs underscored));
and a heavy chain immunoglobulin variable domain comprising the
amino acid sequence:
TABLE-US-00028 QMQLVQSGPEVKKPGTSVKVSCKASGYTFTDYNVDWVRQARGQRLEWIGD
INPNNGGTIYAQKFQERVTITVDKSTSTAYMELSSLRSEDTAVYYCARNY
RWFGAMDHWGQGTTVTVSS (amino acids 1-119 of SEQ ID NO: 114 (CDRs
underscored))
or comprising the CDRs:
TABLE-US-00029 CDR-L1: (SEQ ID NO: 38) KASQSLDYEGDSDMN; CDR-L2:
(SEQ ID NO: 39) GASNLES; CDR-L3: (SEQ ID NO: 40) QQSTEDPRT; CDR-H1:
(SEQ ID NO: 33) DYNVD; CDR-H2: (SEQ ID NO: 458) DINPNNGGTIYAQKFQE;
and CDR-H3: (SEQ ID NO: 35) NYRWFGAMDH
Ab6: humanized light chain 45AGX Humanized.times.[LAG3_H] mAb
(LB145.22D2.E1.D1 (VL3)) Kappa (PX) (or the variable domain
thereof) and humanized heavy chain 73AHD Humanized.times.[LAG3_H]
mAb (LB145.22D2.E1.D1 VH6 N55D/VL3) IgG4 S228P/Kappa (PX) (or the
variable domain thereof); for example comprising: a light chain
immunoglobulin comprising the amino acid sequence:
TABLE-US-00030 DIVMTQTPLSLSVTPGQPASISCKASQSLDYEGDSDMNWYLQKPGQPPQL
LIYGASNLESGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCQQSTEDPR
TFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKV
QWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEV
THQGLSSPVTKSFNRGEC (amino acids 21-238 of SEQ ID NO: 126);
and a heavy chain immunoglobulin comprising the amino acid
sequence:
TABLE-US-00031 (SEQ ID NO: 116)
QMQLVQSGPEVKKPGTSVKVSCKASGYTFTDYNVDWVRQARGQRLEWIGD
INPNDGGTIYAQKFQERVTITVDKSTSTAYMELSSLRSEDTAVYYCARNY
RWFGAMDHWGQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKD
YFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTY
TCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTL
MISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYR
VVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTL
PPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD
GSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK;
or a light chain immunoglobulin variable domain comprising the
amino acid sequence:
TABLE-US-00032 DIVMTQTPLSLSVTPGQPASISCKASQSLDYEGDSDMNWYLQKPGQPPQL
LIYGASNLESGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCQQSTEDPR TFGGGTKVEIK
(amino acids 21-131 of SEQ ID NO: 126 (CDRs underscored));
and a heavy chain immunoglobulin variable domain comprising the
amino acid sequence:
TABLE-US-00033 QMQLVQSGPEVKKPGTSVKVSCKASGYTFTDYNVDWVRQARGQRLEWIGD
INPNDGGTIYAQKFQERVTITVDKSTSTAYMELSSLRSEDTAVYYCARNY
RWFGAMDHWGQGTTVTVSS (amino acids 1-119 of SEQ ID NO: 116 (CDRs
underscored));
or comprising the CDRs:
TABLE-US-00034 (SEQ ID NO: 38) CDR-L1: KASQSLDYEGDSDMN; (SEQ ID NO:
39) CDR-L2: GASNLES; (SEQ ID NO: 40) CDR-L3: QQSTEDPRT; (SEQ ID NO:
33) CDR-H1: DYNVD; (SEQ ID NO: 457) CDR-H2: DINPNDGGTIYAQKFQE; and
(SEQ ID NO: 35) CDR-H3: NYRWFGAMDH
Ab7: humanized light chain 45AGX Humanized.times.[LAG3_H] mAb
(LB145.22D2.E1.D1 (VL3)) Kappa (PX) (or the variable domain
thereof) and humanized heavy chain 21AHG Humanized.times.[LAG3_H]
mAb (LB145.22D2.E1.D1 VH6 N55S/VL3) IgG4 S228P/Kappa (PX) (or the
variable domain thereof); for example comprising: a light chain
immunoglobulin comprising the amino acid sequence:
TABLE-US-00035 DIVMTQTPLSLSVTPGQPASISCKASQSLDYEGDSDMNWYLQKPGQPPQL
LIYGASNLESGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCQQSTEDPR
TFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKV
QWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEV
THQGLSSPVTKSFNRGEC (amino acids 21-238 of SEQ ID NO: 126);
and a heavy chain immunoglobulin comprising the amino acid
sequence:
TABLE-US-00036 (SEQ ID NO: 118)
QMQLVQSGPEVKKPGTSVKVSCKASGYTFTDYNVDWVRQARGQRLEWIGD
INPNSGGTIYAQKFQERVTITVDKSTSTAYMELSSLRSEDTAVYYCARNY
RWFGAMDHWGQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKD
YFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTY
TCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTL
MISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYR
VVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTL
PPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD
GSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK;
or a light chain immunoglobulin variable domain comprising the
amino acid sequence:
TABLE-US-00037 DIVMTQTPLSLSVTPGQPASISCKASQSLDYEGDSDMNWYLQKPGQPPQL
LIYGASNLESGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCQQSTEDPR TFGGGTKVEIK
(amino acids 21-131 of SEQ ID NO: 126 (CDRs underscored));
and a heavy chain immunoglobulin variable domain comprising the
amino acid sequence:
TABLE-US-00038 QMQLVQSGPEVKKPGTSVKVSCKASGYTFTDYNVDWVRQARGQRLEWIGD
INPNSGGTIYAQKFQERVTITVDKSTSTAYMELSSLRSEDTAVYYCARNY
RWFGAMDHWGQGTTVTVSS (amino acids 1-119 of SEQ ID NO: 118 (CDRs
underscored));
or comprising the CDRs:
TABLE-US-00039 (SEQ ID NO: 38) CDR-L1: KASQSLDYEGDSDMN; (SEQ ID NO:
39) CDR-L2: GASNLES; (SEQ ID NO: 40) CDR-L3: QQSTEDPRT; (SEQ ID NO:
33) CDR-H1: DYNVD; (SEQ ID NO: 456) CDR-H2: DINPNSGGTIYAQKFQE; and
(SEQ ID NO: 35) CDR-H3: NYRWFGAMDH
Ab8: humanized light chain 45AGX Humanized.times.[LAG3_H] mAb
(LB145.22D2.E1.D1 (VL3)) Kappa (PX) (or the variable domain
thereof) and humanized heavy chain 80AHG Humanized.times.[LAG3_H]
mAb (LB145.22D2.E1.D1 VH6 N55Q/VL3) IgG4 S228P/Kappa (PX) (or the
variable domain thereof); for example comprising: a light chain
immunoglobulin comprising the amino acid sequence:
TABLE-US-00040 DIVMTQTPLSLSVTPGQPASISCKASQSLDYEGDSDMNWYLQKPGQPPQL
LIYGASNLESGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCQQSTEDPR
TFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKV
QWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEV
THQGLSSPVTKSFNRGEC (amino acids 21-238 of SEQ ID NO: 126);
and a heavy chain immunoglobulin comprising the amino acid
sequence:
TABLE-US-00041 (SEQ ID NO: 120)
QMQLVQSGPEVKKPGTSVKVSCKASGYTFTDYNVDWVRQARGQRLEWIGD
INPNQGGTIYAQKFQERVTITVDKSTSTAYMELSSLRSEDTAVYYCARNY
RWFGAMDHWGQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKD
YFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTY
TCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTL
MISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYR
VVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTL
PPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD
GSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK;
or a light chain immunoglobulin variable domain comprising the
amino acid sequence:
TABLE-US-00042 DIVMTQTPLSLSVTPGQPASISCKASQSLDYEGDSDMNWYLQKPGQPPQL
LIYGASNLESGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCQQSTEDPR TFGGGTKVEIK
(amino acids 21-131 of SEQ ID NO: 126 (CDRs underscored));
and a heavy chain immunoglobulin variable domain comprising the
amino acid sequence:
TABLE-US-00043 QMQLVQSGPEVKKPGTSVKVSCKASGYTFTDYNVDWVRQARGQRLEWIGD
INPNQGGTIYAQKFQERVTITVDKSTSTAYMELSSLRSEDTAVYYCARNY
RWFGAMDHWGQGTTVTVSS (amino acids 1-119 of SEQ ID NO: 120 (CDRs
underscored));
or comprising the CDRs:
TABLE-US-00044 (SEQ ID NO: 38) CDR-L1: KASQSLDYEGDSDMN; (SEQ ID NO:
39) CDR-L2: GASNLES; (SEQ ID NO: 40) CDR-L3: QQSTEDPRT; (SEQ ID NO:
33) CDR-H1: DYNVD; (SEQ ID NO: 455) CDR-H2: DINPNQGGTIYAQKFQE; and
(SEQ ID NO: 35) CDR-H3: NYRWFGAMDH
or Ab9: humanized light chain 45AGX Humanized.times.[LAG3_H] mAb
(LB145.22D2.E1.D1 (VL3)) Kappa (PX) (or the variable domain
thereof) and humanized heavy chain 72AHD Humanized.times.[LAG3_H]
mAb (LB145.22D2.E1.D1 VH6 N55G/VL3) IgG4 S228P/Kappa (PX)) (or the
variable domain thereof); for example comprising: a light chain
immunoglobulin comprising the amino acid sequence:
TABLE-US-00045 DIVMTQTPLSLSVTPGQPASISCKASQSLDYEGDSDMNWYLQKPGQPPQL
LIYGASNLESGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCQQSTEDPR
TEGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNEYPREAKV
QWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEV
THQGLSSPVTKSFNRGEC (amino acids 21-238 of SEQ ID NO: 126);
and a heavy chain immunoglobulin comprising the amino acid
sequence:
TABLE-US-00046 (SEQ ID NO: 122)
QMQLVQSGPEVKKPGTSVKVSCKASGYTFTDYNVDWVRQARGQRLEWIGD
INPNSGGTIYAQKFQERVTITVDKSTSTAYMELSSLRSEDTAVYYCARNY
RWFGAMDHWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKD
YFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTY
ICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPK
DTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS
TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQV
YTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVL
DSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK;
or a light chain immunoglobulin variable domain comprising the
amino acid sequence:
TABLE-US-00047 DIVMTQTPLSLSVTPGQPASISCKASQSLDYEGDSDMNWYLQKPGQPPQL
LIYGASNLESGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCQQSTEDPR TFGGGTKVEIK
(amino acids 21-131 of SEQ ID NO: 126 (CDRs underscored));
and a heavy chain immunoglobulin variable domain comprising the
amino acid sequence:
TABLE-US-00048 QMQLVQSGPEVKKPGTSVKVSCKASGYTFTDYNVDWVRQARGQRLEWIGD
INPNGGGTIYAQKFQERVTITVDKSTSTAYMELSSLRSEDTAVYYCARNY
RWFGAMDHWGQGTTVTVSS (amino acids 1-119 of SEQ ID NO: 122 (CDRs
underscored));
or comprising the CDRs:
TABLE-US-00049 CDR-L1: (SEQ ID NO: 38) KASQSLDYEGDSDMN; CDR-L2:
(SEQ ID NO: 39) GASNLES; CDR-L3: (SEQ ID NO: 40) QQSTEDPRT; CDR-H1:
(SEQ ID NO: 33) DYNVD; CDR-H2: (SEQ ID NO: 454) DINPNGGGTIYAQKFQE;
and CDR-H3: (SEQ ID NO: 35) NYRWFGAMDH
In an embodiment of the invention, the CDR-H2 of any anti-LAG3
antibody or antigen-binding fragment thereof of the present
invention comprises the amino acid sequence:
TABLE-US-00050 (SEQ ID NO: 446)
DINPNX.sub.1GGTIYX.sub.2QKFX.sub.3X.sub.4
wherein, X.sub.1=D, N, S or Q X.sub.2=A or S X.sub.3=Q or K
X.sub.4=E or G
Humanized heavy immunoglobulin chains are set forth in SEQ ID NOs:
106, 108, 110, 112, 114, 116, 118, 120, 122, 124, 124, 128, 134,
140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164,
166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190,
192, 194, 196, 198, 200, 202, 204, 206, 212, 214, 216, 218, 220,
222, 234, 235, 237, 239, 243, 245, 247, 249, 251, 253, 255, 265,
267, 269, 271, 273, 275, 277, 279, 281, 283, 285, 287, 289, 291,
293, 295, 297, 299, 301, 303, 305, 307, 309, 311, 313, 315, 317,
319, 321, 323, 325, 327, 329, 331, 333, 335, 337, 339, 341, 343,
345, 347, 349, 353, 355, 357, 359, 361, 363, 365, 367, 377, 379,
381, 383, 385, 387, 389, 391, 393, 395, 397, 399, 406-419, 448,
449, 462 and 463. DNA encoding humanized heavy immunoglobulin
chains are set forth in SEQ ID NOs: 105, 107, 109, 111, 113, 115,
117, 119, 121, 123, 127, 133, 139, 141, 143, 145, 147, 149, 151,
153, 155, 157, 159, 161, 163, 165, 167, 169, 171, 173, 175, 177,
179, 181, 183, 185, 187, 189, 191, 193, 195, 197, 199, 201, 203,
205, 211, 213, 215, 217, 219, 221, 233, 236, 238, 242, 244, 246,
248, 250, 252, 254, 264, 266, 268, 270, 272, 274, 276, 278, 280,
282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306,
308, 310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332,
334, 336, 338, 340, 342, 344, 346, 348, 352, 354, 356, 358, 360,
362, 364, 366, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394,
396 and 398.
Humanized light immunoglobulin chains are set forth in SEQ ID NOs:
126, 130, 132, 136, 138, 208, 210, 224, 226, 228, 230, 232, 241,
257, 259, 261, 263, 351, 369, 371, 373, 375, 401, 403, 405,
450-453, 426, 427 and 459-461. DNA encoding humanized light
immunoglobulin chains are set forth in SEQ ID NOs: 125, 129, 131,
135, 137, 207, 209, 223, 225, 227, 229, 231, 240, 256, 258, 260,
262, 350, 368, 370, 372, 374, 400, 402 and 404.
A "variant" of a polypeptide, such as an immunoglobulin chain,
refers to a polypeptide comprising an amino acid sequence that is
at least about 70-99.9% (e.g., 70, 72, 74, 75, 76, 79, 80, 81, 82,
83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99,
99.5, 99.9%) identical or similar to a referenced amino acid
sequence that is set forth herein; when the comparison is performed
by a BLAST algorithm wherein the parameters of the algorithm are
selected to give the largest match between the respective sequences
over the entire length of the respective reference sequences (e.g.,
expect threshold: 10; word size: 3; max matches in a query range:
0; BLOSUM 62 matrix; gap costs: existence 11, extension 1;
conditional compositional score matrix adjustment).
A "variant" of a polynucleotide refers to a polynucleotide
comprising a nucleotide sequence that is at least about 70-99.9%
(e.g., 70, 72, 74, 75, 76, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88,
89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 99.5, 99.9%) identical
to a referenced nucleotide sequence that is set forth herein; when
the comparison is performed by a BLAST algorithm wherein the
parameters of the algorithm are selected to give the largest match
between the respective sequences over the entire length of the
respective reference sequences (e.g., expect threshold: 10; word
size: 28; max matches in a query range: 0; match/mismatch scores:
1, -2; gap costs: linear).
Polypeptides and anti-LAG3 antibodies and antigen-binding fragments
thereof (e.g., humanized antibodies) of the present invention, in
an embodiment of the invention, include a heavy chain
immunoglobulin variable region having at least 78.99% (e.g., 79%,
80%, 85%, 90%, 95%, 99%) amino acid sequence identity to amino
acids 1-119 of SEQ ID NO: 106; and/or a light chain immunoglobulin
variable region having at least 78.38% (e.g., 79%, 80%, 85%, 90%,
95%, 99%) amino acid sequence identity to amino acids 1-111 of SEQ
ID NO: 224.
In addition, a variant may be a polypeptide comprising an amino
acid sequence that is set forth herein except for one or more
(e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10) mutations such as, for
example, missense mutations (e.g., conservative substitutions),
non-sense mutations, deletions, or insertions. Such a polypeptide
may be an immunoglobulin light chain, an immunoglobulin heavy chain
and/or a CDR (e.g., any one or more of CDR-L1, CDR-L2, CDR-L3,
CDR-H1, CDR-H2 and/or CDR-H3).
As discussed herein, the present invention includes anti-LAG3
antibodies and antigen-binding fragments thereof that include one
or more variants of the framework sequences (e.g., any one or more
of FR-L1, FR-L2, FR-L3, FR-L4, FR-H1, FR-H2, FR-H3 and/or FR-H4),
CDRs (e.g., 1, 2 or 3 variant CDR-Ls and/or 1, 2, or 3 variant
CDR-Hs) and/or immunoglobulin chains (e.g., 1 or 2 variant V.sub.Ls
and/or 1 or 2 variant V.sub.Hs) whose sequences are specifically
set forth herein. Such antibodies and antigen-binding fragments
may, themselves, be referred to as variants. Simple polypeptide
chains, that include one or more variant FRs, CDR-Ls, CDR-Hs and/or
immunoglobulin chains, themselves are also part of the present
invention. Polynucleotides encoding such variant polypeptide chains
are also part of the present invention. For example, the present
invention provides anti-LAG3 antibodies and antigen-binding
fragments thereof that comprising the amino acid sequence of the
V.sub.H and V.sub.L of the antibodies Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 or Ab9, which are set forth herein, as well as variants
thereof comprising the CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2 and
CDR-H3 of said Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 or Ab9 but
comprising 70% or more (e.g., 80%, 85%, 90%, 95%, 97% or 99%)
overall amino acid sequence identity or similarity to said V.sub.H
and V.sub.L of Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 or Ab9. Thus,
in such embodiments, the CDRs of the antibodies and fragments are
identical to those of the V.sub.H and V.sub.L of Ab1, Ab2, Ab3,
Ab4, Ab5, Ab6, Ab7, Ab8 or Ab9 but any differences from such
V.sub.H and V.sub.L occur in the frameworks and/or immunoglobulin
constant domains.
The invention provides variant anti-LAG3 antibodies or
antigen-binding fragments thereof (e.g., humanized antibodies such
as antagonist humanized antibodies) comprising one or more variant
CDRs (e.g., any one or more of CDR-L1, CDR-L2, CDR-L3, CDR-H1,
CDR-H2 and/or CDR-H3) and/or framework regions (e.g., any one or
more of FR1, FR2, FR3 and/or FR4) that are set forth herein; and/or
one or more variant V.sub.L domains and/or one or more variant
V.sub.H domains of such antibodies or fragments that are set forth
herein, for example, with at least 70%, 75%, 80%, 85%, 90%, 95%,
98%, 99% or 99.9% sequence identity or similarity to, e.g., SEQ ID
NO: 2, 3, 4, 5, 7, 8, 9, 10, 12, 13, 14, 15, 17, 18, 19, 20, 22,
23, 24, 25, 27, 28, 29, 30, 32, 33, 34, 35, 37, 38, 39, 40, 45, 47,
49, 51, 53, 55, 57, 59, 61, 63, 65, 67, 69, 71, 73, 75, 77, 79, 81,
83, 85, 87, 89, 91, 93, 95, 97, 99, 101, 103, 106, 108, 110, 112,
114, 116, 118, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138,
140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164,
166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190,
192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216,
218, 220, 222, 224, 226, 228, 230, 232, 234, 235, 237, 239, 241,
243, 245, 247, 249, 251, 253, 255, 257, 259, 261, 263, 265, 267,
269, 271, 273, 275, 277, 279, 281, 283, 285, 287, 289, 291, 293,
295, 297, 299, 301, 303, 305, 307, 309, 311, 313, 315, 317, 319,
321, 323, 325, 327, 329, 331, 333, 335, 337, 339, 341, 343, 345,
347, 349, 351, 353, 355, 357, 359, 361, 363, 365, 367, 369, 371,
373, 375, 377, 379, 381, 383, 385, 387, 389, 391, 393, 395, 397,
399, 401, 403, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414,
415, 416, 417, 418, 419, 426, 427, 434, 435, 436, 437, 438, 439,
440, 441, 442, 446, 448, 449, 451, 452, 453, 454, 455, 456, 457,
458, 459, 460, 461, 462, 463 or 464; which specifically bind to
LAG3.
As discussed above, the scope of the present invention includes
variant anti-LAG3 antibodies or antigen-binding fragments
comprising one or more variant CDRs (e.g., 1, 2 or 3 variant CDR-Ls
and/or 1, 2, or 3 variant CDR-H); and/or framework regions (e.g.,
any one or more of FR1, FR2, FR3 and/or FR4) and/or variant V.sub.L
and/or variant V.sub.H domains (with or without a signal sequence)
having 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more mutations. The
mutations can include point mutations which are conservative or
non-conservative amino acid substitutions or point deletions, for
example in a framework region and/or in a CDR. As discussed above,
the present invention provides anti-LAG3 antibodies and antigen
binding fragments thereof comprising CDR-L1, CDR-L2, CDR-L3,
CDR-H1, CDR-H2 and CDR-H3 of Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8
or Ab9 but having mutations in the framework regions thereof.
Conservatively modified variant anti-LAG3 antibodies and
antigen-binding fragments thereof are also part of the present
invention. A "conservatively modified variant" or a "conservative
substitution" refers to a variant wherein there is one or more
substitutions of amino acids in a polypeptide with other amino
acids having similar characteristics (e.g. charge, side-chain size,
hydrophobicity/hydrophilicity, backbone conformation and rigidity,
etc.). Such changes can frequently be made without significantly
disrupting the biological activity of the antibody or fragment.
Those of skill in this art recognize that, in general, single amino
acid substitutions in non-essential regions of a polypeptide do not
substantially alter biological activity (see, e.g., Watson et al.
(1987) Molecular Biology of the Gene, The Benjamin/Cummings Pub.
Co., p. 224 (4th Ed.)). In addition, substitutions of structurally
or functionally similar amino acids are less likely to
significantly disrupt biological activity.
Variant anti-LAG3 antibodies or antigen-binding fragments of the
present invention, which are discussed herein, comprise one or more
CDRs (e.g., 1, 2 or 3 variant CDR-Ls and/or 1, 2, or 3 variant
CDR-H); framework regions (e.g., any one or more of FR1, FR2, FR3
and/or FR4); and/or immunoglobulin chains having one or more
conservative substitutions. For example, such antibodies and
fragments may comprise the amino acid sequences disclosed herein,
e.g. SEQ ID NOs: 2, 3, 4, 5, 7, 8, 9, 10, 12, 13, 14, 15, 17, 18,
19, 20, 22, 23, 24, 25, 27, 28, 29, 30, 32, 33, 34, 35, 37, 38, 39,
40, 45, 47, 49, 51, 53, 55, 57, 59, 61, 63, 65, 67, 69, 71, 73, 75,
77, 79, 81, 83, 85, 87, 89, 91, 93, 95, 97, 99, 101, 103, 106, 108,
110, 112, 114, 116, 118, 120, 122, 124, 126, 128, 130, 132, 134,
136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160,
162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186,
188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212,
214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 235, 237,
239, 241, 243, 245, 247, 249, 251, 253, 255, 257, 259, 261, 263,
265, 267, 269, 271, 273, 275, 277, 279, 281, 283, 285, 287, 289,
291, 293, 295, 297, 299, 301, 303, 305, 307, 309, 311, 313, 315,
317, 319, 321, 323, 325, 327, 329, 331, 333, 335, 337, 339, 341,
343, 345, 347, 349, 351, 353, 355, 357, 359, 361, 363, 365, 367,
369, 371, 373, 375, 377, 379, 381, 383, 385, 387, 389, 391, 393,
395, 397, 399, 401, 403, 405, 406, 407, 408, 409, 410, 411, 412,
413, 414, 415, 416, 417, 418, 419, 426, 427, 434, 435, 436, 437,
438, 439, 440, 441, 442, 446, 448, 449, 451, 452, 453, 454, 455,
456, 457, 458, 459, 460, 461, 462, 463 or 464; wherein such amino
acid sequences may comprise 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15,
20 or more conservative amino acid substitutions thereof. Exemplary
conservative substitutions are set forth in Table 1.
TABLE-US-00051 TABLE 1 Exemplary Conservative Amino Acid
Substitutions Original residue Conservative substitution Ala (A)
Gly; Ser Arg (R) Lys; His Asn (N) Gln; His Asp (D) Glu; Asn Cys (C)
Ser; Ala Gln (Q) Asn Glu (E) Asp; Gln Gly (G) Ala His (H) Asn; Gln
Ile (I) Leu; Val Leu (L) Ile; Val Lys (K) Arg; His Met (M) Leu;
Ile; Tyr Phe (F) Tyr; Met; Leu Pro (P) Ala Ser (S) Thr Thr (T) Ser
Trp (W) Tyr; Phe Tyr (Y) Trp; Phe Val (V) Ile; Leu
Function-conservative variants of the anti-LAG3 antibodies and
antigen-binding fragments thereof are also part of the present
invention. Any of the variants of the anti-LAG3 antibodies and
antigen-binding fragments thereof (as discussed herein) may be
"function-conservative variants". Such function-conservative
variants may, in some cases, also be characterized as
conservatively modified variants. "Function-conservative variants,"
as used herein, refers to variants of the anti-LAG3 antibodies or
antigen-binding fragments thereof in which one or more amino acid
residues (e.g., of 1, 2, 3, 4, 5 or 6 CDRs and/or of a V.sub.L
and/or of a V.sub.H) have been changed without significantly
altering one or more functional properties of the antibody or
fragment. In an embodiment of the invention, a
function-conservative variant anti-LAG3 antibody and
antigen-binding fragments thereof of the present invention (e.g.,
humanized antibodies such as antagonist humanized antibodies)
comprise a variant of an immunoglobulin chain (e.g., one or two
variant V.sub.Hs and/or one or more variant V.sub.Ls) and/or of a
CDR (e.g., 1, 2 or 3 variant CDR-Ls and/or 1, 2, or 3 variant
CDR-H) of any of those set forth herein, e.g., any of SEQ ID NOs:
2, 3, 4, 5, 7, 8, 9, 10, 12, 13, 14, 15, 17, 18, 19, 20, 22, 23,
24, 25, 27, 28, 29, 30, 32, 33, 34, 35, 37, 38, 39, 40, 45, 47, 49,
51, 53, 55, 57, 59, 61, 63, 65, 67, 69, 71, 73, 75, 77, 79, 81, 83,
85, 87, 89, 91, 93, 95, 97, 99, 101, 103, 106, 108, 110, 112, 114,
116, 118, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140,
142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166,
168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192,
194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218,
220, 222, 224, 226, 228, 230, 232, 234, 235, 237, 239, 241, 243,
245, 247, 249, 251, 253, 255, 257, 259, 261, 263, 265, 267, 269,
271, 273, 275, 277, 279, 281, 283, 285, 287, 289, 291, 293, 295,
297, 299, 301, 303, 305, 307, 309, 311, 313, 315, 317, 319, 321,
323, 325, 327, 329, 331, 333, 335, 337, 339, 341, 343, 345, 347,
349, 351, 353, 355, 357, 359, 361, 363, 365, 367, 369, 371, 373,
375, 377, 379, 381, 383, 385, 387, 389, 391, 393, 395, 397, 399,
401, 403, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415,
416, 417, 418, 419, 426, 427, 434, 435, 436, 437, 438, 439, 440,
441, 442, 446, 448, 449, 451, 452, 453, 454, 455, 456, 457, 458,
459, 460, 461, 462, 463 or 464; exhibiting one or more of the
following functional properties: Inhibits LAG3 binding to MHC class
II molecules, e.g., on Daudi cells; for example inhibits human
LAG3/MHC class II binding on Daudi cells with an IC.sub.50 of about
1.9-2.9 nM, e.g., 2.1 nM, 2.8 nM, 2.0 nM, 1.9 nM, 2.5 nM, 2.6 nM,
2.1 nM, 2.4 nM or 2.5 nM. (e.g., about 2.1-2.6 nM). Competes with
MEW class II molecules for LAG3 binding e.g., on Daudi cells; Binds
the extraloop of LAG3; Binds LAG3 with a K.sub.D of about
10.sup.-9M to about 2.times.10.sup.-12M affinity (e.g., as measured
by surface plasmon resonance or KinExA); for example binds human
LAG3 with a KD of about 2, 3, 6, 10 or 11 pM (e.g., 2-11 pM) and/or
binds cynomolgous monkey LAG3 with a KD of about 11, 12, 16 or 25
pM (e.g., 11-25 pM), e.g., by KinExA; Binds to native LAG3 on the
surface of activated CD4+ and/or CD8+ T-cells; for example, binds
human CD4+ T-cells expressing human LAG3 with an EC.sub.50 of about
39, 41 or 57 pM (e.g., about 39-57 pM); binds human CD8+ T-cells
expressing human LAG3 with an EC.sub.50 of about 33, 35 or 49 pM
(e.g., about 33-49 pM); binds cynomolgous monkey CD4+ T-cells
expressing cynomolgous monkey LAG3 with an EC.sub.50 of about 27,
30 or 35 pM (e.g., about 27-35 pM); binds cynomolgous monkey CD8+
T-cells expressing cynomolgous monkey LAG3 with an EC.sub.50 of
about 30, 31 or 41 pM (e.g., about 30-41 pM); for example wherein
the T-cells are isolated from blood; Binds to human and/or
cynomolgous monkey, e.g., Macaca fascicularis or Macaca mulatta
LAG3; Inhibits LAG3 homodimerization; Stimulates antigen-specific
T-cell production of IL-2, e.g., IL2 production from the 3A9 murine
T-cell hybridoma expressing human LAG3 with an EC.sub.50 of about
1.06-1.65 nM, 1.74-1.83 nM, 3.56-4.06 nM, 2.83-2.96 nM, 0.57-1.07
nM, 0.45-1.27 nM, 0.47-1.01 nM or 0.72-1.08 nM; labels tonsil
tissue; and/or enhances T-cell activation by anti-PD1 antibody such
as pembrolizumab, e.g., increases IL-2 production by T-cells; does
not label brain, heart, kidney, liver, lung, pancreas, and/or
pituitary tissue. binds to human LAG3 by contacting residues
QEGAPAQL (amino acids 35-42 of SEQ ID NO: 443) and RPARRADAGEYRAAVH
(amino acids 137-152 of SEQ ID NO: 443) and, optionally, residues
DERGRQRGDFSLW (amino acids 123-135 of SEQ ID NO: 443) of LAG3; or
residues SPTIPLQDL (amino acids 45-53 of SEQ ID NO: 443) and,
optionally DERGRQRGDFSL (amino acids 123-134 of SEQ ID NO: 443) of
LAG3; or residues HPLAPGPHPAAPSSWGPRPRRYTVL (amino acids 78-102 of
SEQ ID NO: 443) of LAG3; and/or by protecting hydrogens on the
amide backbone of such residues from exchange with a deuterium
(e.g., from D.sub.2O).
The present invention provides a method for making an antibody or
antigen-binding fragment thereof that binds specifically to LAG3
comprising administering, to a non-human host animal (e.g., mouse,
rabbit, camel, llama or rat), an effective amount of one or more
peptides comprising, consisting of or consisting essentially of an
amino acid sequence selected from the group consisting of QEGAPAQL
(amino acids 35-42 of SEQ ID NO: 443); RPARRADAGEYRAAVH (amino
acids 137-152 of SEQ ID NO: 443); DERGRQRGDFSLW (amino acids
123-135 of SEQ ID NO: 443); SPTIPLQDL (amino acids 45-53 of SEQ ID
NO: 443); DERGRQRGDFSL (amino acids 123-134 of SEQ ID NO: 443); and
HPLAPGPHPAAPSSWGPRPRRYTVL (amino acids 78-102 of SEQ ID NO: 443),
e.g., wherein the peptide is formulated with a pharmaceutically
acceptable carrier. Optionally, the antibody or fragment is
isolated from the host animal, e.g., from the serum or blood of the
host animal. Optionally, the host animal is administered more than
one dose of the peptide. Such isolated peptides are part of the
present invention, e.g., fused to an immunogen such as Keyhole
Limpet Hemocyanin (KLH), human serum albumin or bovine serum
albumin.
Sequence identity refers to the degree to which the amino acids of
two polypeptides are the same at equivalent positions when the two
sequences are optimally aligned. Sequence similarity includes
identical residues and nonidentical, biochemically related amino
acids. Biochemically related amino acids that share similar
properties and may be interchangeable are discussed above.
The following references relate to BLAST algorithms often used for
sequence analysis: BLAST ALGORITHMS: Altschul et al. (2005) FEBS J.
272(20): 5101-5109; Altschul, S. F., et al., (1990) J. Mol. Biol.
215:403-410; Gish, W., et al., (1993) Nature Genet. 3:266-272;
Madden, T. L., et al., (1996) Meth. Enzymol. 266:131-141; Altschul,
S. F., et al., (1997) Nucleic Acids Res. 25:3389-3402; Zhang, J.,
et al., (1997) Genome Res. 7:649-656; Wootton, J. C., et al.,
(1993) Comput. Chem. 17:149-163; Hancock, J. M. et al., (1994)
Comput. Appl. Biosci. 10:67-70; ALIGNMENT SCORING SYSTEMS: Dayhoff,
M. O., et al., "A model of evolutionary change in proteins." in
Atlas of Protein Sequence and Structure, (1978) vol. 5, suppl. 3.
M. O. Dayhoff (ed.), pp. 345-352, Natl. Biomed. Res. Found.,
Washington, D.C.; Schwartz, R. M., et al., "Matrices for detecting
distant relationships." in Atlas of Protein Sequence and Structure,
(1978) vol. 5, suppl. 3." M. O. Dayhoff (ed.), pp. 353-358, Natl.
Biomed. Res. Found., Washington, D.C.; Altschul, S. F., (1991) J.
Mol. Biol. 219:555-565; States, D. J., et al., (1991) Methods
3:66-70; Henikoff, S., et al., (1992) Proc. Natl. Acad. Sci. USA
89:10915-10919; Altschul, S. F., et al., (1993) J. Mol. Evol.
36:290-300; ALIGNMENT STATISTICS: Karlin, S., et al., (1990) Proc.
Natl. Acad. Sci. USA 87:2264-2268; Karlin, S., et al., (1993) Proc.
Natl. Acad. Sci. USA 90:5873-5877; Dembo, A., et al., (1994) Ann.
Prob. 22:2022-2039; and Altschul, S. F. "Evaluating the statistical
significance of multiple distinct local alignments." in Theoretical
and Computational Methods in Genome Research (S. Suhai, ed.),
(1997) pp. 1-14, Plenum, N.Y.
The anti-LAG3 antibodies or antigen-binding fragments thereof of
the present invention (e.g., humanized antibodies such as
antagonist humanized antibodies) can comprise one, two, three,
four, five, or six of the complementarity determining regions
(CDRs) of the immunoglobulin chains disclosed herein (wherein 1, 2,
3, 4, 5 or 6 of the CDRs are, optionally, variants of those set
forth herein). The one, two, three, four, five, or six CDRs may be
independently selected from the CDR sequences of the various
immunoglobulin chains disclosed herein. Alternatively, the one,
two, three, four, five, or six CDRs may be selected from the CDR
sequences of a single described antibody of the invention.
For example, the present invention includes anti-LAG3 antibodies
and antigen-binding fragments thereof as well as immunoglobulin
polypeptide chains that comprise: the 4A10 CDR-H1, CDR-H2 and
CDR-H3; the 4A10 CDR-L1, CDR-L2 and CDR-L3; the 11C9 CDR-H1, CDR-H2
and CDR-H3; the 11C9 CDR-L1, CDR-L2 and CDR-L3; the 19E8 CDR-H1,
CDR-H2 and CDR-H3; the 19E8 CDR-L1, CDR-L2 and CDR-L3; the 22D2
CDR-H1, CDR-H2 and CDR-H3; and/or the 22D2 CDR-L1, CDR-L2 and
CDR-L3; wherein the 4A10, 11C9, 19E8 and 22D2 CDRs may be derived
from the mouse or humanized 4A10, 11C9, 19E8 and 22D2
immunoglobulin chains, respectively, set forth herein (e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 or Ab9).
The anti-LAG3 antibodies or antigen-binding fragments thereof of
the present invention can comprise at least one antibody heavy
chain variable (V.sub.H) domain comprising one or more (e.g., 3) of
CDR-H1, CDR-H2 or CDR-H3 of 4A10 V.sub.H (e.g., SEQ ID NO: 2);
e.g., wherein the CDRs comprise the amino acid sequences set forth
in SEQ ID NOs: 3 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7,
8, 9 or 10 point mutations and/or point deletions), 4 (or a variant
thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations
and/or point deletions), and 5 (or a variant thereof having 1, 2,
3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point deletions),
respectively.
The anti-LAG3 antibodies or antigen-binding fragments thereof of
the present invention can comprise at least one antibody light
chain variable (V.sub.L) domain comprising one or more (e.g., 3) of
CDR-L1, CDR-L2 and CDR-L3 of the 4A10 V.sub.L (e.g., SEQ ID NO: 7);
e.g., wherein the CDRs comprise the amino acid sequences set forth
in SEQ ID NOs: 8 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7,
8, 9 or 10 point mutations and/or point deletions), 9 (or a variant
thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations
and/or point deletions) and 10 (or a variant thereof having 1, 2,
3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point deletions),
respectively.
The anti-LAG3 antibodies or antigen-binding fragments thereof of
the present invention can comprise at least one antibody heavy
chain variable (V.sub.H) domain comprising one or more (e.g., 3) of
CDR-H1, CDR-H2 or CDR-H3 of 19E8 V.sub.H (e.g., SEQ ID NO: 12);
e.g., wherein the CDRs comprise the amino acid sequences set forth
in SEQ ID NOs: 13 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7,
8, 9 or 10 point mutations and/or point deletions), 14 (or a
variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point
mutations and/or point deletions) and 15 (or a variant thereof
having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point
deletions), respectively.
The anti-LAG3 antibodies or antigen-binding fragments thereof of
the present invention can comprise at least one antibody light
chain variable (V.sub.L) domain comprising one or more (e.g., 3) of
CDR-L1, CDR-L2 and CDR-L3 of 19E8 V.sub.L (e.g., SEQ ID NO: 17);
e.g., wherein the CDRs comprise the amino acid sequences set forth
in SEQ ID NOs: 18 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7,
8, 9 or 10 point mutations and/or point deletions), 19 (or a
variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point
mutations and/or point deletions) and 20 (or a variant thereof
having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point
deletions), respectively.
The anti-LAG3 antibodies or antigen-binding fragments thereof of
the present invention can comprise at least one antibody heavy
chain variable (V.sub.H) domain comprising one or more (e.g., 3) of
CDR-H1, CDR-H2 or CDR-H3 of 11C9 V.sub.H (e.g., SEQ ID NO: 22);
e.g., wherein the CDRs comprise the amino acid sequences set forth
in SEQ ID NOs: 23 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7,
8, 9 or 10 point mutations and/or point deletions), 24 (or a
variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point
mutations and/or point deletions) and 25 (or a variant thereof
having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point
deletions), respectively.
The anti-LAG3 antibodies or antigen-binding fragments thereof of
the present invention can comprise at least one antibody light
chain variable (V.sub.L) domain comprising one or more (e.g., 3) of
CDR-L1, CDR-L2 and CDR-L3 of the 11C9 V.sub.L (e.g., SEQ ID NO:
27); e.g., wherein the CDRs comprise the amino acid sequences set
forth in SEQ ID NOs: 28 (or a variant thereof having 1, 2, 3, 4, 5,
6, 7, 8, 9 or 10 point mutations and/or point deletions), 29 (or a
variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point
mutations and/or point deletions) and 30 (or a variant thereof
having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point
deletions), respectively.
The anti-LAG3 antibodies or antigen-binding fragments thereof of
the present invention can comprise at least one antibody heavy
chain variable (V.sub.H) domain comprising one or more (e.g., 3) of
CDR-H1, CDR-H2 or CDR-H3 of 22D2 V.sub.H (e.g., SEQ ID NO: 32, 106,
108, 110, 112, 114, 116, 118, 120 or 122); e.g., wherein the CDRs
comprise the amino acid sequences set forth in SEQ ID NOs: 33 (or a
variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point
mutations and/or point deletions), 34, 446, 454, 455, 456, 457, or
458 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10
point mutations and/or point deletions) and 35 (or a variant
thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations
and/or point deletions), respectively.
The anti-LAG3 antibodies or antigen-binding fragments thereof of
the present invention can comprise at least one antibody light
chain variable (V.sub.L) domain comprising one or more (e.g., 3) of
CDR-L1, CDR-L2 and CDR-L3 of 22D2 V.sub.L (e.g., SEQ ID NO: 37 or
126); e.g., wherein the CDRs comprise the amino acid sequences set
forth in SEQ ID NOs: 38 (or a variant thereof having 1, 2, 3, 4, 5,
6, 7, 8, 9 or 10 point mutations and/or point deletions), 39 (or a
variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point
mutations and/or point deletions) and 40 (or a variant thereof
having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point
deletions), respectively.
The present invention provides an anti-LAG3 antibody or
antigen-binding fragment thereof that comprises: the 4A10 CDR-H1,
CDR-H2 and CDR-H3; and the 4A10 CDR-L1, CDR-L2 and CDR-L3; the 11C9
CDR-H1, CDR-H2 and CDR-H3; and the 11C9 CDR-L1, CDR-L2 and CDR-L3;
the 19E8 CDR-H1, CDR-H2 and CDR-H3; and the 19E8 CDR-L1, CDR-L2 and
CDR-L3; or the 22D2 CDR-H1, CDR-H2 and CDR-H3; and the 22D2 CDR-L1,
CDR-L2 and CDR-L3; wherein the 4A10, 11C9, 19E8 and 22D2 CDRs may
be derived from the mouse or humanized 4A10, 11C9, 19E8 and 22D2
immunoglobulin chains, respectively, set forth herein, and wherein,
optionally, 1, 2, 3, 4, 5 or 6 of the CDRs are variants of those
set forth herein.
The present invention provides an anti-LAG3 antibody or
antigen-binding fragment thereof that comprises an antibody light
chain variable (V.sub.L) domain comprising a CDR-L1, CDR-L2 and
CDR-L3 of the 4A10 V.sub.L (e.g., SEQ ID NOs: 8 (or a variant
thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations
and/or point deletions), 9 (or a variant thereof having 1, 2, 3, 4,
5, 6, 7, 8, 9 or 10 point mutations and/or point deletions) and 10
(or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point
mutations and/or point deletions)); and an antibody heavy chain
variable (V.sub.H) domain comprising a CDR-H1, CDR-H2 and CDR-H3 of
the 4A10 V.sub.H (e.g., SEQ ID NOs: 3 (or a variant thereof having
1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point
deletions), 4 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8,
9 or 10 point mutations and/or point deletions) and 5 (or a variant
thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations
and/or point deletions)).
In a further embodiment, an anti-LAG3 antibody or antigen-binding
fragment thereof comprises an antibody light chain variable
(V.sub.L) domain comprising a CDR-L1, CDR-L2 and CDR-L3 of the 19E8
V.sub.L (e.g., SEQ ID NOs: 18 (or a variant thereof having 1, 2, 3,
4, 5, 6, 7, 8, 9 or 10 point mutations and/or point deletions), 19
(or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point
mutations and/or point deletions) and 20 (or a variant thereof
having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point
deletions)); and an antibody heavy chain variable (V.sub.H) domain
comprising a CDR-H1, CDR-H2 and CDR-H3 of the 19E8 V.sub.H (e.g.,
SEQ ID NOs: 13 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8,
9 or 10 point mutations and/or point deletions), 14 (or a variant
thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations
and/or point deletions) and 15 (or a variant thereof having 1, 2,
3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point
deletions)).
In a further embodiment, an anti-LAG3 antibody or antigen-binding
fragment thereof comprises an antibody light chain variable
(V.sub.L) domain comprising a CDR-L1, CDR-L2 and CDR-L3 of the 11C9
V.sub.L (e.g., SEQ ID NOs: 28 (or a variant thereof having 1, 2, 3,
4, 5, 6, 7, 8, 9 or 10 point mutations and/or point deletions), 29
(or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point
mutations and/or point deletions) and 30 (or a variant thereof
having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point
deletions)); and an antibody heavy chain variable (V.sub.H) domain
comprising a CDR-H1, CDR-H2 and CDR-H3 of the 11C9 V.sub.H (e.g.,
SEQ ID NOs: 23 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8,
9 or 10 point mutations and/or point deletions), 24 (or a variant
thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations
and/or point deletions) and 25 (or a variant thereof having 1, 2,
3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point
deletions)).
In a further embodiment, an anti-LAG3 antibody or antigen-binding
fragment thereof comprises an antibody light chain variable
(V.sub.L) domain comprising a CDR-L1, CDR-L2 and CDR-L3 of the 22D2
V.sub.L (e.g., SEQ ID NOs: 38 (or a variant thereof having 1, 2, 3,
4, 5, 6, 7, 8, 9 or 10 point mutations and/or point deletions), 39
(or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point
mutations and/or point deletions) and 40 (or a variant thereof
having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point
deletions)); and an antibody heavy chain variable (V.sub.H) domain
comprising a CDR-H1, CDR-H2 and CDR-H3 of the 22D2 V.sub.H (e.g.,
SEQ ID NOs: 33 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8,
9 or 10 point mutations and/or point deletions), 34, 446, 454, 455,
456, 457 or 458 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7,
8, 9 or 10 point mutations and/or point deletions) and 35 (or a
variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point
mutations and/or point deletions)).
In a further embodiment, the antibody is a humanized antagonist
anti-LAG3 antibody. Examples of such humanized anti-LAG3 antibodies
include, but are not limited to, those comprising CDR-L1, CDR-L2
and CDR-L3 of 4A10; and CDR-H1, CDR-H2 and CDR-H3 of 4A10.
In a further embodiment, the antibody is a humanized antagonist
anti-LAG3 antibody. Examples of such humanized anti-LAG3 antibodies
include, but are not limited to, those comprising CDR-L1, CDR-L2
and CDR-L3 of 19E8; and CDR-H1, CDR-H2 and CDR-H3 of 19E8.
In a further embodiment, the antibody is a humanized antagonist
anti-LAG3 antibody. Examples of such humanized anti-LAG3 antibodies
include, but are not limited to, those comprising CDR-L1, CDR-L2
and CDR-L3 of 11C9; and CDR-H1, CDR-H2 and CDR-H3 of 11C9.
In a further embodiment, the antibody is a humanized antagonist
anti-LAG3 antibody. Examples of such humanized anti-LAG3 antibodies
include, but are not limited to, those comprising CDR-L1, CDR-L2
and CDR-L3 of 22D2; and CDR-H1, CDR-H2 and CDR-H3 of 22D2; for
example, Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 or Ab9.
The present invention provides an anti-LAG3 antibody or
antigen-binding fragment thereof or an immunoglobulin polypeptide
that comprises: the mature 4A10 V.sub.L immunoglobulin domain
and/or the mature 4A10 V.sub.H domain; the mature 19E8 V.sub.L
immunoglobulin domain and/or the mature 19E8 V.sub.H domain; the
mature 11C9 V.sub.L immunoglobulin domain and/or the mature 11C9
V.sub.H domain; and/or the mature 22D2 V.sub.L immunoglobulin
domain and/or the mature 22D2 V.sub.H domain; wherein the 4A10,
19E8, 11C9 and 22D2 V.sub.L or V.sub.H domain is a mouse or
humanized 4A10, 19E8, 11C9 and 22D2 V.sub.L or V.sub.H domain set
forth herein, and wherein, optionally, the V.sub.L and/or V.sub.H
is a variant of a V.sub.L or V.sub.H set forth herein (e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 or Ab9).
The present invention further provides an anti-LAG3 antibody or
antigen-binding fragment thereof that comprises the mature V.sub.L
domain of 4A10, 19E8, 11C9 or 22D2 wherein the V.sub.L domain
comprises the amino acid sequence of SEQ ID NO: 7, 17, 27, 37, 57,
59, 61, 63, 65, 101, 126, 130, 132, 136, 138, 208, 210, 224, 226,
228, 230, 232, 241, 257, 259, 261, 263, 351, 369, 371, 373, 375,
401, 403, 405, 426, 427, 450-453 or 459-461 or a variant
thereof.
The present invention further provides an anti-LAG3 antibody or
antigen-binding fragment thereof that comprises the mature V.sub.H
domain of 4A10, 19E8, 11C9 or 22D2 wherein the V.sub.H domain
comprises the amino acid sequence of SEQ ID NO: 2, 12, 22, 32, 45,
47, 49, 51, 53, 55, 67, 69, 71, 73, 75, 77, 79, 81, 83, 85, 87, 89,
91, 93, 95, 97, 99, 103, 106, 108, 110, 112, 114, 116, 118, 120,
122, 124, 128, 134, 140, 142, 144, 146, 148, 150, 152, 154, 156,
158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182,
184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 212,
214, 216, 218, 220, 222, 234, 235, 237, 239, 243, 245, 247, 249,
251, 253, 255, 265, 267, 269, 271, 273, 275, 277, 279, 281, 283,
285, 287, 289, 291, 293, 295, 297, 299, 301, 303, 305, 307, 309,
311, 313, 315, 317, 319, 321, 323, 325, 327, 329, 331, 333, 335,
337, 339, 341, 343, 345, 347, 349, 353, 355, 357, 359, 361, 363,
365, 367, 377, 379, 381, 383, 385, 387, 389, 391, 393, 395, 397,
399, 406-419, 434-442, 448, 449, 462, 463 or 464; or a variant
thereof.
The present invention further provides an anti-LAG3 antibody or
antigen-binding fragment thereof that comprises the mature V.sub.L
domain of 4A10 (e.g., amino acids 21-132 of SEQ ID NO: 7 or a
variant thereof) and the mature V.sub.H domain of 4A10 (e.g., amino
acids 20-136 of SEQ ID NO: 2 or a variant thereof).
The present invention further provides an anti-LAG3 antibody or
antigen-binding fragment thereof that comprises the mature V.sub.L
domain of 19E8 (e.g., amino acids 21-128 of SEQ ID NO: 17 or a
variant thereof) and the mature V.sub.H domain of 19E8 (e.g., amino
acids 20-138 of SEQ ID NO: 12 or a variant thereof).
The present invention further provides an anti-LAG3 antibody or
antigen-binding fragment thereof that comprises the mature V.sub.L
domain of 11C9 (e.g., amino acids 21-128 of SEQ ID NO: 27 or a
variant thereof) and the mature V.sub.H domain of 11C9 (e.g., amino
acids 20-142 of SEQ ID NO: 22 or a variant thereof).
The present invention further provides an anti-LAG3 antibody or
antigen-binding fragment thereof that comprises the mature V.sub.L
domain of 22D2 (e.g., amino acids 21-131 of SEQ ID NO: 37 or 126 or
a variant thereof) and the mature V.sub.H domain of 22D2 (e.g.,
amino acids 21-138 or 21-131 of SEQ ID NO: 32, 106, 108, 110, 112,
114, 116, 118, 120 or 122 or a variant thereof).
The invention also provides polypeptides comprising the amino acid
sequence set forth in SEQ ID NO: 2 or amino acids 20-136 thereof or
a variant thereof; or any polynucleotide encoding such a
polypeptide.
The invention also provides polypeptides comprising the amino acid
sequence set forth in SEQ ID NO: 7 or amino acids 21-132 thereof or
a variant thereof; or any polynucleotide encoding such a
polypeptide.
The invention also provides polypeptides comprising the amino acid
sequence set forth in SEQ ID NO: 12 or amino acids 20-138 thereof
or a variant thereof; or any polynucleotide encoding such a
polypeptide.
The invention also provides polypeptides comprising the amino acid
sequence set forth in SEQ ID NO: 17 or amino acids 21-128 thereof
or a variant thereof; or any polynucleotide encoding such a
polypeptide.
The invention also provides polypeptides comprising the amino acid
sequence set forth in SEQ ID NO: 22 or amino acids 20-142 thereof
or a variant thereof; or any polynucleotide encoding such a
polypeptide.
The invention also provides polypeptides comprising the amino acid
sequence set forth in SEQ ID NO: 27 or amino acids 21-128 thereof
or a variant thereof; or any polynucleotide encoding such a
polypeptide.
The invention also provides polypeptides comprising the amino acid
sequence set forth in SEQ ID NO: 32, 106, 108, 110, 112, 114, 116,
118, 120 or 122 or a mature fragment thereof, e.g., comprising
amino acids 20-138 or 20-131 thereof; or a variant thereof; or any
polynucleotide encoding such a polypeptide.
The invention also provides polypeptides comprising the amino acid
sequence set forth in SEQ ID NO: 37 or 126 or a mature fragment
thereof, e.g., comprising amino acids 21-131 thereof or a variant
thereof; or any polynucleotide encoding such a polypeptide.
The invention also provides polypeptides (e.g., a humanized
immunoglobulin chain) comprising the CDR-H1, CDR-H2, and CDR-H3 of
a V.sub.H domain comprising SEQ ID NO: 2 (e.g., SEQ ID NOs: 3-5);
or any polynucleotide encoding such a polypeptide. Optionally, 1, 2
or 3 of such CDRs are variants of the sequence set forth
herein.
The invention also provides polypeptides (e.g., a humanized
immunoglobulin chain) comprising the CDR-L1, CDR-L2, and CDR-L3 of
a V.sub.L domain comprising SEQ ID NO: 7 (e.g., SEQ ID NOs: 8-10);
or any polynucleotide encoding such a polypeptide. Optionally, 1, 2
or 3 of such CDRs are variants of the sequence set forth
herein.
The invention also provides polypeptides (e.g., a humanized
immunoglobulin chain) comprising the CDR-H1, CDR-H2, and CDR-H3 of
a V.sub.H domain comprising SEQ ID NO: 12 (e.g., SEQ ID NOs:
13-15); or any polynucleotide encoding such a polypeptide.
Optionally, 1, 2 or 3 of such CDRs are variants of the sequence set
forth herein.
The invention also provides polypeptides (e.g., a humanized
immunoglobulin chain) comprising the CDR-L1, CDR-L2, and CDR-L3 of
a V.sub.L domain comprising SEQ ID NO: 17 (e.g., SEQ ID NOs:
18-20); or any polynucleotide encoding such a polypeptide.
Optionally, 1, 2 or 3 of such CDRs are variants of the sequence set
forth herein.
The invention also provides polypeptides (e.g., a humanized
immunoglobulin chain) comprising the CDR-H1, CDR-H2, and CDR-H3 of
a V.sub.H domain comprising SEQ ID NO: 22 (e.g., SEQ ID NOs:
23-25); or any polynucleotide encoding such a polypeptide.
Optionally, 1, 2 or 3 of such CDRs are variants of the sequence set
forth herein.
The invention also provides polypeptides (e.g., a humanized
immunoglobulin chain) comprising the CDR-L1, CDR-L2, and CDR-L3 of
a V.sub.L domain comprising SEQ ID NO: 27 (e.g., SEQ ID NOs:
28-30); or any polynucleotide encoding such a polypeptide.
Optionally, 1, 2 or 3 of such CDRs are variants of the sequence set
forth herein.
The invention also provides polypeptides (e.g., a humanized
immunoglobulin chain) comprising the CDR-H1, CDR-H2, and CDR-H3 of
a V.sub.H domain comprising SEQ ID NO: 32, 106, 108, 110, 112, 114,
116, 118, 120 or 122 (e.g., SEQ ID NOs: 33, 34 (or 446, 454, 455,
456, 457 or 458) or 35); or any polynucleotide encoding such a
polypeptide. Optionally, 1, 2 or 3 of such CDRs are variants of the
sequence set forth herein.
The invention also provides polypeptides (e.g., a humanized
immunoglobulin chain) comprising the CDR-L1, CDR-L2, and CDR-L3 of
a V.sub.L domain comprising SEQ ID NO: 37 or 126 (e.g., SEQ ID NOs:
38-40); or any polynucleotide encoding such a polypeptide.
Optionally, 1, 2 or 3 of such CDRs are variants of the sequence set
forth herein.
The present invention includes crystalline compositions of the
anti-LAG3 antibodies and antigen-binding fragments thereof of the
present invention.
Polynucleotides
The present invention further comprises the polynucleotides
encoding any of the polypeptides or immunoglobulin chains of
anti-LAG3 antibodies and antigen-binding fragments thereof
disclosed herein (including variants of the amino acid chains
specifically set forth herein). For example, the present invention
includes the polynucleotides described in SEQ ID NOs: 1, 6, 11, 16,
21, 26, 31, 36, 46, 48, 50, 52, 54, 56, 56, 58, 60, 62, 64, 66, 68,
70, 72, 74, 76, 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100,
102, 104, 105, 107, 109, 111, 113, 115, 117, 119, 121, 123, 125,
127, 129, 131, 133, 135, 137, 139, 141, 143, 145, 147, 149, 151,
153, 155, 157, 159, 161, 163, 165, 167, 169, 171, 173, 175, 177,
179, 181, 183, 185, 187, 189, 191, 193, 195, 197, 199, 201, 203,
205, 207, 209, 211, 213, 215, 217, 219, 221, 223, 225, 227, 229,
231, 233, 236, 238, 240, 242, 244, 246, 248, 250, 252, 254, 256,
258, 260, 262, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282,
284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308,
310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332, 334,
336, 338, 340, 342, 344, 346, 348, 350, 352, 354, 356, 358, 360,
362, 364, 366, 368, 370, 372, 374, 376, 378, 380, 382, 384, 386,
388, 390, 392, 394, 396, 398, 400, 402 or 404 and variants thereof
(e.g., comprising nucleotide sequences having at least 70%, 80%,
90%, 95% or 99% BLAST sequence identity to such nucleotide
sequences (as discussed above)); and polynucleotides encoding the
amino acids described therein, e.g., in SEQ ID NOs: 2, 3, 4, 5, 7,
8, 9, 10, 12, 13, 14, 15, 17, 18, 19, 20, 22, 23, 24, 25, 27, 28,
29, 30, 32, 33, 34, 35, 37, 38, 39, 40, 45, 47, 49, 51, 53, 55, 57,
59, 61, 63, 65, 67, 69, 71, 73, 75, 77, 79, 81, 83, 85, 87, 89, 91,
93, 95, 97, 99, 101, 103, 106, 108, 110, 112, 114, 116, 118, 120,
122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146,
148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172,
174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198,
200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224,
226, 228, 230, 232, 234, 235, 237, 239, 241, 243, 245, 247, 249,
251, 253, 255, 257, 259, 261, 263, 265, 267, 269, 271, 273, 275,
277, 279, 281, 283, 285, 287, 289, 291, 293, 295, 297, 299, 301,
303, 305, 307, 309, 311, 313, 315, 317, 319, 321, 323, 325, 327,
329, 331, 333, 335, 337, 339, 341, 343, 345, 347, 349, 351, 353,
355, 357, 359, 361, 363, 365, 367, 369, 371, 373, 375, 377, 379,
381, 383, 385, 387, 389, 391, 393, 395, 397, 399, 401, 403, 405,
406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418,
419, 426, 427, 434, 435, 436, 437, 438, 439, 440, 441, 442, 446,
448, 449, 451, 452, 453, 454, 455, 456, 457, 458, 459, 460, 461,
462, 463 or 464. The scope of the present invention also includes
variant polynucleotides that hybridize to any of such
polynucleotides.
Moreover, the present invention includes anti-LAG3 antibodies and
antigen-binding fragments thereof comprising immunoglobulin heavy
and light chains (e.g., variable regions thereof) and/or heavy and
light chain CDRs encoded by the polynucleotides set forth
herein.
For example, the present invention includes anti-LAG3 antibodies
and antigen-binding fragments thereof comprising a heavy chain
immunoglobulin encoded by a polynucleotide comprising the
nucleotide sequence set forth in SEQ ID NO: 107 (or encoding a
variable domain thereof) and a light chain immunoglobulin encoded
by the nucleotide sequence set forth in SEQ ID NO: 125 (or encoding
a variable domain thereof). For example, the present invention also
includes anti-LAG3 antibodies and antigen-binding fragments thereof
comprising a heavy chain immunoglobulin encoded by a polynucleotide
comprising the nucleotide sequence set forth in SEQ ID NO: 115 (or
encoding a variable domain thereof) and a light chain
immunoglobulin encoded by the nucleotide sequence set forth in SEQ
ID NO: 125 (or encoding a variable domain thereof).
The present invention provides polynucleotide encoding the 4A10
V.sub.L or a mature fragment thereof; 4A10 V.sub.H or a mature
fragment thereof; 19E8 V.sub.L or a mature fragment thereof; 19E8
V.sub.H or a mature fragment thereof; 11C9 V.sub.L or a mature
fragment thereof; 11C9 V.sub.H or a mature fragment thereof; 22D2
V.sub.L or a mature fragment thereof; and/or 22D2 V.sub.H or a
mature fragment thereof; wherein the 4A10, 19E8, 11C9 and 22D2
V.sub.L or V.sub.H domain is a mouse or humanized 4A10, 19E8, 11C9
and 22D2 V.sub.L or V.sub.H domain set forth herein, and wherein,
optionally, the V.sub.L and/or V.sub.H is a variant of a V.sub.L or
V.sub.H set forth herein.
The invention also provides polynucleotide comprising the
nucleotide sequence set forth in SEQ ID NO: 1 or nucleotide 58-408
thereof; or a variant thereof.
The invention also provides polynucleotide comprising the
nucleotide sequence set forth in SEQ ID NO: 6 or nucleotide 61-396
thereof; or a variant thereof.
The invention also provides polynucleotide comprising the
nucleotide sequence set forth in SEQ ID NO:11 or nucleotide 58-414
thereof; or a variant thereof.
The invention also provides polynucleotides comprising the
nucleotide sequence set forth in SEQ ID NO: 16 or nucleotide 61-384
thereof; or a variant thereof.
The invention also provides polynucleotides comprising the
nucleotide sequence set forth in SEQ ID NO: 21 or nucleotide 58-426
thereof; or a variant thereof.
The invention also provides polynucleotides comprising the
nucleotide sequence set forth in SEQ ID NO: 26 or nucleotide 61-384
thereof; or a variant thereof.
The invention also provides polynucleotides comprising the
nucleotide sequence set forth in SEQ ID NO: 31 or nucleotide 61-447
thereof; or a variant thereof.
The invention also provides polynucleotides comprising the
nucleotide sequence set forth in SEQ ID NO: 36 or nucleotide 61-547
thereof; or a variant thereof.
Variant polynucleotides set forth herein include those that
hybridize under low, moderate or high stringency conditions to the
polynucleotides set forth herein or to polynucleotides that encode
the polypeptides set forth herein, and encode immunoglobulin chains
of anti-LAG3 antibodies or antigen-binding fragments thereof which
maintain the ability to specifically bind to LAG3 (human and/or
cynomolgous monkey, e.g., Macaca fascicularis or Macaca mulatta). A
first polynucleotide molecule is "hybridizable" to a second
polynucleotide molecule when a single stranded form of the first
polynucleotide molecule can anneal to the second polynucleotide
molecule under the appropriate conditions of temperature and
solution ionic strength (see Sambrook, et al., supra). The
conditions of temperature and ionic strength determine the
"stringency" of the hybridization. Typical low stringency
hybridization conditions include 55.degree. C., 5.times. SSC, 0.1%
SDS and no formamide; or 30% formamide, 5.times. SSC, 0.5% SDS at
42.degree. C. Typical moderate stringency hybridization conditions
are 40% formamide, with 5.times. or 6.times. SSC and 0.1% SDS at
42.degree. C. High stringency hybridization conditions are 50%
formamide, 5.times. or 6.times. SSC at 42.degree. C. or,
optionally, at a higher temperature (e.g., 57.degree. C.,
59.degree. C., 60.degree. C., 62.degree. C., 63.degree. C.,
65.degree. C. or 68.degree. C.). In general, SSC is 0.15M NaCl and
0.015M Na-citrate. Hybridization requires that the two
polynucleotide contain complementary sequences, although, depending
on the stringency of the hybridization, mismatches between bases
are possible. The appropriate stringency for hybridizing
polynucleotides depends on the length of the polynucleotides and
the degree of complementation, variables well known in the art. The
greater the degree of similarity or homology between two nucleotide
sequences, the higher the stringency under which the nucleic acids
may hybridize. For hybrids of greater than 100 nucleotides in
length, equations for calculating the melting temperature have been
derived (see Sambrook, et al., supra, 9.50-9.51). For hybridization
with shorter polynucleotides, e.g., oligonucleotides, the position
of mismatches becomes more important, and the length of the
oligonucleotide determines its specificity (see Sambrook, et al.,
supra, 11.7-11.8).
In another embodiment of the invention, an polynucleotide, for
example DNA, encoding the immunoglobulin polypeptide chains of the
anti-LAG3 antibodies or antigen-binding fragments set forth herein
forms part of the present invention. In one embodiment, the
polynucleotide encodes at least one mature immunoglobulin
polypeptide light chain variable (V.sub.L) domain and at least one
mature immunoglobulin polypeptide heavy chain variable (V.sub.H)
domain, wherein the V.sub.L domain comprises a CDR-L1, CDR-L2 and
CDR-L3 having a sequence selected from SEQ ID NOs: 8-10, 18-20
28-30 and 38-40, and the V.sub.H domain comprises CDR-H1, CDR-H2
and CDR-H3 having a sequence selected from SEQ ID NOs: 3-5, 13-15,
23-25 and 33-35. In one embodiment, the nucleic acid encodes the
4A10, 11C9, 19E8 or 22D2 mature light chain variable region and/or
the 4A10, 11C9, 19E8 or 22D2 mature heavy chain variable region
sequences. In some embodiments of the invention, the polynucleotide
encodes both a light chain and a heavy chain on a single
polynucleotide molecule, and, in other embodiments of the
invention, the light and heavy chains are encoded on separate
polynucleotide molecules, e.g., in separate or common host cells.
In another embodiment the polynucleotides further encodes a signal
sequence.
In one embodiment of the invention, the polynucleotide encodes a
mature immunoglobulin light chain variable (V.sub.L) domain
comprising the CDR-L1, CDR-L2 and CDR-L3 of SEQ ID NO: 7. Variants
of such polynucleotides are also part of the present invention.
In one embodiment of the invention, the polynucleotide encodes a
mature immunoglobulin light chain variable (V.sub.L) domain
comprising the CDR-L1, CDR-L2 and CDR-L3 of SEQ ID NO: 17. Variants
of such polynucleotides are also part of the present invention.
In one embodiment of the invention, the polynucleotide encodes a
mature immunoglobulin light chain variable (V.sub.L) domain
comprising the CDR-L1, CDR-L2 and CDR-L3 of SEQ ID NO: 27. Variants
of such polynucleotides are also part of the present invention.
In one embodiment of the invention, the polynucleotide encodes a
mature immunoglobulin light chain variable (V.sub.L) domain
comprising the CDR-L1, CDR-L2 and CDR-L3 of SEQ ID NO: 37 or 126.
Variants of such polynucleotides are also part of the present
invention.
In one embodiment of the invention, the polynucleotide encodes a
mature immunoglobulin heavy chain variable (V.sub.H) domain
comprising the CDR-H1, CDR-H2 and CDR-H3 of SEQ ID NO: 2. Variants
of such polynucleotides are also part of the present invention.
In one embodiment of the invention, the polynucleotide encodes a
mature immunoglobulin heavy chain variable (V.sub.H) domain
comprising the CDR-H1, CDR-H2 and CDR-H3 of SEQ ID NO: 12. Variants
of such polynucleotides are also part of the present invention.
In one embodiment of the invention, the polynucleotide encodes a
mature immunoglobulin heavy chain variable (V.sub.H) domain
comprising the CDR-H1, CDR-H2 and CDR-H3 of SEQ ID NO: 22. Variants
of such polynucleotides are also part of the present invention.
In one embodiment of the invention, the polynucleotide encodes a
mature immunoglobulin heavy chain variable (V.sub.H) domain
comprising the CDR-H1, CDR-H2 and CDR-H3 of SEQ ID NO: 32, 106,
108, 110, 112, 114, 116, 118, 120 or 122. Variants of such
polynucleotides are also part of the present invention.
In one embodiment of the invention, the polynucleotide encodes the
immunoglobulin light chain variable (V.sub.L) domain of SEQ ID NO:
7, 17, 27 and/or 37. Variants of such polynucleotides are also part
of the present invention.
In one embodiment of the invention, the polynucleotide encodes the
immunoglobulin heavy chain variable (V.sub.H) domain of SEQ ID NO:
2, 12, 22, 32, 106, 108, 110, 112, 114, 116, 118, 120 and/or 122.
Variants of such polynucleotides are also part of the present
invention.
This present invention also provides vectors, e.g., expression
vectors, such as plasmids, comprising the polynucleotides of the
invention (sequences set forth herein and variants thereof, e.g.,
SEQ ID NO: 125, 105, 107, 109, 111, 113, 115, 117, 119 and/or 121),
wherein the polynucleotide is operably linked to control sequences
that are recognized by a host cell when the host cell is
transfected with the vector. Also provided are host cells
comprising a polynucleotide (e.g., integrated into the genome,
e.g., a chromosome, of the host cell) or vector of the present
invention and methods for producing the antibody or antigen-binding
fragment thereof or polypeptide disclosed herein comprising
culturing a host cell harboring an expression vector or
polynucleotide encoding the immunoglobulin chains of the antibody
or antigen-binding fragment thereof in culture medium, and
isolating the antigen or antigen-binding fragment thereof from the
host cell or culture medium.
Binding Affinity
By way of example, and not limitation, the anti-LAG3 antibodies and
antigen-binding fragments thereof disclosed herein bind human
and/or cynomolgous monkey, e.g., Macaca fascicularis or Macaca
mulatta LAG3, e.g., with a K.sub.D value of at least about 100 nM
(1.times.10.sup.-7M); at least about 10 nM; or at least about 1 nM.
In further embodiments, the antibodies have K.sub.D values of at
least about 200 pM (2.times.10.sup.-10M), 100 pM, 50 pM, 20 pM, 10
pM, 5 pM or even 2 pM. For example, the K.sub.D is about
2.77.times.10.sup.-12 M, 1.47.times.10.sup.-11 M,
1.47.times.10.sup.-09M, or 9.03.times.10.sup.-11 M; or a higher
affinity. In an embodiment of the invention, the K.sub.D is as
measured in a KinExA assay or similar kinetic exclusion assay. See
e.g., Darling et al. Assay and Drug Dev. Tech. 2(6): 647-657
(2004).
Methods of Making Antibodies and Antigen-binding Fragments
Thereof
Hybridoma cells that produce parental (e.g., mouse) monoclonal
anti-LAG3 antibodies or antigen-binding fragments thereof discussed
herein may be produced by methods which are commonly known in the
art. Such isolated hybridomas are part of the present invention.
These methods include, but are not limited to, the hybridoma
technique originally developed by Kohler, et al., (1975) (Nature
256:495-497), as well as the trioma technique (Hering, et al.,
(1988) Biomed. Biochim. Acta. 47:211-216 and Hagiwara, et al.,
(1993) Hum. Antibod. Hybridomas 4:15), the human B-cell hybridoma
technique (Kozbor, et al., (1983) Immunology Today 4:72 and Cote,
et al., (1983) Proc. Natl. Acad. Sci. U.S.A 80:2026-2030), the
EBV-hybridoma technique (Cole, et al., in Monoclonal Antibodies and
Cancer Therapy, Alan R. Liss, Inc., pp. 77-96, 1985), and electric
field based electrofusion using a Cyto Pulse large chamber cull
fusion electroporator (Cyto Pulse Sciences, Inc., Glen Burnie,
Md.). Preferably, mouse splenocytes are isolated and fused with PEG
or by electrofusion to a mouse myeloma cell line based upon
standard protocols. The resulting hybridomas may then be screened
for the production of antigen-specific antibodies. For example,
single cell suspensions of splenic lymphocytes from immunized mice
may by fused to one-sixth the number of P3.times.63-Ag8.653
nonsecreting mouse myeloma cells (ATCC, CRL 1580) with 50% PEG.
Cells may be plated at approximately 2.times.10.sup.5 cells/mL in a
flat bottom microtiter plate, followed by a two week incubation in
selective medium containing 20% fetal Clone Serum, 18% "653"
conditioned media, 5% origen (IGEN), 4 mM L-glutamine, 1 mM
L-glutamine, 1 mM sodium pyruvate, 5 mM HEPES, 0.055 mM
2-mercaptoethanol, 50 units/ml penicillin, 50 mg/ml streptomycin,
50 mg/ml gentamycin and 1.times. HAT (Sigma; the HAT is added 24
hours after the fusion). After two weeks, cells may be cultured in
medium in which the HAT is replaced with HT. Individual wells may
then be screened by ELISA for anti-LAG3 monoclonal IgG antibodies.
Once extensive hybridoma growth occurs, medium can be observed
usually after 10-14 days. The antibody secreting hybridomas may be
replated, screened again, and if still positive for human IgG,
anti-LAG3 monoclonal antibodies, can be subcloned at least twice by
limiting dilution. The stable subclones may then be cultured in
vitro to generate small amounts of antibody in tissue culture
medium for characterization.
Thus, the present invention includes methods for making an
anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention comprising culturing a hybridoma cell that
expresses the antibody or fragment under condition favorable to
such expression and, optionally, isolating the antibody or fragment
from the hybridoma.
The anti-LAG3 antibodies disclosed herein may also be produced
recombinantly (e.g., in an E. coli/T7 expression system). In this
embodiment, nucleic acids encoding the anti-LAG3 antibody
immunoglobulin molecules of the invention (e.g., V.sub.H or
V.sub.L; e.g., any one or more of SEQ ID NO: 125, 105, 107, 109,
111, 113, 115, 117, 119 and/or 121) may be inserted into a
pET-based plasmid and expressed in the E. coli/T7 system. For
example, the present invention includes methods for expressing an
antibody or antigen-binding fragment thereof or immunoglobulin
chain thereof in a host cell (e.g., bacterial host cell such as E.
coli such as BL21 or BL21DE3) comprising expressing T7 RNA
polymerase in the cell which also includes a polynucleotide
encoding an immunoglobulin chain that is operably linked to a T7
promoter. For example, in an embodiment of the invention, a
bacterial host cell, such as a E. coli, includes a polynucleotide
encoding the T7 RNA polymerase gene operably linked to a lac
promoter and expression of the polymerase and the chain is induced
by incubation of the host cell with IPTG
(isopropyl-beta-D-thiogalactopyranoside).
There are several methods by which to produce recombinant
antibodies which are known in the art. One example of a method for
recombinant production of antibodies is disclosed in U.S. Pat. No.
4,816,567.
Transformation can be by any known method for introducing
polynucleotides into a host cell. Methods for introduction of
heterologous polynucleotides into mammalian cells are well known in
the art and include dextran-mediated transfection, calcium
phosphate precipitation, polybrene-mediated transfection,
protoplast fusion, electroporation, encapsulation of the
polynucleotide(s) in liposomes, biolistic injection and direct
microinjection of the DNA into nuclei. In addition, nucleic acid
molecules may be introduced into mammalian cells by viral vectors.
Methods of transforming cells are well known in the art. See, for
example, U.S. Pat. Nos. 4,399,216; 4,912,040; 4,740,461 and
4,959,455.
Thus, the present invention includes recombinant methods for making
an anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention, or an immunoglobulin chain thereof, comprising
(i) introducing a polynucleotide (e.g., any one or more of SEQ ID
NO: 125, 105, 107, 109, 111, 113, 115, 117, 119 and/or 121)
encoding one or more immunoglobulin chains of the antibody or
fragment (e.g., heavy chain immunoglobulin of 4A10, 19E8, 11C9
and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or
Ab9 and/or light chain immunoglobulin of 4A10, 19E8, 11C9 and/or
22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9), for
example, wherein the polynucleotide is in a vector and/or is
operably linked to a promoter; (ii) culturing the host cell (e.g.,
CHO or Pichia or Pichia pastoris) under condition favorable to
expression of the polynucleotide and, (iii) optionally, isolating
the antibody or fragment or chain from the host cell and/or medium
in which the host cell is grown. When making an antibody or
antigen-binding fragment comprising more than one immunoglobulin
chain, e.g., an antibody that comprises two heavy immunoglobulin
chains and two light immunoglobulin chains, co-expression of the
chains in a single host cell leads to association of the chains,
e.g., in the cell or on the cell surface or outside the cell if
such chains are secreted, so as to form the antibody or
antigen-binding fragment molecule. The methods include those
wherein only a heavy immunoglobulin chain or only a light
immunoglobulin chain (e.g., any of those discussed herein including
mature fragments and/or variable domains thereof) is expressed.
Such chains are useful, for example, as intermediates in the
expression of an antibody or antigen-binding fragment that includes
such a chain. For example, the present invention also includes
anti-LAG3 antibodies and antigen-binding fragments thereof
comprising a heavy chain immunoglobulin (or variable domain thereof
or comprising the CDRs thereof) encoded by a polynucleotide
comprising the nucleotide sequence set forth in SEQ ID NO: 115 (or
encoding a variable domain thereof) and a light chain
immunoglobulin (or variable domain thereof or comprising the CDRs
thereof) encoded by the nucleotide sequence set forth in SEQ ID NO:
125 (or encoding a variable domain thereof) which are the product
of such production methods, and, optionally, the purification
methods set forth herein.
Anti-LAG3 antibodies can also be synthesized by any of the methods
set forth in U.S. Pat. No. 6,331,415.
Eukaryotic and prokaryotic host cells, including mammalian cells as
hosts for expression of the anti-LAG3 antibodies or fragments or
immunoglobulin chains disclosed herein are well known in the art
and include many immortalized cell lines available from the
American Type Culture Collection (ATCC). These include, inter alia,
Chinese hamster ovary (CHO) cells, NSO, SP2 cells, HeLa cells, baby
hamster kidney (BHK) cells, monkey kidney cells (COS), human
hepatocellular carcinoma cells (e.g., Hep G2), A549 cells, 3T3
cells, HEK-293 cells and a number of other cell lines. Mammalian
host cells include human, mouse, rat, dog, monkey, pig, goat,
bovine, horse and hamster cells. Cell lines of particular
preference are selected through determining which cell lines have
high expression levels. Other cell lines that may be used are
insect cell lines (e.g., Spodoptera frugiperda or Trichoplusia ni),
amphibian cells, bacterial cells, plant cells and fungal cells.
Fungal cells include yeast and filamentous fungus cells including,
for example, Pichia pastoris, Pichia finlandica, Pichia
trehalophila, Pichia koclamae, Pichia membranaefaciens, Pichia
minuta (Ogataea minuta, Pichia lindneri), Pichia opuntiae, Pichia
thermotolerans, Pichia salictaria, Pichia guercuum, Pichia pijperi,
Pichia stiptis, Pichia methanolica, Pichia sp., Saccharomyces
cerevisiae, Saccharomyces sp., Hansenula polymorpha, Kluyveromyces
sp., Kluyveromyces lactis, Candida albicans, Aspergillus nidulans,
Aspergillus niger, Aspergillus oryzae, Trichoderma reesei,
Chrysosporium lucknowense, Fusarium sp., Fusarium gramineum,
Fusarium venenatum, Physcomitrella patens and Neurospora crassa.
Pichia sp., any Saccharomyces sp., Hansenula polymorpha, any
Kluyveromyces sp., Candida albicans, any Aspergillus sp.,
Trichoderma reesei, Chrysosporium lucknowense, any Fusarium sp.,
Yarrowia lipolytica, and Neurospora crassa.
Further, expression of antibodies and antigen-binding fragments
thereof and immunoglobulin chains of the invention (or other
moieties therefrom) from production cell lines can be enhanced
using a number of known techniques. For example, the glutamine
synthetase gene expression system (the GS system) is a common
approach for enhancing expression under certain conditions. The GS
system is discussed in whole or part in connection with European
Patent Nos. 0 216 846, 0 256 055, and 0 323 997 and European Patent
Application No. 89303964.4. Thus, in an embodiment of the
invention, the mammalian host cells (e.g., CHO) lack a glutamine
synthetase gene and are grown in the absence of glutamine in the
medium wherein, however, the polynucleotide encoding the
immunoglobulin chain comprises a glutamine synthetase gene which
complements the lack of the gene in the host cell.
The present invention includes methods for purifying an anti-LAG3
antibody or antigen-binding fragment thereof of the present
invention comprising introducing a sample (e.g., culture medium,
cell lysate or cell lysate fraction, e.g., a soluble fraction of
the lysate) comprising the antibody or fragment to a purification
medium (e.g., cation-exchange medium, anion-exchange medium,
hydrophobic exchange medium, affinity purification medium (e.g.,
protein-A, protein-G, protein-A/G, protein-L)) and either
collecting purified antibody or fragment from the flow-through
fraction of said sample that does not bind to the medium; or,
discarding the flow-through fraction and eluting bound antibody or
fragment from the medium and collecting the eluate. In an
embodiment of the invention, the medium is in a column to which the
sample is applied. In an embodiment of the invention, the
purification method is conducted following recombinant expression
of the antibody or fragment in a host cell, e.g., wherein the host
cell is first lysed and, optionally, the lysate is purified of
insoluble materials prior to purification on a medium; or wherein
the antibody or fragment is secreted into the culture medium by the
host cell and the medium or a fraction thereof is applied to the
purification medium.
In general, glycoproteins produced in a particular cell line or
transgenic animal will have a glycosylation pattern that is
characteristic for glycoproteins produced in the cell line or
transgenic animal. Therefore, the particular glycosylation pattern
of an antibody will depend on the particular cell line or
transgenic animal used to produce the antibody. However, all
antibodies encoded by the nucleic acid molecules provided herein,
or comprising the amino acid sequences provided herein, comprise
the instant invention, independent of the glycosylation pattern the
antibodies may have. Similarly, in particular embodiments,
antibodies with a glycosylation pattern comprising only
non-fucosylated N-glycans may be advantageous, because these
antibodies have been shown to typically exhibit more potent
efficacy than their fucosylated counterparts both in vitro and in
vivo (See for example, Shinkawa et al., J. Biol. Chem. 278:
3466-3473 (2003); U.S. Pat. Nos. 6,946,292 and 7,214,775). These
antibodies with non-fucosylated N-glycans are not likely to be
immunogenic because their carbohydrate structures are a normal
component of the population that exists in human serum IgG.
The present invention includes anti-LAG3 antibodies and
antigen-binding fragments thereof (e.g., 4A10, 19E8, 11C9 and/or
22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9)
comprising N-linked glycans that are typically added to
immunoglobulins produced in Chinese hamster ovary cells (CHO
N-linked glycans) or to engineered yeast cells (engineered yeast
N-linked glycans), such as, for example, Pichia pastoris. For
example, in an embodiment of the invention, the antibody or
antigen-binding fragment comprises one or more of the "engineered
yeast N-linked glycans" or "CHO N-linked glycans" that are set
forth in FIG. 6 (e.g., G0 and/or G0-F and/or G1 and/or G1-F and/or
and/or G2-F and/or Man5). In an embodiment of the invention, the
antibody or antigen-binding fragment comprises the engineered yeast
N-linked glycans, i.e., G0 and/or G1 and/or G2, optionally, further
including Man5. In an embodiment of the invention, the antibody or
antigen-binding fragment comprise the CHO N-linked glycans, i.e.,
G0-F, G1-F and G2-F, optionally, further including G0 and/or G1
and/or G2 and/or Man5. In an embodiment of the invention, about 80%
to about 95% (e.g., about 80-90%, about 85%, about 90% or about
95%) of all N-linked glycans on the antibody or antigen-binding
fragment immunoglobulin chains are engineered yeast N-linked
glycans or CHO N-linked glycans. See Nett et al. Yeast. 28(3):
237-252 (2011); Hamilton et al. Science. 313(5792): 1441-1443
(2006); Hamilton et al. Curr Opin Biotechnol. 18(5): 387-392
(2007). For example, in an embodiment of the invention, an
engineered yeast cell is GFI5.0 or YGLY8316 or strains set forth in
U.S. Pat. No. 7,795,002 or Zha et al. Methods Mol Biol. 988:31-43
(2013). See also international patent application publication no.
WO2013/066765.
The present invention includes polyclonal anti-LAG3 antibodies and
antigen-binding fragments thereof, e.g., a composition comprising a
plurality of anti-LAG3 antibodies and fragments, which include one
or more of the anti-LAG3 antibodies or antigen-binding fragments
thereof of the present invention (e.g., Ab1, Ab2, Ab3, Ab4, Ab5,
Ab6, Ab7, Ab8 or Ab9), and methods of use thereof. A polyclonal
antibody is an antibody which was produced among or in the presence
of one or more other, non-identical antibodies. In general,
polyclonal antibodies are produced from collections of different
B-lymphocytes, e.g., the B-lymphocyte of an animal treated with an
immunogen of interest, which produces a population of different
antibodies but which are all directed to the immunogen. Usually,
polyclonal antibodies are obtained directly from an immunized
animal, e.g., spleen, serum or ascites fluid.
The present invention includes "antagonist" anti-LAG3 antibodies
and antigen-binding fragments thereof and methods of use thereof,
e.g., humanized, antagonist anti-LAG3 antibodies and fragments. An
antagonist anti-LAG3 antibody or antigen-binding fragment thereof
antagonizes an activity of LAG3 (e.g., human LAG3) such as by
inhibiting LAG3 binding to MHC class II molecules; competing with
MHC class II molecules for LAG3 binding; or when a cell or subject
is contacted with the antibody or fragment, a biological phenotype
associated with LAG3 antagonism, such as stimulation of
antigen-specific T-cell production of IL-2, is produced.
The present invention includes bispecific and bifunctional
antibodies and antigen-binding fragments having a binding
specificity for LAG3 and another antigen such as, for example, PD-1
or PD-L1, and methods of use thereof. In an embodiment of the
invention, the anti-PD1 chains comprise the amino acid sequence of
SEQ ID NOs: 41 and 42 or of SEQ ID NOs: 43 and 44. A bispecific or
bifunctional antibody is an artificial hybrid antibody having two
different heavy/light chain pairs and two different binding sites.
Bispecific antibodies can be produced by a variety of methods
including fusion of hybridomas or linking of Fab' fragments. See,
e.g., Songsivilai, et al., (1990) Clin. Exp. Immunol. 79: 315-321,
Kostelny, et al., (1992) J Immunol. 148:1547-1553. In addition,
bispecific antibodies may be formed as "diabodies" (Holliger, et
al., (1993) PNAS USA 90:6444-6448) or as "Janusins" (Traunecker, et
al., (1991) EMBO J. 10:3655-3659 and Traunecker, et al., (1992)
Int. J. Cancer Suppl. 7:51-52).
The present invention further includes anti-LAG3 antigen-binding
fragments of the anti-LAG3 antibodies disclosed herein. The
antibody fragments include F(ab).sub.2 fragments, which may be
produced by enzymatic cleavage of an IgG by, for example, pepsin.
Fab fragments may be produced by, for example, reduction of
F(ab).sub.2 with dithiothreitol or mercaptoethylamine. A Fab
fragment is a V.sub.L-C.sub.L chain appended to a V.sub.H-C.sub.H1
chain by a disulfide bridge. A F(ab).sub.2 fragment is two Fab
fragments which, in turn, are appended by two disulfide bridges.
The Fab portion of an F(ab).sub.2 molecule includes a portion of
the F.sub.c region between which disulfide bridges are located. An
F.sub.V fragment is a V.sub.L or V.sub.H region.
Immunoglobulins may be assigned to different classes depending on
the amino acid sequences of the constant domain of their heavy
chains. There are at least five major classes of immunoglobulins:
IgA, IgD, IgE, IgG and IgM, and several of these may be further
divided into subclasses (isotypes), e.g. IgG-1, IgG-2, IgG-3 and
IgG-4; IgA-1 and IgA-2. The invention comprises anti-LAG3
antibodies and antigen-binding fragments of any of these classes or
subclasses of antibodies.
In one embodiment, the anti-LAG3 antibody or antigen-binding
fragment comprises a heavy chain constant region, e.g. a human
constant region, such as .gamma.1, .gamma.2, .gamma.3, or .gamma.4
human heavy chain constant region or a variant thereof. In another
embodiment, the anti-LAG3 antibody or antigen-binding fragment
comprises a light chain constant region, e.g. a human light chain
constant region, such as lambda or kappa human light chain region
or variant thereof. By way of example, and not limitation, the
human heavy chain constant region can be .gamma.4 and the human
light chain constant region can be kappa. In an alternative
embodiment, the Fc region of the antibody is .gamma.4 with a
Ser228Pro mutation (Schuurman, J et. al., Mol. Immunol. 38: 1-8,
2001).
In some embodiments, different constant domains may be appended to
humanized V.sub.L and V.sub.H regions derived from the CDRs
provided herein. For example, if a particular intended use of an
antibody (or fragment) of the present invention were to call for
altered effector functions, a heavy chain constant domain other
than human IgG1 may be used, or hybrid IgG1/IgG4 may be
utilized.
Although human IgG1 antibodies provide for long half-life and for
effector functions, such as complement activation and
antibody-dependent cellular cytotoxicity, such activities may not
be desirable for all uses of the antibody. In such instances a
human IgG4 constant domain, for example, may be used. The present
invention includes anti-LAG3 antibodies and antigen-binding
fragments thereof which comprise an IgG4 constant domain, e.g.,
antagonist, humanized anti-LAG3 antibodies and fragments, and
methods of use thereof. In one embodiment, the IgG4 constant domain
can differ from the native human IgG4 constant domain (Swiss-Prot
Accession No. P01861.1) at a position corresponding to position 228
in the EU system and position 241 in the KABAT system, where the
native Ser108 is replaced with Pro, in order to prevent a potential
inter-chain disulfide bond between Cys106 and Cys109 (corresponding
to positions Cys 226 and Cys 229 in the EU system and positions Cys
239 and Cys 242 in the KABAT system) that could interfere with
proper intra-chain disulfide bond formation. See Angal et al.
(1993) Mol. Imunol. 30:105. In other instances, a modified IgG1
constant domain which has been modified to increase half-life or
reduce effector function can be used.
Antibody Engineering
Further included are embodiments in which the anti-LAG3 antibodies
and antigen-binding fragments thereof are engineered antibodies to
include modifications to framework residues within the variable
domains of a parental (e.g., mouse) monoclonal antibody, e.g. to
improve the properties of the antibody or fragment. Typically, such
framework modifications are made to decrease the immunogenicity of
the antibody or fragment. This is usually accomplished by replacing
non-CDR residues in the variable domains (i.e. framework residues)
in a parental (e.g. rodent) antibody or fragment with analogous
residues from the immune repertoire of the species in which the
antibody is to be used, e.g. human residues in the case of human
therapeutics. Such an antibody or fragment is referred to as a
"humanized" antibody or fragment. In some cases it is desirable to
increase the affinity, or alter the specificity of an engineered
(e.g. humanized) antibody. One approach is to "backmutate" one or
more framework residues to the corresponding germline sequence.
More specifically, an antibody or fragment that has undergone
somatic mutation can contain framework residues that differ from
the germline sequence from which the antibody is derived. Such
residues can be identified by comparing the antibody or fragment
framework sequences to the germline sequences from which the
antibody or fragment is derived. Another approach is to revert to
the original parental (e.g., rodent) residue at one or more
positions of the engineered (e.g. humanized) antibody, e.g. to
restore binding affinity that may have been lost in the process of
replacing the framework residues. (See, e.g., U.S. Pat. Nos.
5,693,762, 5,585,089 and 5,530,101.)
For example, Table 2, below, shows regions where a framework region
amino acid position (using Kabat numbering system) differs from the
germline and how this position can be backmutated to the germline
by the indicated substitutions:
TABLE-US-00052 TABLE 2 Exemplary Backmutations Framework Amino Acid
Backmutation-- Region Position (Kabat Numbering) examples AbA
V.sub.H 25 H25S AbAV.sub.H 68 S68T AbA V.sub.H 82a T82aT
Another type of framework modification involves mutating one or
more residues within the framework region, or even within one or
more CDR regions, to remove T cell epitopes to thereby reduce the
potential immunogenicity of the antibody. This approach is also
referred to as "deimmunization" and is described in further detail
in U.S. Pat. No. 7,125,689.
In particular embodiments, it will be desirable to change certain
amino acids containing exposed side-chains to another amino acid
residue in order to provide for greater chemical stability of the
final antibody, as follows. Such changes in the antigen-binding
region can alter the binding to the antigen. The deamidation of
asparagine may occur on N-G or D-G sequences and result in the
creation of an isoaspartic acid residue that introduces a kink into
the polypeptide chain and decreases its stability (isoaspartic acid
effect). In certain embodiments, the antibodies of the present
disclosure do not contain asparagine isomerism sites.
For example, an asparagine (Asn) residue may be changed to Gln or
Ala to reduce the potential for formation of isoaspartate at any
Asn-Gly sequences, particularly within a CDR. A similar problem may
occur at a Asp-Gly sequence. Reissner and Aswad (2003) Cell. Mol.
Life Sci. 60:1281. Isoaspartate formation may debilitate or
completely abrogate binding of an antibody to its target antigen.
See, Presta (2005) J. Allergy Clin. Immunol. 116:731 at 734. In one
embodiment, the asparagine is changed to glutamine (Gln). It may
also be desirable to alter an amino acid adjacent to an asparagine
(Asn) or glutamine (Gln) residue to reduce the likelihood of
deamidation, which occurs at greater rates when small amino acids
occur adjacent to asparagine or glutamine. See, Bischoff &
Kolbe (1994) J. Chromatog. 662:261. In addition, any methionine
residues (typically solvent exposed Met) in CDRs may be changed to
Lys, Leu, Ala, or Phe or other amino acids in order to reduce the
possibility that the methionine sulfur would oxidize, which could
reduce antigen-binding affinity and also contribute to molecular
heterogeneity in the final antibody preparation. Id. In one
embodiment of the invention, the methionine is changed to alanine
(Ala). Additionally, in order to prevent or minimize potential
scissile Asn-Pro peptide bonds, it may be desirable to alter any
Asn-Pro combinations found in a CDR to Gln-Pro, Ala-Pro, or
Asn-Ala. Antibodies with such substitutions are subsequently
screened to ensure that the substitutions do not decrease the
affinity or specificity of the antibody for LAG3, or other desired
biological activity to unacceptable levels.
TABLE-US-00053 TABLE 3 Exemplary stabilizing CDR variants CDR
Residue Stabilizing Variant Sequence Asn-Gly Gln-Gly, Ala-Gly, or
Asn-Ala (N-G) (Q-G), (A-G), or (N-A) Asp-Gly Glu-Gly, Ala-Gly or
Asp-Ala (D-G) (E-G), (A-G), or (D-A) Met (typically solvent
exposed) Lys, Leu, Ala, or Phe (M) (K), (L), (A), or (F) Asn Gln or
Ala (N) (Q) or (A) Asn-Pro Gln-Pro, Ala-Pro, or Asn-Ala (N-P)
(Q-P), (A-P), or (N-A)
The immunoglobulin chains set forth above 4A10, 19E8, 11C9 and 22D2
contain residues that are double-underscored. The scope of the
present invention includes antibodies, antigen-binding fragments,
polypeptides and polynucleotides as discussed herein wherein any
one or more of such residues are mutated to any other residue
including, for example, those of the stabilizing variant sequences
set forth above in Table 3.
Mouse anti-LAG3 antibodies and antigen-binding fragments can be
humanized by various methods known in the art (see e.g.,
humanization methods set forth in WO2005/047326 or U.S. Pat. No.
7,846,443). For example, in an embodiment of the invention, mouse
anti-LAG3 antibodies and fragments are humanized by a method
wherein computer aided molecular modeling is used for identifying
CDR loops in non-human immunoglobulin chains. This identification
is made based upon the three-dimensional structure of the
immunoglobulin chain and the position of the loops in the
chain.
Human frameworks (obtained from the IMGD Database), into which the
non-human loops will be introduced, are selected based on best
matches (by amino acid sequence comparison) with the non-human
sequence both in the frameworks and in the CDRs. Regarding the FR4
in the V.sub.H domain, VJ regions, for the human germlines, are
compared with the corresponding non-human VJ regions; and,
regarding FR4 in V.sub.L domain, J-kappa and J-Lambda regions, of
human germline sequences, are compared with the corresponding
non-human J-Kappa and J-Lambda regions.
Proper three-dimensional orientation of the CDRs, which is critical
to maintaining antigen binding, depends, in part, on proper
interfacing between the V.sub.H and V.sub.L. Thus, the molecular
models are constructed and used for identifying residues in the
V.sub.L-V.sub.H interface as well as for identifying residues that
can potentially alter the CDR conformations and hence binding to
antigen. If necessary, mutations in the immunoglobulin chain may be
introduced so as to achieve desirable properties e.g., antigen
binding.
Developability Filters are established through the use of molecular
modeling techniques. Developability Filters are criteria used for
filtering features out of the final immunoglobulin chain so as to
avoid unwanted effects. Molecular models are further used to
identify solvent exposed amino acids that can result in unwanted
effects such as glycosylation, deamidation and oxidation. Such
effects on the antibody can lead to changes in the antibody
conformation and hence function. Such problems can occur, for
example, during scale-up or over a prolonged period of time when
exposed to extreme chemical/physical environments. Again, if
necessary, mutations in the chains can be introduced so as achieve
the desired properties.
The Developability Filters are typically introduced early on in the
design stage of the humanized chains to eliminate/minimize these
potential problems. Humanized antibodies are further subjected to
design criteria, such as good expressibility and desirable
isoelectric points.
Antibody Engineering of the Fc region
The anti-LAG3 antibodies (e.g., humanized antibodies such as
antagonist humanized antibodies) and antigen-binding fragments
thereof disclosed herein (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g.,
Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) may also be
engineered to include modifications within the Fc region, typically
to alter one or more functional properties of the antibody, such as
serum half-life, complement fixation, Fc receptor binding, and/or
effector function (e.g., antigen-dependent cellular cytotoxicity).
Furthermore, the antibodies and antigen-binding fragments thereof
(e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5,
Ab6, Ab7, Ab8 and/or Ab9) can be chemically modified (e.g., one or
more chemical moieties can be attached to the antibody) or be
modified to alter its glycosylation, again to alter one or more
functional properties of the antibody or fragment. Each of these
embodiments is described in further detail below. The numbering of
residues in the Fc region is that of the EU index of Kabat. Any
such anti-LAG3 antibody or antigen-binding fragment thereof having
the modifications (e.g., Fc modifications) and/or alterations
discussed herein are part of the present invention.
The anti-LAG3 antibodies (e.g., humanized antibodies such as
antagonist humanized antibodies) and antigen-binding fragments
thereof disclosed herein (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g.,
Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) also include
antibodies and fragments with modified (or blocked) Fc regions to
provide altered effector functions. See, e.g., U.S. Pat. No.
5,624,821; WO2003/086310; WO2005/120571; WO2006/0057702. Such
modifications can be used to enhance or suppress various reactions
of the immune system, with possible beneficial effects in diagnosis
and therapy. Alterations of the Fc region include amino acid
changes (substitutions, deletions and insertions), glycosylation or
deglycosylation, and adding multiple Fc. Changes to the Fc can also
alter the half-life of antibodies in therapeutic antibodies,
enabling less frequent dosing and thus increased convenience and
decreased use of material. See Presta (2005) J. Allergy Clin.
Immunol. 116:731 at 734-35.
In one embodiment, the anti-LAG3 antibody (e.g., humanized
antibodies such as antagonist humanized antibodies) or
antigen-binding fragment (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g.,
Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) is an IgG4
isotype antibody or fragment comprising a serine to proline
mutation at a position corresponding to position 228 (S228P; EU
index) in the hinge region of the heavy chain constant region. This
mutation has been reported to abolish the heterogeneity of
inter-heavy chain disulfide bridges in the hinge region (Angal et
al. supra; position 241 is based on the Kabat numbering
system).
In one embodiment of the invention, the hinge region of CH1 is
modified such that the number of cysteine residues in the hinge
region is increased or decreased. This approach is described
further in U.S. Pat. No. 5,677,425. The number of cysteine residues
in the hinge region of CH1 is altered, for example, to facilitate
assembly of the light and heavy chains or to increase or decrease
the stability of the antibody.
In another embodiment, the Fc hinge region of an anti-LAG3 antibody
or antigen-binding fragment (e.g., 4A10, 19E8, 11C9 and/or 22D2;
e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) is mutated
to decrease the biological half-life of the antibody or fragment.
More specifically, one or more amino acid mutations are introduced
into the CH2-CH3 domain interface region of the Fc-hinge fragment
such that the antibody or fragment has impaired Staphylococcyl
protein A (SpA) binding relative to native Fc-hinge domain SpA
binding. This approach is described in further detail in U.S. Pat.
No. 6,165,745.
In another embodiment, the anti-LAG3 antibody (e.g., humanized
antibodies such as antagonist humanized antibodies) or
antigen-binding fragment (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g.,
Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) is modified to
increase its biological half-life. Various approaches are possible.
For example, one or more of the following mutations can be
introduced: T252L, T254S, T256F, as described in U.S. Pat. No.
6,277,375. Alternatively, to increase the biological half-life, the
antibody can be altered within the CH1 or CL region to contain a
salvage receptor binding epitope taken from two loops of a CH2
domain of an Fc region of an IgG, as described in U.S. Pat. Nos.
5,869,046 and 6,121,022.
In yet other embodiments, the Fc region is altered by replacing at
least one amino acid residue with a different amino acid residue to
alter the effector function(s) of the anti-LAG3 antibody or
antigen-binding fragment. For example, one or more amino acids
selected from amino acid residues 234, 235, 236, 237, 297, 318, 320
and 322 can be replaced with a different amino acid residue such
that the antibody has an altered affinity for an effector ligand
but retains the antigen-binding ability of the parent antibody. The
effector ligand to which affinity is altered can be, for example,
an Fc receptor or the C1 component of complement. This approach is
described in further detail in U.S. Pat. Nos. 5,624,821 and
5,648,260.
In another example, one or more amino acids selected from amino
acid residues 329, 331 and 322 can be replaced with a different
amino acid residue such that the anti-LAG3 antibody has altered C1q
binding and/or reduced or abolished complement dependent
cytotoxicity (CDC). This approach is described in further detail in
U.S. Pat. No. 6,194,551.
In another example, one or more amino acid residues within amino
acid positions 231 and 239 are altered to thereby alter the ability
of the anti-LAG3 antibody or antigen-binding fragment thereof to
fix complement. This approach is described further in PCT
Publication WO 94/29351.
In yet another example, the Fc region is modified to decrease the
ability of the anti-LAG3 antibody (e.g., humanized antibodies such
as antagonist humanized antibodies) or antigen-binding fragment
(e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5,
Ab6, Ab7, Ab8 and/or Ab9) to mediate antibody dependent cellular
cytotoxicity (ADCC) and/or to decrease the affinity of the antibody
or fragment for an Fc.gamma. receptor by modifying one or more
amino acids at the following positions: 238, 239, 243, 248, 249,
252, 254, 255, 256, 258, 264, 265, 267, 268, 269, 270, 272, 276,
278, 280, 283, 285, 286, 289, 290, 292, 293, 294, 295, 296, 298,
301, 303, 305, 307, 309, 312, 315, 320, 322, 324, 326, 327, 329,
330, 331, 333, 334, 335, 337, 338, 340, 360, 373, 376, 378, 382,
388, 389, 398, 414, 416, 419, 430, 434, 435, 437, 438 or 439. This
approach is described further in PCT Publication WO 00/42072.
Moreover, the binding sites on human IgG1 for Fc.gamma.R1,
Fc.gamma.RII, Fc.gamma.RIII and FcRn have been mapped and variants
with improved binding have been described (see Shields et al.
(2001) J. Biol. Chem. 276:6591-6604).
In one embodiment of the invention, the Fc region is modified to
decrease the ability of the anti-LAG3 antibody (e.g., humanized
antibodies such as antagonist humanized antibodies) or
antigen-binding fragment (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g.,
Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to mediate
effector function and/or to increase anti-inflammatory properties
by modifying residues 243 and 264. In one embodiment, the Fc region
of the antibody or fragment is modified by changing the residues at
positions 243 and 264 to alanine. In one embodiment, the Fc region
is modified to decrease the ability of the antibody or fragment to
mediate effector function and/or to increase anti-inflammatory
properties by modifying residues 243, 264, 267 and 328.
In still another embodiment, the anti-LAG3 antibody (e.g.,
humanized antibodies such as antagonist humanized antibodies) or
antigen-binding fragment (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g.,
Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) comprises a
particular glycosylation pattern. For example, an aglycosylated
antibody or fragment can be made (i.e., the antibody lacks
glycosylation). The glycosylation pattern of an antibody or
fragment may be altered to, for example, increase the affinity or
avidity of the antibody or fragment for a LAG3 antigen. Such
modifications can be accomplished by, for example, altering one or
more of the glycosylation sites within the antibody or fragment
sequence. For example, one or more amino acid substitutions can be
made that result removal of one or more of the variable region
framework glycosylation sites to thereby eliminate glycosylation at
that site. Such aglycosylation may increase the affinity or avidity
of the antibody or fragment for antigen. See, e.g., U.S. Pat. Nos.
5,714,350 and 6,350,861.
Anti-LAG3 antibodies (e.g., humanized antibodies such as antagonist
humanized antibodies) and antigen-binding fragments disclosed
herein (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3,
Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) include those produced in lower
eukaryote host cells, in particular fungal host cells such as yeast
(e.g., Pichia pastoris) and filamentous fungi, that have been
genetically engineered to produce glycoproteins that have
mammalian- or human-like glycosylation patterns (See for example,
Choi et al, (2003) Proc. Natl. Acad. Sci. 100: 5022-5027; Hamilton
et al., (2003) Science 301: 1244-1246; Hamilton et al., (2006)
Science 313: 1441-1443). A particular advantage of these
genetically modified host cells over currently used mammalian cell
lines is the ability to control the glycosylation profile of
glycoproteins that are produced in the cells such that compositions
of glycoproteins can be produced wherein a particular N-glycan
structure predominates (see, e.g., U.S. Pat. Nos. 7,029,872 and
7,449,308). These genetically modified host cells have been used to
produce antibodies that have predominantly particular N-glycan
structures (See for example, Li et al., (2006) Nat. Biotechnol. 24:
210-215).
In particular embodiments, the anti-LAG3 antibodies (e.g.,
humanized antibodies such as antagonist humanized antibodies) and
antigen-binding fragments thereof disclosed herein (e.g., 4A10,
19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7,
Ab8 and/or Ab9) further include those produced in lower eukaryotic
host cells and which comprise fucosylated and non-fucosylated
hybrid and complex N-glycans, including bisected and multiantennary
species, including but not limited to N-glycans such as
GlcNAc.sub.(1-4)Man.sub.3GlcNAc.sub.2;
Gal.sub.(1-4)GlcNAc.sub.(1-4)Man.sub.3GlcNAc.sub.2;
NANA.sub.(1-4)Gal.sub.(1-4)GlcNAc.sub.(1-4)Man.sub.3GlcNAc.sub.2.
In particular embodiments, the anti-LAG3 antibodies (e.g.,
humanized antibodies such as antagonist humanized antibodies) and
antigen-binding fragments thereof provided herein (e.g., 4A10,
19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7,
Ab8 and/or Ab9) may comprise antibodies or fragments having at
least one hybrid N-glycan selected from the group consisting of
GlcNAcMan.sub.5GlcNAc.sub.2; GalGlcNAcMan.sub.5GlcNAc.sub.2; and
NANAGalGlcNAcMan.sub.5GlcNAc.sub.2. In particular aspects, the
hybrid N-glycan is the predominant N-glycan species in the
composition. In further aspects, the hybrid N-glycan is a
particular N-glycan species that comprises about 30%, 40%, 50%,
60%, 70%, 80%, 90%, 95%, 97%, 98%, 99%, or 100% of the hybrid
N-glycans in the composition.
In particular embodiments, the anti-LAG3 antibodies (e.g.,
humanized antibodies such as antagonist humanized antibodies) and
antigen-binding fragments thereof provided herein (e.g., 4A10,
19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7,
Ab8 and/or Ab9) comprise antibodies and fragments having at least
one complex N-glycan selected from the group consisting of
GlcNAcMan.sub.3GlcNAc.sub.2; GalGlcNAcMan.sub.3GlcNAc.sub.2;
NANAGalGlcNAcMan.sub.3GlcNAc.sub.2;
GlcNAc.sub.2Man.sub.3GlcNAc.sub.2;
GalGlcNAc.sub.2Man.sub.3GlcNAc.sub.2;
Gal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2;
NANAGal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2; and
NANA.sub.2Gal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2. In particular
aspects, the complex N-glycan is the predominant N-glycan species
in the composition. In further aspects, the complex N-glycan is a
particular N-glycan species that comprises about 30%, 40%, 50%,
60%, 70%, 80%, 90%, 95%, 97%, 98%, 99%, or 100% of the complex
N-glycans in the composition.
In particular embodiments, the anti-LAG3 antibody and
antigen-binding fragment N-glycan is fucosylated. In general, the
fucose is in an .alpha.1,3-linkage with the GlcNAc at the reducing
end of the N-glycan, an .alpha.1,6-linkage with the GlcNAc at the
reducing end of the N-glycan, an .alpha.1,2-linkage with the Gal at
the non-reducing end of the N-glycan, an .alpha.1,3-linkage with
the GlcNac at the non-reducing end of the N-glycan, or an
.alpha.1,4-linkage with a GlcNAc at the non-reducing end of the
N-glycan.
Therefore, in particular aspects of the above the glycoprotein
compositions, the glycoform is in an .alpha.1,3-linkage or
.alpha.1,6-linkage fucose to produce a glycoform selected from the
group consisting of Man.sub.5GlcNAc.sub.2(Fuc),
GlcNAcMan.sub.5GlcNAc.sub.2(Fuc), Man.sub.3GlcNAc.sub.2(Fuc),
GlcNAcMan.sub.3GlcNAc.sub.2(Fuc),
GlcNAc.sub.2Man.sub.3GlcNAc.sub.2(Fuc),
GalGlcNAc.sub.2Man.sub.3GlcNAc.sub.2(Fuc),
Gal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2(Fuc),
NANAGal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2(Fuc), and
NANA.sub.2Gal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2(Fuc); in an
.alpha.1,3-linkage or .alpha.1,4-linkage fucose to produce a
glycoform selected from the group consisting of
GlcNAc(Fuc)Man.sub.5GlcNAc.sub.2, GlcNAc(Fuc)Man.sub.3GlcNAc.sub.2,
GlcNAc.sub.2(Fuc.sub.1-2)Man.sub.3GlcNAc.sub.2,
GalGlcNAc.sub.2(Fuc.sub.1-2)Man.sub.3GlcNAc.sub.2,
Gal.sub.2GlcNAc.sub.2(Fuc1-2)Man3GlcNAc2,
NANAGal2GlcNAc2(Fuc.sub.1-2)Man.sub.3GlcNAc.sub.2, and
NANA.sub.2Gal.sub.2GlcNAc.sub.2(Fuc.sub.1-2)Man.sub.3GlcNAc.sub.2;
or in an .alpha.1,2-linkage fucose to produce a glycoform selected
from the group consisting of
Gal(Fuc)GlcNAc.sub.2Man.sub.3GlcNAc.sub.2,
Gal.sub.2(Fuc.sub.1-2)GlcNAc.sub.2Man.sub.3GlcNAc.sub.2,
NANAGal.sub.2(Fuc.sub.1-2)GlcNAc.sub.2Man.sub.3GlcNAc.sub.2, and
NANA.sub.2Gal.sub.2(Fuc.sub.1-2)GlcNAc.sub.2Man.sub.3GlcNAc.sub.2.
In further aspects, the anti-LAG3 antibodies (e.g., humanized
antibodies such as antagonist humanized antibodies) or
antigen-binding fragments thereof comprise high mannose N-glycans,
including but not limited to, Man.sub.8GlcNAc.sub.2,
Man.sub.7GlcNAc.sub.2, Man.sub.6GlcNAc.sub.2,
Man.sub.5GlcNAc.sub.2, Man.sub.4GlcNAc.sub.2, or N-glycans that
consist of the Man.sub.3GlcNAc.sub.2 N-glycan structure.
In further aspects of the above, the complex N-glycans further
include fucosylated and non-fucosylated bisected and multiantennary
species.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., Ab1, Ab2, Ab3, Ab4, Ab5,
Ab6, Ab7, Ab8 or Ab9) comprises an immunoglobulin Fc domain that
comprises glycans that comprise sialic acid (e.g.,
N-Acetylneuraminic acid), e.g., terminal .alpha.2,3-sialic acid or
terminal .alpha.2,6-sialic acid. In an embodiment of the invention,
the glycans on the Fc are 5, 10, 20, 50, 90% or more sialylated
species. In an embodiment of the invention, the Fc comprises the
mutations at positions 297, 264 and/or 243.
As used herein, the terms "N-glycan" and "glycoform" are used
interchangeably and refer to an N-linked oligosaccharide, for
example, one that is attached by an asparagine-N-acetylglucosamine
linkage to an asparagine residue of a polypeptide. N-linked
glycoproteins contain an N-acetylglucosamine residue linked to the
amide nitrogen of an asparagine residue in the protein. The
predominant sugars found on glycoproteins are glucose, galactose,
mannose, fucose, N-acetylgalactosamine (GalNAc),
N-acetylglucosamine (GlcNAc) and sialic acid (e.g.,
N-acetyl-neuraminic acid (NANA)). The processing of the sugar
groups occurs co-translationally in the lumen of the ER and
continues post-translationally in the Golgi apparatus for N-linked
glycoproteins.
N-glycans have a common pentasaccharide core of
Man.sub.3GlcNAc.sub.2 ("Man" refers to mannose; "Glc" refers to
glucose; and "NAc" refers to N-acetyl; GlcNAc refers to
N-acetylglucosamine). Usually, N-glycan structures are presented
with the non-reducing end to the left and the reducing end to the
right. The reducing end of the N-glycan is the end that is attached
to the Asn residue comprising the glycosylation site on the
protein. N-glycans differ with respect to the number of branches
(antennae) comprising peripheral sugars (e.g., GlcNAc, galactose,
fucose and sialic acid) that are added to the Man.sub.3GlcNAc.sub.2
("Man3") core structure which is also referred to as the
"trimannose core", the "pentasaccharide core" or the "paucimannose
core". N-glycans are classified according to their branched
constituents (e.g., high mannose, complex or hybrid). A "high
mannose" type N-glycan has five or more mannose residues. A
"complex" type N-glycan typically has at least one GlcNAc attached
to the 1,3 mannose arm and at least one GlcNAc attached to the 1,6
mannose arm of a "trimannose" core. Complex N-glycans may also have
galactose ("Gal") or N-acetylgalactosamine ("GalNAc") residues that
are optionally modified with sialic acid or derivatives (e.g.,
"NANA" or "NeuAc", where "Neu" refers to neuraminic acid and "Ac"
refers to acetyl). Complex N-glycans may also have intrachain
substitutions comprising "bisecting" GlcNAc and core fucose
("Fuc"). Complex N-glycans may also have multiple antennae on the
"trimannose core," often referred to as "multiple antennary
glycans." A "hybrid" N-glycan has at least one GlcNAc on the
terminal of the 1,3 mannose arm of the trimannose core and zero or
more mannoses on the 1,6 mannose arm of the trimannose core. The
various N-glycans are also referred to as "glycoforms."
With respect to complex N-glycans, the terms "G-2", "G-1", "G0",
"G1", "G2", "A1", and "A2" mean the following. "G-2" refers to an
N-glycan structure that can be characterized as
Man.sub.3GlcNAc.sub.2; the term "G-1" refers to an N-glycan
structure that can be characterized as GlcNAcMan.sub.3GlcNAc.sub.2;
the term "G0" refers to an N-glycan structure that can be
characterized as GlcNAc.sub.2Man.sub.3GlcNAc.sub.2; the term "G1"
refers to an N-glycan structure that can be characterized as
GalGlcNAc.sub.2Man.sub.3GlcNAc.sub.2; the term "G2" refers to an
N-glycan structure that can be characterized as
Gal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2; the term "A1" refers to
an N-glycan structure that can be characterized as
NANAGal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2; and, the term "A2"
refers to an N-glycan structure that can be characterized as
NANA.sub.2Gal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2. Unless
otherwise indicated, the terms G-2'', "G-1", "G0", "G1", "G2",
"A1", and "A2" refer to N-glycan species that lack fucose attached
to the GlcNAc residue at the reducing end of the N-glycan. When the
term includes an "F", the "F" indicates that the N-glycan species
contains a fucose residue on the GlcNAc residue at the reducing end
of the N-glycan. For example, G0F, G1F, G2F, A1F, and A2F all
indicate that the N-glycan further includes a fucose residue
attached to the GlcNAc residue at the reducing end of the N-glycan.
Lower eukaryotes such as yeast and filamentous fungi do not
normally produce N-glycans that produce fucose.
With respect to multiantennary N-glycans, the term "multiantennary
N-glycan" refers to N-glycans that further comprise a GlcNAc
residue on the mannose residue comprising the non-reducing end of
the 1,6 arm or the 1,3 arm of the N-glycan or a GlcNAc residue on
each of the mannose residues comprising the non-reducing end of the
1,6 arm and the 1,3 arm of the N-glycan. Thus, multiantennary
N-glycans can be characterized by the formulas
GlcNAc.sub.(2-4)Man.sub.3GlcNAc.sub.2,
Gal.sub.(1-4)GlcNAc.sub.(2-4)Man.sub.3GlcNAc.sub.2, or
NANA.sub.(1-4)Gal.sub.(1-4)GlcNAc.sub.(2-4)Man.sub.3GlcNAc.sub.2.
The term "1-4" refers to 1, 2, 3, or 4 residues.
With respect to bisected N-glycans, the term "bisected N-glycan"
refers to N-glycans in which a GlcNAc residue is linked to the
mannose residue at the reducing end of the N-glycan. A bisected
N-glycan can be characterized by the formula
GlcNAc.sub.3Man.sub.3GlcNAc.sub.2 wherein each mannose residue is
linked at its non-reducing end to a GlcNAc residue. In contrast,
when a multiantennary N-glycan is characterized as
GlcNAc.sub.3Man.sub.3GlcNAc.sub.2, the formula indicates that two
GlcNAc residues are linked to the mannose residue at the
non-reducing end of one of the two arms of the N-glycans and one
GlcNAc residue is linked to the mannose residue at the non-reducing
end of the other arm of the N-glycan.
Antibody Physical Properties
The anti-LAG3 antibodies (e.g., humanized antibodies such as
antagonist humanized antibodies) and antigen-binding fragments
thereof disclosed herein (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g.,
Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) may further
contain one or more glycosylation sites in either the light or
heavy chain immunoglobulin variable region. Such glycosylation
sites may result in increased immunogenicity of the antibody or
fragment or an alteration of the pK of the antibody due to altered
antigen-binding (Marshall et al. (1972) Annu Rev Biochem
41:673-702; Gala and Morrison (2004) J Immunol 172:5489-94; Wallick
et al (1988) J Exp Med 168:1099-109; Spiro (2002) Glycobiology
12:43R-56R; Parekh et al (1985) Nature 316:452-7; Mimura et al.
(2000) Mol Immunol 37:697-706). Glycosylation has been known to
occur at motifs containing an N-X-S/T sequence.
Each anti-LAG3 antibody (e.g., humanized antibodies such as
antagonist humanized antibodies) or antigen-binding fragment (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) will have a unique isoelectric point (pI). For
example, some antibodies, such as Ab6, have a pI of about 6.3.
Each anti-LAG3 antibody (e.g., humanized antibodies such as
antagonist humanized antibodies) or antigen-binding fragment (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) will have a characteristic melting
temperature, with a higher melting temperature indicating greater
overall stability in vivo (Krishnamurthy R and Manning M C (2002)
Curr Pharm Biotechnol 3:361-71). In general, the T.sub.M1 (the
temperature of initial unfolding) may be greater than 60.degree.
C., greater than 65.degree. C., or greater than 70.degree. C. The
melting point of an antibody or fragment can be measured using
differential scanning calorimetry (Chen et al (2003) Pharm Res
20:1952-60; Ghirlando et al (1999) Immunol Lett 68:47-52) or
circular dichroism (Murray et al. (2002) J. Chromatogr Sci
40:343-9).
In a further embodiment, anti-LAG3 antibodies (e.g., humanized
antibodies such as antagonist humanized antibodies) and
antigen-binding fragments thereof (e.g., 4A10, 19E8, 11C9 and/or
22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) are
selected that do not degrade rapidly. Degradation of an antibody or
fragment can be measured using capillary electrophoresis (CE) and
MALDI-MS (Alexander A J and Hughes D E (1995) Anal Chem
67:3626-32).
In a further embodiment, anti-LAG3 antibodies (e.g., humanized
antibodies such as antagonist humanized antibodies) and
antigen-binding fragments thereof are selected that have minimal
aggregation effects, which can lead to the triggering of an
unwanted immune response and/or altered or unfavorable
pharmacokinetic properties. Generally, antibodies and fragments are
acceptable with aggregation of 25% or less, 20% or less, 15% or
less, 10% or less, or 5% or less. Aggregation can be measured by
several techniques, including size-exclusion column (SEC), high
performance liquid chromatography (HPLC), and light scattering.
Antibody Conjugates
The anti-LAG3 antibodies (e.g., humanized antibodies such as
antagonist humanized antibodies) and antigen-binding fragments
thereof disclosed herein (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g.,
Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) may also be
conjugated to a chemical moiety. Such conjugated antibodies and
fragments are part of the present invention. The chemical moiety
may be, inter alia, a polymer, a radionuclide or a cytotoxic
factor. In particular embodiments, the chemical moiety is a polymer
which increases the half-life of the antibody or fragment in the
body of a subject. Suitable polymers include, but are not limited
to, hydrophilic polymers which include but are not limited to
polyethylene glycol (PEG) (e.g., PEG with a molecular weight of 2
kDa, 5 kDa, 10 kDa, 12 kDa, 20 kDa, 30 kDa or 40 kDa), dextran and
monomethoxypolyethylene glycol (mPEG). Lee, et al., (1999)
(Bioconj. Chem. 10:973-981) discloses PEG conjugated single-chain
antibodies. Wen, et al., (2001) (Bioconj. Chem. 12:545-553)
disclose conjugating antibodies with PEG which is attached to a
radiometal chelator (diethylenetriaminpentaacetic acid (DTPA)).
The anti-LAG3 antibodies (e.g., humanized antibodies such as
antagonist humanized antibodies) and antigen-binding fragments
thereof disclosed herein (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g.,
Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) may also be
conjugated with labels such as .sup.99Tc, .sup.90Y, .sup.111In,
.sup.32P, .sup.14C, .sup.125I, .sup.3H, .sup.131I, .sup.11C,
.sup.15O, .sup.13N, .sup.18F, .sup.35S, .sup.51Cr, .sup.57To,
.sup.226Ra, .sup.60Co, .sup.59Fe, .sup.57Se, .sup.152Eu, .sup.67CU,
.sup.217Ci, .sup.211At, .sup.212Pb, .sup.47Sc, .sup.109Pd,
.sup.234Th, and .sup.40K, .sup.157Gd, .sup.55Mn, .sup.52Tr, and
.sup.56Fe.
The anti-LAG3 antibodies (e.g., humanized antibodies such as
antagonist humanized antibodies) and antigen-binding fragments
disclosed herein (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) may also be
PEGylated, for example to increase its biological (e.g., serum)
half-life. To PEGylate an antibody or fragment, the antibody or
fragment, typically is reacted with a reactive form of polyethylene
glycol (PEG), such as a reactive ester or aldehyde derivative of
PEG, under conditions in which one or more PEG groups become
attached to the antibody or antibody fragment. In particular
embodiments, the PEGylation is carried out via an acylation
reaction or an alkylation reaction with a reactive PEG molecule (or
an analogous reactive water-soluble polymer). As used herein, the
term "polyethylene glycol" is intended to encompass any of the
forms of PEG that have been used to derivatize other proteins, such
as mono (C1-C10) alkoxy- or aryloxy-polyethylene glycol or
polyethylene glycol-maleimide. In certain embodiments, the antibody
or fragment to be PEGylated is an aglycosylated antibody or
fragment. Methods for PEGylating proteins are known in the art and
can be applied to the antibodies of the invention. See, e.g., EP 0
154 316 and EP 0 401 384.
The anti-LAG3 antibodies (e.g., humanized antibodies such as
antagonist humanized antibodies) and antigen-binding fragments
disclosed herein (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) may also be
conjugated with fluorescent or chemiluminescent labels, including
fluorophores such as rare earth chelates, fluorescein and its
derivatives, rhodamine and its derivatives, isothiocyanate,
phycoerythrin, phycocyanin, allophycocyanin, o-phthaladehyde,
fluorescamine, .sup.152Eu, dansyl, umbelliferone, luciferin,
luminal label, isoluminal label, an aromatic acridinium ester
label, an imidazole label, an acridimium salt label, an oxalate
ester label, an aequorin label, 2,3-dihydrophthalazinediones,
biotin/avidin, spin labels and stable free radicals.
The anti-LAG3 antibodies (e.g., humanized antibodies such as
antagonist humanized antibodies) and antigen-binding fragments
thereof (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3,
Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) may also be conjugated to a
cytotoxic factor such as diptheria toxin, Pseudomonas aeruginosa
exotoxin A chain, ricin A chain, abrin A chain, modeccin A chain,
alpha-sarcin, Aleurites fordii proteins and compounds (e.g., fatty
acids), dianthin proteins, Phytoiacca americana proteins PAPI,
PAPII, and PAP-S, momordica charantia inhibitor, curcin, crotin,
Saponaria officinalis inhibitor, mitogellin, restrictocin,
phenomycin, and enomycin.
Any method known in the art for conjugating the anti-LAG3
antibodies (e.g., humanized antibodies such as antagonist humanized
antibodies) and antigen-binding fragments thereof (e.g., 4A10,
19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7,
Ab8 and/or Ab9) to the various moieties may be employed, including
those methods described by Hunter, et al., (1962) Nature 144:945;
David, et al., (1974) Biochemistry 13:1014; Pain, et al., (1981) J.
Immunol. Meth. 40:219; and Nygren, J., (1982) Histochem. and
Cytochem. 30:407. Methods for conjugating antibodies and fragments
are conventional and very well known in the art.
Therapeutic Uses of Anti-LAG3 Antibodies
Further provided are methods for treating or preventing cancer in
subjects, such as human subjects, in need of such treatment by
administering an effective amount of the anti-LAG3 antibodies or
antigen-binding fragments thereof of the present invention which
are disclosed herein (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g.,
Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) which may be
effective for such treatment or prevention. In an embodiment of the
invention, such a subject suffers from and is treated for cancer,
e.g., a solid tumor which includes, in addition to the tumor cells,
tumor infiltrating lymphocytes (TILs), such as T-cells, expressing
LAG3, e.g., osteosarcoma, rhabdomyosarcoma, neuroblastoma, kidney
cancer, leukemia, renal transitional cell cancer, bladder cancer,
Wilm's cancer, ovarian cancer, pancreatic cancer, breast cancer
(e.g., characterized by a mutation in BRCA1 and/or BRCA2), prostate
cancer, bone cancer, lung cancer (e.g., non-small cell lung
cancer), gastric cancer, colorectal cancer, cervical cancer,
synovial sarcoma, head and neck cancer, squamous cell carcinoma,
multiple myeloma, renal cell cancer, retinoblastoma,
hepatoblastoma, hepatocellular carcinoma, melanoma, rhabdoid tumor
of the kidney, Ewing's sarcoma, chondrosarcoma, brain cancer,
glioblastoma, meningioma, pituitary adenoma, vestibular schwannoma,
a primitive neuroectodermal tumor, medulloblastoma, astrocytoma,
anaplastic astrocytoma, oligodendroglioma, ependymoma, choroid
plexus papilloma, polycythemia vera, thrombocythemia, idiopathic
myelfibrosis, soft tissue sarcoma, thyroid cancer, endometrial
cancer, carcinoid cancer or liver cancer, breast cancer or gastric
cancer. In an embodiment of the invention, the cancer is metastatic
cancer, e.g., of the varieties described above.
The present invention also provides methods for treating or
preventing an infectious disease in a subject by administering an
effective amount of anti-LAG3 antibodies or antigen-binding
fragments thereof disclosed herein (e.g., 4A10, 19E8, 11C9 and/or
22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to
the subject which may be effective for such treatment or
prevention. In an embodiment of the invention, the infectious
disease is viral infection. In an embodiment of the invention, the
infectious disease is bacterial infection. In an embodiment of the
invention, the infectious disease is parasitic infection. In an
embodiment of the invention, the infectious disease is fungal
infection.
The present invention includes methods of treating any of the
cancers or infectious diseases discussed herein by administering a
therapeutically effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., 4A10, 19E8, 11C9 and/or
22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9)
optionally in association with any of the further chemotherapeutic
agents or therapeutic procedures discussed herein as well as
compositions including such an antibody or fragment in association
with such a further chemotherapeutic agent.
In an embodiment of the invention, the viral infection is infection
with a virus selected from the group consisting of human
immunodeficiency virus (HIV), ebola virus, hepatitis virus (A, B,
or C), herpes virus (e.g., VZV, HSV-I, HAV-6, HSV-II, and CMV,
Epstein Barr virus), adenovirus, influenza virus, flaviviruses,
echovirus, rhinovirus, coxsackie virus, coronavirus, respiratory
syncytial virus, mumps virus, rotavirus, measles virus, rubella
virus, parvovirus, vaccinia virus, HTLV virus, dengue virus,
papillomavirus, molluscum virus, poliovirus, rabies virus, JC virus
or arboviral encephalitis virus.
In an embodiment of the invention, the bacterial infection is
infection with a bacteria selected from the group consisting of
Chlamydia, rickettsial bacteria, mycobacteria, staphylococci,
streptococci, pneumonococci, meningococci and gonococci,
klebsiella, proteus, serratia, pseudomonas, Legionella,
Corynebacterium diphtheriae, Salmonella, bacilli, Vibrio cholerae,
Clostridium tetan, Clostridium botulinum, Bacillus anthricis,
Yersinia pestis, Mycobacterium leprae, Mycobacterium lepromatosis,
and Borriella.
In an embodiment of the invention, the fungal infection is
infection with a fungus selected from the group consisting of
Candida (albicans, krusei, glabrata, tropicalis, etc.),
Cryptococcus neoformans, Aspergillus (fumigatus, niger, etc.),
Genus Mucorales (mucor, absidia, rhizopus), Sporothrix schenkii,
Blastomyces dermatitidis, Paracoccidioides brasiliensis,
Coccidioides immitis and Histoplasma capsulatum.
In an embodiment of the invention, the parasitic infection is
infection with a parasite selected from the group consisting of
Entamoeba histolytica, Balantidium coli, Naegleria fowleri,
Acanthamoeba, Giardia Zambia, Cryptosporidium, Pneumocystis
carinii, Plasmodium vivax, Babesia microti, Trypanosoma brucei,
Trypanosoma cruzi, Leishmania donovani, Toxoplasma gondii,
Nippostrongylus brasiliensis.
In addition, the present invention provides a method for preventing
or inhibiting LAG3 binding to MEW class II, enhancing
antigen-specific T-cell activation or stimulating T-cell production
of interleukin-2 in a subject (e.g., human), for example, wherein
the subject suffers from cancer or infectious disease (e.g., as
discussed herein) comprising administering an effective amount of
anti-LAG3 antibody or antigen-binding fragment thereof (e.g., 4A10,
19E8, 11C9, 22D2, Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or
Ab9, to the subject, optionally, in association with a further
chemotherapeutic agent, e.g., pembrolizumab or nivolumab.
The scope of the present invention provides uses of the anti-LAG3
antibodies or antigen-binding fragments thereof disclosed herein
(e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5,
Ab6, Ab7, Ab8 and/or Ab9) in the manufacture of a medicament for
treating cancer or infectious disease in a subject.
The present invention includes methods for treating or preventing
osteosarcoma comprising administering (optionally, in association
with pembrolizumab or nivolumab) an effective amount of an
anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as
a human, in need thereof.
The present invention includes methods for treating or preventing
rhabdomyosarcoma comprising administering (optionally, in
association with pembrolizumab or nivolumab) an effective amount of
an anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as
a human, in need thereof.
The present invention includes methods for treating or preventing
neuroblastoma comprising administering (optionally, in association
with pembrolizumab or nivolumab) an effective amount of an
anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as
a human, in need thereof.
The present invention includes methods for treating or preventing
kidney cancer comprising administering (optionally, in association
with pembrolizumab or nivolumab) an effective amount of an
anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as
a human, in need thereof.
The present invention includes methods for treating or preventing
leukemia comprising administering (optionally, in association with
pembrolizumab or nivolumab) an effective amount of an anti-LAG3
antibody or antigen-binding fragment thereof of the present
invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3,
Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human,
in need thereof.
The present invention includes methods for treating or preventing
renal transitional cell cancer comprising administering
(optionally, in association with pembrolizumab or nivolumab) an
effective amount of an anti-LAG3 antibody or antigen-binding
fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9
and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or
Ab9) to a subject, such as a human, in need thereof.
The present invention includes methods for treating or preventing
bladder cancer comprising administering (optionally, in association
with pembrolizumab or nivolumab) an effective amount of an
anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as
a human, in need thereof.
The present invention includes methods for treating or preventing
Wilm's cancer comprising administering (optionally, in association
with pembrolizumab or nivolumab) an effective amount of an
anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as
a human, in need thereof.
The present invention includes methods for treating or preventing
ovarian cancer comprising administering (optionally, in association
with pembrolizumab or nivolumab) an effective amount of an
anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as
a human, in need thereof.
The present invention includes methods for treating or preventing
pancreatic cancer comprising administering (optionally, in
association with pembrolizumab or nivolumab) an effective amount of
an anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as
a human, in need thereof.
The present invention includes methods for treating or preventing
breast cancer comprising administering (optionally, in association
with pembrolizumab or nivolumab) an effective amount of an
anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as
a human, in need thereof. In an embodiment of the invention, the
method for treating or preventing breast cancer comprises
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention in
association with an anthracycline (e.g., doxorubicin and/or
epirubicin) and/or a taxane (e.g., paclitaxel and/or docetaxel).
Optionally, an anthracycline and taxane is in association with
5-fluorouracil (5-FU), cyclophosphamide, and carboplatin. In an
embodiment of the invention, wherein the breast cancer is HER2
positive, the anti-LAG3 antibody or fragment is administered in
association with trastuzumab, optionally with a taxane and/or
pertuzumab.
The present invention includes methods for treating or preventing
prostate cancer comprising administering (optionally, in
association with pembrolizumab or nivolumab) an effective amount of
an anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as
a human, in need thereof.
The present invention includes methods for treating or preventing
bone cancer comprising administering (optionally, in association
with pembrolizumab or nivolumab) an effective amount of an
anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as
a human, in need thereof.
The present invention includes methods for treating or preventing
lung cancer comprising administering (optionally, in association
with pembrolizumab or nivolumab) an effective amount of an
anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as
a human, in need thereof. In an embodiment of the invention, the
method for treating or preventing lung cancer comprises
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention in
association with bevacizumab and/or cetuximab.
The present invention includes methods for treating or preventing
non-small cell lung cancer comprising administering (optionally, in
association with pembrolizumab or nivolumab) an effective amount of
an anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as
a human, in need thereof. In an embodiment of the invention, the
method for treating or preventing non-small cell lung cancer
comprises administering an effective amount of an anti-LAG3
antibody or antigen-binding fragment thereof of the present
invention in association with cisplatin, carboplatin, paclitaxel,
albumin-bound paclitaxel, docetaxel, gemcitabine, vinorelbine,
irinotecan, etoposide, vinblastine, and/or pemetrexed.
The present invention includes methods for treating or preventing
gastric cancer comprising administering (optionally, in association
with pembrolizumab or nivolumab) an effective amount of an
anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as
a human, in need thereof.
The present invention includes methods for treating or preventing
colorectal cancer comprising administering (optionally, in
association with pembrolizumab or nivolumab) an effective amount of
an anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as
a human, in need thereof. In an embodiment of the invention, the
method for treating or preventing colorectal cancer comprises
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention in
association with 5-Fluorouracil (5-FU), capecitabine, irinotecan
and/or oxaliplatin (e.g., FOLFOX, FOLFIRI, FOLFOXIRI or
CapeOx).
The present invention includes methods for treating or preventing
cervical cancer comprising administering (optionally, in
association with pembrolizumab or nivolumab) an effective amount of
an anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as
a human, in need thereof.
The present invention includes methods for treating or preventing
synovial sarcoma comprising administering (optionally, in
association with pembrolizumab or nivolumab) an effective amount of
an anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as
a human, in need thereof.
The present invention includes methods for treating or preventing
head and neck cancer comprising administering (optionally, in
association with pembrolizumab or nivolumab) an effective amount of
an anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as
a human, in need thereof.
The present invention includes methods for treating or preventing
squamous cell carcinoma comprising administering (optionally, in
association with pembrolizumab or nivolumab) an effective amount of
an anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as
a human, in need thereof.
The present invention includes methods for treating or preventing
multiple myeloma comprising administering (optionally, in
association with pembrolizumab or nivolumab) an effective amount of
an anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as
a human, in need thereof.
The present invention includes methods for treating or preventing
renal cell cancer comprising administering (optionally, in
association with pembrolizumab or nivolumab) an effective amount of
an anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as
a human, in need thereof.
The present invention includes methods for treating or preventing
retinoblastoma comprising administering (optionally, in association
with pembrolizumab or nivolumab) an effective amount of an
anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as
a human, in need thereof.
The present invention includes methods for treating or preventing
hepatoblastoma comprising administering (optionally in association
with pembrolizumab or nivolumab) an effective amount of an
anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as
a human, in need thereof.
The present invention includes methods for treating or preventing
hepatocellular carcinoma comprising administering (optionally, in
association with pembrolizumab or nivolumab) an effective amount of
an anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as
a human, in need thereof.
The present invention includes methods for treating or preventing
melanoma comprising administering (optionally, in association with
pembrolizumab or nivolumab) an effective amount of an anti-LAG3
antibody or antigen-binding fragment thereof of the present
invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3,
Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human,
in need thereof.
The present invention includes methods for treating or preventing
rhabdoid tumor of the kidney comprising administering (optionally,
in association with pembrolizumab or nivolumab) an effective amount
of an anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as
a human, in need thereof.
The present invention includes methods for treating or preventing
Ewing's sarcoma comprising administering (optionally, in
association with pembrolizumab or nivolumab) an effective amount of
an anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as
a human, in need thereof.
The present invention includes methods for treating or preventing
chondrosarcoma comprising administering (optionally in association
with pembrolizumab or nivolumab) an effective amount of an
anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as
a human, in need thereof.
The present invention includes methods for treating or preventing
brain cancer comprising administering (optionally, in association
with pembrolizumab or nivolumab) an effective amount of an
anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as
a human, in need thereof.
The present invention includes methods for treating or preventing
glioblastoma comprising administering (optionally, in association
with pembrolizumab or nivolumab) an effective amount of an
anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as
a human, in need thereof. In an embodiment of the invention, the
method for treating or preventing glioblastoma multiforme comprises
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention in
association with temozolomide.
The present invention includes methods for treating or preventing
meningioma comprising administering (optionally, in association
with pembrolizumab or nivolumab) an effective amount of an
anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as
a human, in need thereof.
The present invention includes methods for treating or preventing
pituitary adenoma comprising administering (optionally, in
association with pembrolizumab or nivolumab) an effective amount of
an anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as
a human, in need thereof.
The present invention includes methods for treating or preventing
vestibular schwannoma comprising administering (optionally, in
association with pembrolizumab or nivolumab) an effective amount of
an anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as
a human, in need thereof.
The present invention includes methods for treating or preventing a
primitive neuroectodermal tumor comprising administering
(optionally, in association with pembrolizumab or nivolumab) an
effective amount of an anti-LAG3 antibody or antigen-binding
fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9
and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or
Ab9) to a subject, such as a human, in need thereof.
The present invention includes methods for treating or preventing
medulloblastoma comprising administering (optionally, in
association with pembrolizumab or nivolumab) an effective amount of
an anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as
a human, in need thereof.
The present invention includes methods for treating or preventing
astrocytoma comprising administering (optionally, in association
with pembrolizumab or nivolumab) an effective amount of an
anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as
a human, in need thereof.
The present invention includes methods for treating or preventing
anaplastic astrocytoma comprising administering (optionally, in
association with pembrolizumab or nivolumab) an effective amount of
an anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as
a human, in need thereof. In an embodiment of the invention, the
method for treating or preventing refractory anaplastic astrocytoma
comprises administering an effective amount of an anti-LAG3
antibody or antigen-binding fragment thereof of the present
invention in association with temozolomide.
The present invention includes methods for treating or preventing
oligodendroglioma comprising administering (optionally, in
association with pembrolizumab or nivolumab) an effective amount of
an anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as
a human, in need thereof.
The present invention includes methods for treating or preventing
ependymoma comprising administering (optionally, in association
with pembrolizumab or nivolumab) an effective amount of an
anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as
a human, in need thereof.
The present invention includes methods for treating or preventing
choroid plexus papilloma comprising administering (optionally, in
association with pembrolizumab or nivolumab) an effective amount of
an anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as
a human, in need thereof.
The present invention includes methods for treating or preventing
polycythemia vera comprising administering (optionally, in
association with pembrolizumab or nivolumab) an effective amount of
an anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as
a human, in need thereof.
The present invention includes methods for treating or preventing
thrombocythemia comprising administering (optionally, in
association with pembrolizumab or nivolumab) an effective amount of
an anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as
a human, in need thereof.
The present invention includes methods for treating or preventing
idiopathic myelfibrosis comprising administering (optionally, in
association with pembrolizumab or nivolumab) an effective amount of
an anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as
a human, in need thereof.
The present invention includes methods for treating or preventing
soft tissue sarcoma comprising administering (optionally, in
association with pembrolizumab or nivolumab) an effective amount of
an anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as
a human, in need thereof.
The present invention includes methods for treating or preventing
thyroid cancer comprising administering (optionally, in association
with pembrolizumab or nivolumab) an effective amount of an
anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as
a human, in need thereof.
The present invention includes methods for treating or preventing
endometrial cancer comprising administering (optionally, in
association with pembrolizumab or nivolumab) an effective amount of
an anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as
a human, in need thereof.
The present invention includes methods for treating or preventing
carcinoid cancer comprising administering (optionally, in
association with pembrolizumab or nivolumab) an effective amount of
an anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as
a human, in need thereof.
The present invention includes methods for treating or preventing
liver cancer comprising administering (optionally, in association
with pembrolizumab or nivolumab) an effective amount of an
anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as
a human, in need thereof.
The present invention includes methods for treating or preventing
breast cancer (e.g., characterized by a mutation in BRCA1 and/or
BRCA2) comprising administering (optionally, in association with
pembrolizumab or nivolumab) an effective amount of an anti-LAG3
antibody or antigen-binding fragment thereof of the present
invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3,
Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human,
in need thereof.
The present invention includes methods for treating or preventing
gastric cancer comprising administering (optionally, in association
with pembrolizumab or nivolumab) an effective amount of an
anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as
a human, in need thereof.
The present invention includes methods for treating or preventing
an infection with human immunodeficiency virus (HIV) in a subject
comprising administering) an effective amount of an anti-LAG3
antibody or antigen-binding fragment thereof of the present
invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3,
Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human,
in need thereof. Optionally, the subject is administered an
anti-viral therapeutic agent such as a protease inhibitor, a
nucleoside/nucleotide reverse transcriptase inhibitor, a
non-nucleoside reverse transcriptase inhibitors, an entry
inhibitor, a fusion inhibitor or an integrase inhibitors.
The present invention includes methods for treating or preventing
an infection with Bundibugyo virus (BDBV), Sudan virus (SUDV),
TaiForest virus (TAFV) and/or ebola virus in a subject comprising
administering) an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof. Optionally, the subject is administered an anti-viral
therapeutic agent, such as one or more antibodies that specifically
bind to the BDBV, SUDV, TAFV or ebola virus or a nucleoside RNA
polymerase inhibitor; or a vaccine.
The present invention includes methods for treating or preventing
an infection with hepatitis A virus in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof. Optionally, the subject is administered an anti-viral
therapeutic agent.
The present invention includes methods for treating or preventing
an infection with hepatitis B virus in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof. Optionally, the subject is administered an anti-viral
therapeutic agent.
The present invention includes methods for treating or preventing
an infection with hepatitis C virus in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof. Optionally, the subject is administered an anti-viral
therapeutic agent such as interferon and/or ribavirin.
The present invention includes methods for treating or preventing
an infection with herpes virus in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof. Optionally, the subject is administered an anti-viral
therapeutic agent.
The present invention includes methods for treating or preventing
an infection with vesicular stomatitis virus in a subject
comprising administering an effective amount of an anti-LAG3
antibody or antigen-binding fragment thereof of the present
invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3,
Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human,
in need thereof. Optionally, the subject is administered an
anti-viral therapeutic agent.
The present invention includes methods for treating or preventing
an infection with herpes simplex virus-I in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof. Optionally, the subject is administered an anti-viral
therapeutic agent.
The present invention includes methods for treating or preventing
an infection with HAV-6 virus in a subject comprising administering
an effective amount of an anti-LAG3 antibody or antigen-binding
fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9
and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or
Ab9) to a subject, such as a human, in need thereof. Optionally,
the subject is administered an anti-viral therapeutic agent.
The present invention includes methods for treating or preventing
an infection with herpes simplex virus-II in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof. Optionally, the subject is administered an anti-viral
therapeutic agent.
The present invention includes methods for treating or preventing
an infection with cytomegalovirus (CMV) in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof. Optionally, the subject is administered an anti-viral
therapeutic agent.
The present invention includes methods for treating or preventing
an infection with epstein Barr virus in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof. Optionally, the subject is administered an anti-viral
therapeutic agent.
The present invention includes methods for treating or preventing
an infection with adenovirus in a subject comprising administering
an effective amount of an anti-LAG3 antibody or antigen-binding
fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9
and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or
Ab9) to a subject, such as a human, in need thereof. Optionally,
the subject is administered an anti-viral therapeutic agent.
The present invention includes methods for treating or preventing
an infection with influenza virus in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof. Optionally, the subject is administered an anti-viral
therapeutic agent.
The present invention includes methods for treating or preventing
an infection with flavivirus in a subject comprising administering
an effective amount of an anti-LAG3 antibody or antigen-binding
fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9
and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or
Ab9) to a subject, such as a human, in need thereof. Optionally,
the subject is administered an anti-viral therapeutic agent.
The present invention includes methods for treating or preventing
an infection with echovirus in a subject comprising administering
an effective amount of an anti-LAG3 antibody or antigen-binding
fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9
and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or
Ab9) to a subject, such as a human, in need thereof. Optionally,
the subject is administered an anti-viral therapeutic agent.
The present invention includes methods for treating or preventing
an infection with rhinovirus in a subject comprising administering
an effective amount of an anti-LAG3 antibody or antigen-binding
fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9
and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or
Ab9) to a subject, such as a human, in need thereof. Optionally,
the subject is administered an anti-viral therapeutic agent.
The present invention includes methods for treating or preventing
an infection with coxsackie virus in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof. Optionally, the subject is administered an anti-viral
therapeutic agent.
The present invention includes methods for treating or preventing
an infection with coronavirus in a subject comprising administering
an effective amount of an anti-LAG3 antibody or antigen-binding
fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9
and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or
Ab9) to a subject, such as a human, in need thereof. Optionally,
the subject is administered an anti-viral therapeutic agent.
The present invention includes methods for treating or preventing
an infection with respiratory syncytial virus in a subject
comprising administering an effective amount of an anti-LAG3
antibody or antigen-binding fragment thereof of the present
invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3,
Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human,
in need thereof. Optionally, the subject is administered an
anti-viral therapeutic agent.
The present invention includes methods for treating or preventing
an infection with mumps virus in a subject comprising administering
an effective amount of an anti-LAG3 antibody or antigen-binding
fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9
and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or
Ab9) to a subject, such as a human, in need thereof. Optionally,
the subject is administered an anti-viral therapeutic agent.
The present invention includes methods for treating or preventing
an infection with rotavirus in a subject comprising administering
an effective amount of an anti-LAG3 antibody or antigen-binding
fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9
and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or
Ab9) to a subject, such as a human, in need thereof. Optionally,
the subject is administered an anti-viral therapeutic agent.
The present invention includes methods for treating or preventing
an infection with measles virus in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof. Optionally, the subject is administered an anti-viral
therapeutic agent.
The present invention includes methods for treating or preventing
an infection with rubella virus in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof. Optionally, the subject is administered an anti-viral
therapeutic agent.
The present invention includes methods for treating or preventing
an infection with parvovirus in a subject comprising administering
an effective amount of an anti-LAG3 antibody or antigen-binding
fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9
and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or
Ab9) to a subject, such as a human, in need thereof. Optionally,
the subject is administered an anti-viral therapeutic agent.
The present invention includes methods for treating or preventing
an infection with vaccinia virus in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof. Optionally, the subject is administered an anti-viral
therapeutic agent.
The present invention includes methods for treating or preventing
an infection with human T-lymphotropic virus (HTLV) in a subject
comprising administering an effective amount of an anti-LAG3
antibody or antigen-binding fragment thereof of the present
invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3,
Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human,
in need thereof. Optionally, the subject is administered an
anti-viral therapeutic agent.
The present invention includes methods for treating or preventing
an infection with dengue virus in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof. Optionally, the subject is administered an anti-viral
therapeutic agent.
The present invention includes methods for treating or preventing
an infection with papillomavirus in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof. Optionally, the subject is administered an anti-viral
therapeutic agent.
The present invention includes methods for treating or preventing
an infection with molluscum virus in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof. Optionally, the subject is administered an anti-viral
therapeutic agent.
The present invention includes methods for treating or preventing
an infection with poliovirus in a subject comprising administering
an effective amount of an anti-LAG3 antibody or antigen-binding
fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9
and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or
Ab9) to a subject, such as a human, in need thereof. Optionally,
the subject is administered an anti-viral therapeutic agent.
The present invention includes methods for treating or preventing
an infection with rabies virus in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof. Optionally, the subject is administered an anti-viral
therapeutic agent.
The present invention includes methods for treating or preventing
an infection with John Cunningham virus (JC virus) in a subject
comprising administering an effective amount of an anti-LAG3
antibody or antigen-binding fragment thereof of the present
invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3,
Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human,
in need thereof. Optionally, the subject is administered an
anti-viral therapeutic agent.
The present invention includes methods for treating or preventing
an infection with arboviral encephalitis virus in a subject
comprising administering an effective amount of an anti-LAG3
antibody or antigen-binding fragment thereof of the present
invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3,
Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human,
in need thereof. Optionally, the subject is administered an
anti-viral therapeutic agent.
The present invention includes methods for treating or preventing
an infection with Chlamydia trachomatis in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof. Optionally, the subject is administered an anti-bacterial
antibiotic.
The present invention includes methods for treating or preventing
an infection with rickettsia bacteria in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof. Optionally, the subject is administered an anti-bacterial
antibiotic.
The present invention includes methods for treating or preventing
an infection with mycobacteria in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof. Optionally, the subject is administered an anti-bacterial
antibiotic.
The present invention includes methods for treating or preventing
an infection with staphylococci in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof. Optionally, the subject is administered an anti-bacterial
antibiotic.
The present invention includes methods for treating or preventing
an infection with streptococci in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof. Optionally, the subject is administered an anti-bacterial
antibiotic.
The present invention includes methods for treating or preventing
an infection with pneumonococci in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof. Optionally, the subject is administered an anti-bacterial
antibiotic.
The present invention includes methods for treating or preventing
an infection with meningococci in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof. Optionally, the subject is administered an anti-bacterial
antibiotic.
The present invention includes methods for treating or preventing
an infection with gonococci in a subject comprising administering
an effective amount of an anti-LAG3 antibody or antigen-binding
fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9
and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or
Ab9) to a subject, such as a human, in need thereof. Optionally,
the subject is administered an anti-bacterial antibiotic.
The present invention includes methods for treating or preventing
an infection with klebsiella in a subject comprising administering
an effective amount of an anti-LAG3 antibody or antigen-binding
fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9
and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or
Ab9) to a subject, such as a human, in need thereof. Optionally,
the subject is administered an anti-bacterial antibiotic.
The present invention includes methods for treating or preventing
an infection with proteus (e.g., P. vulgaris, P. mirabilis, or P.
penneri) in a subject comprising administering an effective amount
of an anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as
a human, in need thereof. Optionally, the subject is administered
an anti-bacterial antibiotic.
The present invention includes methods for treating or preventing
an infection with serratia in a subject comprising administering an
effective amount of an anti-LAG3 antibody or antigen-binding
fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9
and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or
Ab9) to a subject, such as a human, in need thereof. Optionally,
the subject is administered an anti-bacterial antibiotic.
The present invention includes methods for treating or preventing
an infection with pseudomonas in a subject comprising administering
an effective amount of an anti-LAG3 antibody or antigen-binding
fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9
and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or
Ab9) to a subject, such as a human, in need thereof. Optionally,
the subject is administered an anti-bacterial antibiotic.
The present invention includes methods for treating or preventing
an infection with legionella in a subject comprising administering
an effective amount of an anti-LAG3 antibody or antigen-binding
fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9
and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or
Ab9) to a subject, such as a human, in need thereof. Optionally,
the subject is administered an anti-bacterial antibiotic.
The present invention includes methods for treating or preventing
an infection with Corynebacterium diphtheriae in a subject
comprising administering an effective amount of an anti-LAG3
antibody or antigen-binding fragment thereof of the present
invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3,
Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human,
in need thereof. Optionally, the subject is administered an
anti-bacterial antibiotic.
The present invention includes methods for treating or preventing
an infection with Salmonella (e.g., Salmonella bongori or
Salmonella enterica) in a subject comprising administering an
effective amount of an anti-LAG3 antibody or antigen-binding
fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9
and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or
Ab9) to a subject, such as a human, in need thereof. Optionally,
the subject is administered an anti-bacterial antibiotic.
The present invention includes methods for treating or preventing
an infection with bacilli in a subject comprising administering an
effective amount of an anti-LAG3 antibody or antigen-binding
fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9
and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or
Ab9) to a subject, such as a human, in need thereof. Optionally,
the subject is administered an anti-bacterial antibiotic.
The present invention includes methods for treating or preventing
an infection with Vibrio cholerae in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof. Optionally, the subject is administered an anti-bacterial
antibiotic.
The present invention includes methods for treating or preventing
an infection with Clostridium tetani in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof. Optionally, the subject is administered an anti-bacterial
antibiotic.
The present invention includes methods for treating or preventing
an infection with Clostridium botulinum in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof. Optionally, the subject is administered an anti-bacterial
antibiotic.
The present invention includes methods for treating or preventing
an infection with Bacillus anthracis in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof. Optionally, the subject is administered an anti-bacterial
antibiotic.
The present invention includes methods for treating or preventing
an infection with Yersinia pestis in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof. Optionally, the subject is administered an anti-bacterial
antibiotic.
The present invention includes methods for treating or preventing
an infection with Leptospira in a subject comprising administering
an effective amount of an anti-LAG3 antibody or antigen-binding
fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9
and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or
Ab9) to a subject, such as a human, in need thereof. Optionally,
the subject is administered an anti-bacterial antibiotic.
The present invention includes methods for treating or preventing
an infection with Borrelia in a subject comprising administering an
effective amount of an anti-LAG3 antibody or antigen-binding
fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9
and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or
Ab9) to a subject, such as a human, in need thereof. Optionally,
the subject is administered an anti-bacterial antibiotic.
The present invention includes methods for treating or preventing
an infection with Candida albicans in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof. Optionally, the subject is administered an anti-fungal
therapeutic agent.
The present invention includes methods for treating or preventing
an infection with Candida krusei in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof. Optionally, the subject is administered an anti-fungal
therapeutic agent.
The present invention includes methods for treating or preventing
an infection with Candida glabrata in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof. Optionally, the subject is administered an anti-fungal
therapeutic agent.
The present invention includes methods for treating or preventing
an infection with Candida tropicalis in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof. Optionally, the subject is administered an anti-fungal
therapeutic agent.
The present invention includes methods for treating or preventing
an infection with Cryptococcus neoformans in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof. Optionally, the subject is administered an anti-fungal
therapeutic agent.
The present invention includes methods for treating or preventing
an infection with Aspergillus fumigatus in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof. Optionally, the subject is administered an anti-fungal
therapeutic agent.
The present invention includes methods for treating or preventing
an infection with Aspergillus niger in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof. Optionally, the subject is administered an anti-fungal
therapeutic agent.
The present invention includes methods for treating or preventing
an infection with Mucorales mucor in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof. Optionally, the subject is administered an anti-fungal
therapeutic agent.
The present invention includes methods for treating or preventing
an infection with Mucorales absidia in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof. Optionally, the subject is administered an anti-fungal
therapeutic agent.
The present invention includes methods for treating or preventing
an infection with Mucorales rhizopus in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof. Optionally, the subject is administered an anti-fungal
therapeutic agent.
The present invention includes methods for treating or preventing
an infection with Sporothrix schenkii in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof. Optionally, the subject is administered an anti-fungal
therapeutic agent.
The present invention includes methods for treating or preventing
an infection with Blastomyces dermatitidis in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof. Optionally, the subject is administered an anti-fungal
therapeutic agent.
The present invention includes methods for treating or preventing
an infection with Paracoccidioides brasiliensis in a subject
comprising administering an effective amount of an anti-LAG3
antibody or antigen-binding fragment thereof of the present
invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3,
Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human,
in need thereof. Optionally, the subject is administered an
anti-fungal therapeutic agent.
The present invention includes methods for treating or preventing
an infection with Coccidioides immitis in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof. Optionally, the subject is administered an anti-fungal
therapeutic agent.
The present invention includes methods for treating or preventing
an infection with Histoplasma capsulatum in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof. Optionally, the subject is administered an anti-fungal
therapeutic agent.
The present invention includes methods for treating or preventing
an infection with Entamoeba histolytica in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof.
The present invention includes methods for treating or preventing
an infection with Balantidium coli in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof.
The present invention includes methods for treating or preventing
an infection with Naegleria fowleri in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof.
The present invention includes methods for treating or preventing
an infection with Acanthamoeba sp. in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof.
The present invention includes methods for treating or preventing
an infection with Giardia Zambia in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof.
The present invention includes methods for treating or preventing
an infection with Cryptosporidium sp. in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof.
The present invention includes methods for treating or preventing
an infection with Pneumocystis carinii in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof.
The present invention includes methods for treating or preventing
an infection with Plasmodium vivax in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof.
The present invention includes methods for treating or preventing
an infection with Babesia microti in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof.
The present invention includes methods for treating or preventing
an infection with Trypanosoma brucei in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof.
The present invention includes methods for treating or preventing
an infection with Trypanosoma cruzi in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof.
The present invention includes methods for treating or preventing
an infection with Leishmania donovani in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof.
The present invention includes methods for treating or preventing
an infection with Toxoplasma gondii in a subject comprising
administering an effective amount of an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need
thereof.
The present invention includes methods for treating or preventing
an infection with Nippostrongylus brasiliensis in a subject
comprising administering an effective amount of an anti-LAG3
antibody or antigen-binding fragment thereof of the present
invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3,
Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human,
in need thereof.
A "subject" is a mammal such as, for example, a human, dog, cat,
horse, cow, mouse, rat, monkey (e.g., cynomolgous monkey, e.g.,
Macaca fascicularis or Macaca mulatta) or rabbit.
In particular embodiments, the anti-LAG3 antibodies (e.g.,
humanized antibodies such as antagonist humanized antibodies) or
antigen-binding fragments thereof of the present invention which
are disclosed herein (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g.,
Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) may be used
alone, or in association with other, further therapeutic agents
and/or therapeutic procedures, for treating or preventing any
disease such as cancer, e.g., as discussed herein, in a subject in
need of such treatment or prevention. Compositions or kits, e.g.,
pharmaceutical compositions comprising a pharmaceutically
acceptable carrier, comprising such antibodies and fragments in
association with further therapeutic agents are also part of the
present invention.
In particular embodiments, the anti-LAG3 antibodies (e.g.,
humanized antibody such as antagonist humanized antibodies) or
antigen-binding fragments thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) may be used in association with an anti-cancer
therapeutic agent or immunomodulatory drug such as an
immunomodulatory receptor inhibitor, e.g., an antibody or
antigen-binding fragment thereof that specifically binds to the
receptor.
In an embodiment of the invention, an anti-LAG3 antibody (e.g.,
humanized antibodies such as antagonist humanized antibodies) or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with one or more of an
inhibitors (e.g., a small organic molecule or an antibody or
antigen-binding fragment thereof) such as: an MTOR (mammalian
target of rapamycin) inhibitor, a cytotoxic agent, a platinum agent
a BRAF inhibitor, a CDK4/6 inhibitor an EGFR inhibitor, a VEGF
inhibitor, a microtubule stabilizer, a taxane, a CD20 inhibitor, a
CD52 inhibitor, a CD30 inhibitor, a RANK (Receptor activator of
nuclear factor kappa-B) inhibitor, a RANKL (Receptor activator of
nuclear factor kappa-B ligand) inhibitor, an ERK inhibitor, a MAP
Kinase inhibitor, an AKT inhibitor, a MEK inhibitor, a PI3K
inhibitor, a HER1 inhibitor, a HER2 inhibitor, a HER3 inhibitor, a
HER4 inhibitor, a Bcl2 inhibitor, a CD22 inhibitor, a CD79b
inhibitor, an ErbB2 inhibitor, or a farnesyl protein transferase
inhibitor.
In an embodiment of the invention, an anti-LAG3 antibody (e.g.,
humanized antibody such as antagonist humanized antibodies) or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with one or more of:
anti-PD1 (e.g., pembrolizumab, nivolumab, CT-011), anti-PDL1,
anti-CTLA4, anti-TIM3, anti-CS1, (e.g., elotuzumab),
anti-KIR2DL1/2/3 (e.g., lirilumab), anti-CD27, anti-CD137 (e.g.,
urelumab), anti-GITR (e.g., TRX518), anti-PD-L1 (e.g., BMS-936559,
MSB0010718C or MPDL3280A), anti-PD-L2, anti-ILT1, anti-ILT2,
anti-ILT3, anti-ILT4, anti-ILT5, anti-ILT6, anti-ILT7, anti-ILT8,
anti-CD40, anti-OX40, anti-CD137, anti-KIR2DL1, anti-KIR2DL2/3,
anti-KIR2DL4, anti-KIR2DL5A, anti-KIR2DL5B, anti-KIR3DL1,
anti-KIR3DL2, anti-KIR3DL3, anti-NKG2A, anti-NKG2C, anti-NKG2E, or
any small organic molecule inhibitor of such targets; IL-10,
anti-IL10, anti-TSLP (thymic stromal lymphopoietin) or PEGylated
IL-10.
In an embodiment of the invention, the molecular weight of the
polyethylene glycol (PEG) moiety, on a PEGylated IL-10 molecule, is
about 12,000 daltons or about 20,000 daltons. In an embodiment of
the invention, PEGylated IL-10 (e.g., PEGylated human IL-10)
comprises one or more polyethylene glycol molecules covalently
attached via a linker (e.g., C.sub.2-12 alkyl such as
--CH.sub.2CH.sub.2CH.sub.2--) to a single amino acid residue of a
single subunit of IL-10, wherein said amino acid residue is the
alpha amino group of the N-terminal amino acid residue or the
epsilon amino group of a lysine residue. In an embodiment of the
invention PEGylated IL-10 is: (PEG) .sub.b-L-NH-IL-10; wherein b is
1-9 and L is a C.sub.2-12 alkyl linker moiety covalently attached
to a nitrogen (N) of the single amino acid residue of the IL-10. In
an embodiment of the invention, the IL-10 of PEGylated IL-10 has
the formula: [X--O(CH.sub.2CH.sub.2O).sub.n].sub.b-L-NH-IL-10,
wherein X is H or C.sub.1-4 alkyl; n is 20 to 2300; b is 1 to 9;
and L is a C.sub.1-11 alkyl linker moiety which is covalently
attached to the nitrogen (N) of the alpha amino group at the amino
terminus of one IL-10 subunit; provided that when b is greater than
1, the total of n does not exceed 2300. See U.S. Pat. No.
7,052,686.
In an embodiment of the invention, the anti-IL-10 antibody or
antigen-binding fragment thereof (e.g., humanized antibody)
comprises the CDRs set forth below:
TABLE-US-00054 CDR-L1: (SEQ ID NO: 465) KTSQNIFENLA CDR-L2: (SEQ ID
NO: 466) NASPLQA CDR-L3: (SEQ ID NO: 467) HQYYSGYT CDR-H1: (SEQ ID
NO: 468) GFTFSDYHMA CDR-H2: (SEQ ID NO: 469) SITLDATYTYYRDSVRG
CDR-H3: (SEQ ID NO: 470) HRGFSVWLDY
(See U.S. Pat. No. 7,662,379)
In an embodiment of the invention, the anti-TSLP antibody or
antigen-binding fragment thereof (e.g., humanized antibody)
comprises the CDRs set forth below:
TABLE-US-00055 CDR-H1: (SEQ ID NO: 428) GYIFTDYAMH; CDR-H2: (SEQ ID
NO: 429) TFIPLLDTSDYNQNFK; CDR-H3: (SEQ ID NO: 430) MGVTHSYVMDA;
CDR-L1: (SEQ ID NO: 431) RASQPISISVH; CDR-L2: (SEQ ID NO: 432)
FASQSIS; CDR-L3: (SEQ ID NO: 433) QQTFSLPYT;
(see WO2008/76321)
In an embodiment of the invention, the anti-CD27 antibody or
antigen-binding fragment thereof (e.g., humanized antibody)
comprises the CDRs set forth below:
TABLE-US-00056 CDR-H1: (SEQ ID NO: 420) GFIIKATYMH; CDR-H2: (SEQ ID
NO: 421) RIDPANGETKYDPKFQV; CDR-H3: (SEQ ID NO: 422) YAWYFDV;
CDR-L1: (SEQ ID NO: 423) RASENIYSFLA; CDR-L2: (SEQ ID NO: 424)
HAKTLAE; CDR-L3: (SEQ ID NO: 425) QHYYGSPLT;
(See WO2012/04367).
Thus, the present invention includes compositions comprising an
anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) in association with
pembrolizumab; as well as methods for treating or preventing cancer
in a subject comprising administering an effective amount of the
anti-LAG3 antibody or antigen-binding fragment thereof in
association with pembrolizumab (e.g., pembrolizumab dosed at 200 mg
once every three weeks) to the subject. Optionally, the subject is
also administered in association with a another further therapeutic
agent.
In an embodiment of the invention, an anti-LAG3 antibody (e.g.,
humanized antibody such as antagonist humanized antibodies) or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with a pembrolizumab
antibody which comprises an immunoglobulin heavy chain (or CDR-H1,
CDR-H2 and CDR-H3 thereof) comprising the amino acid sequence:
TABLE-US-00057 (SEQ ID NO: 41)
QVQLVQSGVEVKKPGASVKVSCKASGYTFTNYYMYWVRQAPGQGLEWMGG
INPSNGGTNFNEKFKNRVTLTTDSSTTTAYMELKSLQFDDTAVYYCARRD
YREDMGEDYWGQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVK
DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKT
YTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDT
LMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTY
RVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYT
LPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS
DGSFFLYSRLTVDKSRWQEGNVESCSVMHEALHNHYTQKSLSLSLGK;
and an immunoglobulin light chain (or CDR-L1, CDR-L2 and CDR-L3
thereof) comprising the amino acid sequence:
TABLE-US-00058 (SEQ ID NO: 42)
EIVLTQSPATLSLSPGERATLSCRASKGVSTSGYSYLHWYQQKPGQAPRL
LTYLASYLESGVPARFSGSGSGTDFTLTISSLEPEDFAVYYCQHSRDLPL
TEGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNEYPREAKV
QWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEV
THQGLSSPVTKSFNRGEC.
In an embodiment of the invention, an anti-LAG3 antibody (e.g.,
humanized antibody such as antagonist humanized antibodies) or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with an antibody comprising
an immunoglobulin heavy chain (or CDR-H1, CDR-H2 and CDR-H3
thereof) comprising the amino acid sequence:
TABLE-US-00059 (SEQ ID NO: 43)
QVQLVESGGGVVQPGRSLRLDCKASGITESNSGMHWVRQAPGKGLEWVAV
IWYDGSKRYYADSVKGRFTISRDNSKNTLFLQMNSLRAEDTAVYYCATND
DYWGQGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPV
TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDH
KPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTP
EVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLT
VLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEE
MTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY
SRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK;
and an immunoglobulin light chain (or CDR-L1, CDR-L2 and CDR-L3
thereof) comprising the amino acid sequence:
TABLE-US-00060 (SEQ ID NO: 44)
EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYD
ASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQSSNWPRTFGQ
GTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKV
DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQG
LSSPVTKSFNRGEC.
In an embodiment of the invention, an anti-LAG3 antibody (e.g.,
humanized antibody such as antagonist humanized antibodies) or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with any one or more of:
13-cis-retinoic acid,
3-[5-(methylsulfonylpiperadinemethyl)-indolyl]-quinolone,
4-hydroxytamoxifen, 5-deooxyuridine, 5'-deoxy-5-fluorouridine,
5-fluorouracil, 6-mecaptopurine, 7-hydroxystaurosporine, A-443654,
abirateroneacetate, abraxane, ABT-578, acolbifene, ADS-100380,
aflibercept, ALT-110, altretamine, amifostine, aminoglutethimide,
amrubicin, amsacrine, anagrelide, anastrozole, angiostatin,
AP-23573, ARQ-197, arzoxifene, AS-252424, AS-605240, asparaginase,
ATI3387, AT-9263, atrasentan, axitinib, AZD1152, Bacillus
Calmette-Guerin (BCG) vaccine, batabulin, BC-210, besodutox,
bevacizumab, BGJ398, bicalutamide, Bio111, BIO140, BKM120,
bleomycin, BMS-214662, BMS-247550, BMS-275291, BMS-310705,
bortezimib, buserelin, busulfan, calcitriol, camptothecin,
canertinib, capecitabine, carboplatin, carmustine, CC8490, CEA
(recombinant vaccinia-carcinoembryonic antigen vaccine), cediranib,
CG-1521, CG-781, chlamydocin, chlorambucil, chlorotoxin,
cilengitide, cimitidine, cisplatin, cladribine, clodronate,
cobimetnib, COL-3, CP-724714, cyclophosphamide, cyproterone,
cyproteroneacetate, cytarabine, cytosinearabinoside, dabrafenib,
dacarbazine, dacinostat, dactinomycin, dalotuzumab, danusertib,
dasatanib, daunorubicin, decatanib, deguelin, denileukin,
deoxycoformycin, depsipeptide, diarylpropionitrile,
diethylstilbestrol, diftitox, DNE03, docetaxel, dovitinib,
doxorubicin, droloxifene, edotecarin, yttrium-90
labeled-edotreotide, edotreotide, EKB-569, EMD121974, encorafenib,
endostatin, enzalutamide, enzastaurin, epirubicin, epithilone B,
ERA-923, erbitux, erlotinib, estradiol, estramustine, etoposide,
everolimus, exemestane, ficlatuzumab, finasteride, flavopiridol,
floxuridine, fludarabine, fludrocortisone, fluoxymesterone,
flutamide, FOLFOX regimen, fulvestrant, galeterone, ganetespib,
gefitinib, gemcitabine, gimatecan, glucopyranosyl lipid A,
goserelin, goserelin acetate, gossypol, GSK461364, GSK690693,
EMIR-3339, hydroxyprogesteronecaproate, hydroxyurea, IC87114,
idarubicin, idoxyfene, ifosfamide, IM862, imatinib, IMC-1C11,
imiquimod, INC280, INCB24360, INO1001, interferon, interleukin-2,
interleukin-12, ipilimumab, irinotecan, JNJ-16241199, ketoconazole,
KRX-0402, lapatinib, lasofoxifene, LEE011, letrozole, leucovorin,
leuprolide, leuprolide acetate, levamisole, liposome entrapped
paclitaxel, lomustine, lonafarnib, lucanthone, LY292223, LY292696,
LY293646, LY293684, LY294002, LY317615, LY3009120, marimastat,
mechlorethamine, medroxyprogesteroneacetate, megestrolacetate,
MEK162, melphalan, mercaptopurine, mesna, methotrexate,
mithramycin, mitomycin, mitotane, mitoxantrone, a suspension of
heat killed Mycobacterium obuense, tozasertib, MLN8054, natitoclax,
neovastat, Neratinib, neuradiab, nilotinib, nilutimide, nolatrexed,
NVP-BEZ235, oblimersen, octreotide, ofatumumab, oregovomab,
ornatuzumab, orteronel, oxaliplatin, paclitaxel, palbociclib,
pamidronate, panitumumab, pazopanib, PD0325901, PD184352,
PEG-interferon, pemetrexed, pentostatin, perifosine,
phenylalaninemustard, PI-103, pictilisib, PIK-75, pipendoxifene,
PKI-166, plicamycin, poly-ICLC, porfimer, prednisone, procarbazine,
progestins, PSK protein bound polysaccharide (derived from
Basidiomycete coriolus versicolor), PLX8394, PX-866, R-763,
raloxifene, raltitrexed, razoxin, ridaforolimus, rituximab,
romidepsin, RTA744, rubitecan, scriptaid, Sdx102, seliciclib,
selumetinib, semaxanib, SF1126, sirolimus, SN36093, sorafenib,
spironolactone, squalamine, SR13668, streptozocin, SU6668,
suberoylanalide hydroxamic acid, sunitinib, synthetic estrogen,
talampanel, talimogene laherparepvec, tamoxifen, temozolomide,
temsirolimus, teniposide, tesmilifene, testosterone, tetrandrine,
TGX-221, thalidomide, 6-thioguanine, thiotepa, ticilimumab,
tipifarnib, tivozanib, TKI-258, TLK286, TNF.alpha. (tumor necrosis
factor alpha), topotecan, toremifene citrate, trabectedin,
trametinib, trastuzumab, tretinoin, trichostatin A,
triciribinephosphate monohydrate, triptorelin pamoate, TSE-424,
uracil mustard, valproic acid, valrubicin, vandetanib, vatalanib,
VEGF trap, vemurafenib, vinblastine, vincristine, vindesine,
vinorelbine, vitaxin, vitespan, vorinostat, VX-745, wortmannin,
Xr311, Z-100 hot water extract of Bacillus tuberculosis,
zanolimumab, ZK186619, ZK-304709, ZM336372 or ZSTK474.
In an embodiment of the invention, an anti-LAG3 antibody (e.g.,
humanized antibody such as antagonist humanized antibodies) or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with one or more antiemetics
including, but not limited to: casopitant (GlaxoSmithKline),
Netupitant (MGI-Helsinn) and other NK-1 receptor antagonists,
palonosetron (sold as Aloxi by MGI Pharma), aprepitant (sold as
Emend by Merck and Co.; Rahway, N.J.), diphenhydramine (sold as
Benadryl.RTM. by Pfizer; New York, N.Y.), hydroxyzine (sold as
Atarax.RTM. by Pfizer; New York, N.Y.), metoclopramide (sold as
Reglan.RTM. by A H Robins Co; Richmond, Va.), lorazepam (sold as
Ativan.RTM. by Wyeth; Madison, N.J.), alprazolam (sold as
Xanax.RTM. by Pfizer; New York, N.Y.), haloperidol (sold as
Haldol.RTM. by Ortho-McNeil; Raritan, N.J.), droperidol
(Inapsine.RTM.), dronabinol (sold as Marinol.RTM. by Solvay
Pharmaceuticals, Inc.; Marietta, Ga.), dexamethasone (sold as
Decadron.RTM. by Merck and Co.; Rahway, N.J.), methylprednisolone
(sold as Medrol.RTM. by Pfizer; New York, N.Y.), prochlorperazine
(sold as Compazine.RTM. by Glaxosmithkline; Research Triangle Park,
N.C.), granisetron (sold as Kytril.RTM. by Hoffmann-La Roche Inc.;
Nutley, N.J.), ondansetron (sold as Zofran.RTM. by by
Glaxosmithkline; Research Triangle Park, N.C.), dolasetron (sold as
Anzemet.RTM. by Sanofi-Aventis; New York, N.Y.), tropisetron (sold
as Navoban.RTM. by Novartis; East Hanover, N.J.).
Other side effects of cancer treatment include red and white blood
cell deficiency. Accordingly, in an embodiment of the invention, an
anti-LAG3 antibody (e.g., humanized antibody such as antagonist
humanized antibodies) or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) is in association
with an agent which treats or prevents such a deficiency, such as,
e.g., filgrastim, PEG-filgrastim, erythropoietin, epoetin alfa or
darbepoetin alfa.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with a vaccine. In an
embodiment of the invention, the vaccine is an anti-cancer vaccine,
a peptide vaccine or a DNA vaccine. For example, in an embodiment
of the invention, the vaccine is a tumor cell (e.g., an irradiated
tumor cell) or a dendritic cell (e.g., a dendritic cell pulsed with
a tumor peptide).
In an embodiment of the invention, an anti-LAG3 antibody (e.g.,
humanized antibody such as antagonist humanized antibodies) or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is administered in association with a
therapeutic procedure. A therapeutic procedure is one or more steps
carried out by a physician or clinician in treating a subject which
is intended to alleviate one or more symptoms (e.g., of cancer
and/or infectious disease) in the treated subject, whether by
inducing the regression or elimination of such symptoms or by
inhibiting the progression of such symptom(s), e.g., cancer
symptoms such as tumor growth or metastasis, by any clinically
measurable degree.
In an embodiment of the invention, a therapeutic procedure is
anti-cancer radiation therapy. For example, in an embodiment of the
invention, the radiation therapy is external beam therapy (EBT): a
method for delivering a beam of high-energy X-rays to the location
of the tumor. The beam is generated outside the patient (e.g., by a
linear accelerator) and is targeted at the tumor site. These X-rays
can destroy the cancer cells and careful treatment planning allows
the surrounding normal tissues to be spared. No radioactive sources
are placed inside the patient's body. In an embodiment of the
invention, the radiation therapy is proton beam therapy: a type of
conformal therapy that bombards the diseased tissue with protons
instead of X-rays. In an embodiment of the invention, the radiation
therapy is conformal external beam radiation therapy: a procedure
that uses advanced technology to tailor the radiation therapy to an
individual's body structures.
In an embodiment of the invention, the radiation therapy is
brachytherapy: the temporary placement of radioactive materials
within the body, usually employed to give an extra dose--or
boost--of radiation to an area.
In an embodiment of the invention, a surgical procedure
administered in association with an anti-LAG3 antibody (e.g.,
humanized antibody such as antagonist humanized antibodies) or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is surgical tumorectomy.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with an MTOR (mammalian
target of rapamycin) inhibitor.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with a cytotoxic agent.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with a platinum agent.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with an EGFR inhibitor.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with a VEGF inhibitor.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with a microtubule
stabilizer.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with a taxane a CD20
inhibitor.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with a CD52 inhibitor.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with a CD30 inhibitor.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with a RANK (Receptor
activator of nuclear factor kappa-B) inhibitor.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with a RANKL (Receptor
activator of nuclear factor kappa-B ligand) inhibitor.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with a BRAF inhibitor, e.g.,
for treatment of melanoma.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with an a CDK4/6 inhibitor,
e.g., for treatment of melanoma.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with an ERK inhibitor.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with a MAP Kinase
inhibitor.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with an AKT inhibitor.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with a MEK inhibitor, e.g.,
for treatment of melanoma.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with a PI3K inhibitor.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with a HER1 inhibitor.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with a HER2 inhibitor.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with a HER3 inhibitor.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with a HER4 inhibitor.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with a Bcl2 inhibitor.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with a CD22 inhibitor.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with a CD79b inhibitor.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with an ErbB2 inhibitor.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with a farnesyl protein
transferase inhibitor.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with anti-PD1.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with nivolumab.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with CT-011.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with anti-PDL1.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with anti-CTLA4.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with anti-TIM3.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with anti-CS1.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with elotuzumab.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with anti-KIR2DL1/2/3.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with lirilumab.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with an anti-CD137 antibody
or antigen-binding fragment thereof, e.g., an agonist anti-CD137
antibody or fragment.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with urelumab.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with anti-GITR.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with TRX518.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with anti-PD-L1.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with BMS-936559.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with MSB0010718C.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with MPDL3280A.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with anti-PD-L2.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with anti-ILT1.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with anti-ILT2.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with anti-ILT3.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with anti-ILT4.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with anti-ILT5.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with anti-ILT6.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with anti-ILT7.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with anti-ILT8.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with anti-CD40.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with anti-OX40.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with anti-CD137.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with anti-KIR2DL1.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
antagonist humanized antibodies) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with anti-KIR2DL2/3.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with anti-KIR2DL4.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with anti-KIR2DL5A.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with anti-KIR2DL5B.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with anti-KIR3DL1.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with anti-KIR3DL2.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with anti-KIR3DL3.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with anti-NKG2A.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with anti-NKG2C.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with anti-NKG2E.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with IL-10.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with anti-IL10.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with anti-TSLP (thymic
stromal lymphopoietin).
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with PEGylated IL-10. In an
embodiment of the invention, PEGylated-IL-10 is administered to the
subject at a dose of up to 20 micrograms/kg (e.g., 1, 2, 3, 4, 5,
6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20
micrograms/kg). For example, up to 20 micrograms/kg daily, e.g.,
for up to four (e.g., 1, 2, 3 or 4) 28 day cycles--e.g., 20
micrograms/kg/day for four 28 day cycles.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with 13-cis-retinoic
acid.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with
3-[5-(methylsulfonylpiperadinemethyl)-indolyl]-quinolone.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with 4-hydroxytamoxifen.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with 5-deooxyuridine.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with
5'-deoxy-5-fluorouridine.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with 5-fluorouracil.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with 6-mecaptopurine.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with
7-hydroxystaurosporine.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with A-443654.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with abirateroneacetate.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with abraxane.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with ABT-578.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with acolbifene.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with ADS-100380.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with ALT-110.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with altretamine.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with amifostine.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with aminoglutethimide.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with amrubicin.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with Amsacrine.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with anagrelide.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with anastrozole.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with angiostatin.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with AP-23573.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with ARQ-197.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with arzoxifene.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with AS-252424.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with AS-605240.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with asparaginase.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with AT-9263.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with atrasentan.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with axitinib.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with AZD1152.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with Bacillus
Calmette-Guerin (BCG) vaccine.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with batabulin.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with BC-210.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with besodutox.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with bevacizumab.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with bicalutamide.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with Bio111.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with BIO140.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with bleomycin.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with BMS-214662.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with BMS-247550.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with BMS-275291.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with BMS-310705.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with bortezimib.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with buserelin.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with busulfan.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with calcitriol.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with camptothecin.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with canertinib.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with capecitabine.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with carboplatin.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with carmustine.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with CC8490.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with CEA (recombinant
vaccinia-carcinoembryonic antigen vaccine).
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with cediranib.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with CG-1521.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with CG-781.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with chlamydocin.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with chlorambucil.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with chlorotoxin.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with cilengitide.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with cimitidine.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with cisplatin.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with cladribine.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with clodronate.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with COL-3.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with CP-724714.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with cyclophosphamide.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with cyproterone.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with cyproteroneacetate.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with cytarabine.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with
cytosinearabinoside.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with dacarbazine.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with dacinostat.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with dactinomycin.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with dalotuzumab.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with danusertib.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with dasatanib.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with daunorubicin.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with decatanib.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with deguelin.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with denileukin.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with deoxycoformycin.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with depsipeptide.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with
diarylpropionitrile.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with diethylstilbestrol.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with diftitox.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with docetaxel.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with dovitinib.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with doxorubicin.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with droloxifene.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with edotecarin.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with yttrium-90
labeled-edotreotide.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with edotreotide.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with EKB-569.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with EMD121974.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with endostatin.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with enzalutamide.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with enzastaurin.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with epirubicin.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with epithilone B.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with ERA-923.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with Cetuximab.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with erlotinib.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with estradiol.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with estramustine.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with etoposide. In an
embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with everolimus.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with exemestane.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with ficlatuzumab.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with finasteride.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with flavopiridol.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with floxuridine.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with fludarabine.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with fludrocortisone.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with fluoxymesterone.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with flutamide.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with FOLFOX regimen.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with fulvestrant.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with galeterone.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with gefitinib.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with gemcitabine.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with gimatecan.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with glycopyranosyl lipid
A.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with goserelin.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with goserelin acetate.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with gossypol.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with GSK461364.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with GSK690693.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with HMR-3339.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with
hydroxyprogesteronecaproate.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with hydroxyurea.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with IC87114.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with idarubicin.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with idoxyfene.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with ifosfamide.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with IM862.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with imatinib.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with imiquimod.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with IMC-1C11.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with INCB24360.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with INO1001.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with interferon.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with interleukin-2
(IL-2).
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with interleukin-12
(IL-12).
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with ipilimumab.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with irinotecan.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with JNJ-16241199.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with ketoconazole.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with KRX-0402.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with lapatinib.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with lasofoxifene.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with letrozole.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with leucovorin.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with leuprolide.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with leuprolide acetate.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with levamisole.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with liposome entrapped
paclitaxel.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with lomustine.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with lonafarnib.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with lucanthone.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with LY292223.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with LY292696.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with LY293646.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with LY293684.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with LY294002.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with LY317615.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with marimastat.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with mechlorethamine.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with
medroxyprogesteroneacetate.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with megestrolacetate.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with melphalan.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with mercaptopurine.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with mesna.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with methotrexate.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with mithramycin.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with mitomycin.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with mitotane.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with mitoxantrone.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with tozasertib.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with a suspension of heat
killed Mycobacterium obuense.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with MLN8054.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with neovastat.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with Neratinib.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with neuradiab.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with nilotinib.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with nilutimide.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with nolatrexe.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with NVP-BEZ235.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with oblimersen.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with octreotide.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with ofatumumab.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with oregovomab.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with orteronel.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with oxaliplatin.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with paclitaxel.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with palbociclib.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with pamidronate.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with panitumumab.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with pazopanib.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with PD0325901.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with PD184352.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with PEG-interferon.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with pemetrexed.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with pentostatin.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with perifosine.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with phenylalanine
mustard.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with PI-103.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with pictilisib.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with PIK-75.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with pipendoxifene.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with PKI-166.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with plicamycin.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with poly-ICLC.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with porfimer.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with prednisone.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with procarbazine.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with progestins.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with PSK protein bound
polysaccharide (derived from Basidiomycete coriolus
versicolor).
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with PX-866.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with R-763.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with raloxifene.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with raltitrexed.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with razoxin.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with ridaforolimus.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with rituximab.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with romidepsin.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with RTA744.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with rubitecan.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with scriptaid.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with Sdx102.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with seliciclib.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with selumetinib.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with semaxanib.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with SF1126.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with sirolimus.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with SN36093.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with sorafenib.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with spironolactone.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with squalamine.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with SR13668.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with streptozocin.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with SU6668.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with suberoylanalide
hydroxamic acid.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with sunitinib.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with synthetic estrogen.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with talampanel.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with talimogene
laherparepvec.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with tamoxifen.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with temozolomide.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with temsirolimus.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with teniposide.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with tesmilifene.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with testosterone.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with tetrandrine.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with TGX-221.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with thalidomide.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with 6-thioguanine.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with thiotepa.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with ticilimumab.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with tipifarnib.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with tivozanib.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with TKI-258.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with TLK286.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with topotecan.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with toremifene citrate.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with trabectedin.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with trastuzumab.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with tretinoin.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with trichostatin A.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with triciribinephosphate
monohydrate.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with triptorelin
pamoate.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with TSE-424.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with tumor necrosis factor
alpha (TNF.alpha.).
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with uracil mustard.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with valproic acid.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with valrubicin.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with vandetanib.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with vatalanib.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with VEGF trap.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with vinblastine.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with vincristine.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with vindesine.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with vinorelbine.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with vitaxin.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with vitespan.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with vorinostat.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with VX-745.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with wortmannin.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with Xr311.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with zanolimumab.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with Z-100 hot water extract
of Bacillus tuberculosis.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with ZK186619.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with ZK-304709.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with ZM336372.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with ZSTK474.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with casopitant.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with netupitant.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with an NK-1 receptor
antagonist.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with palonosetron.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with aprepitant.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with diphenhydramine.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with hydroxyzine.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with metoclopramide.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with lorazepam.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with alprazolam.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with haloperidol.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with droperidol.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with dronabinol.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with dexamethasone.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with methylprednisolone.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with prochlorperazine.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with granisetron.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with ondansetron.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with dolasetron.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with tropisetron.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with filgrastim.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with PEG-filgrastim.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with erythropoietin.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with epoetin alfa.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with darbepoetin alfa.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with dabrafenib.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with trametinib.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with vemurafenib.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with cobimetnib.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with LY3009120.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with DNE03.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with ATI13387.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with ganetespib.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with encorafenib.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with MEK162.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with BKM120.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with LEE011.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with BGJ398.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with INC280.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with PLX8394.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with ornatuzumab.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with natitoclax.
In an embodiment of the invention, an anti-LAG3 antibody or
antigen-binding fragment thereof (e.g., humanized antibody such as
an antagonist humanized antibody) of the present invention (e.g.,
4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6,
Ab7, Ab8 and/or Ab9) is in association with aflibercept.
The term "in association with" indicates that the components, an
anti-LAG3 antibody (e.g., humanized antibody such as antagonist
humanized antibodies) or antigen-binding fragment thereof of the
present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) along with another
agent such as pembrolizumab or nivolumab, can be formulated into a
single composition, e.g., for simultaneous delivery, or formulated
separately into two or more compositions (e.g., a kit). Each
component can be administered to a subject at a different time than
when the other component is administered; for example, each
administration may be given non-simultaneously (e.g., separately or
sequentially) at intervals over a given period of time. Moreover,
the separate components may be administered to a subject by the
same or by a different route (e.g., wherein an anti-LAG3 antibody
(e.g., humanized antibody such as antagonist humanized antibodies)
or antigen-binding fragment thereof (e.g., 4A10, 19E8, 11C9 and/or
22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is
administered parenterally and paclitaxel is administered
orally).
Assays and Experimental and Diagnostic Uses
The present invention includes any method for forming a complex
between an anti-LAG3 antibody or antigen-binding fragment thereof
of the present invention and LAG3 (e.g., human or cynomolgous
monkey LAG3) comprising contacting the LAG3 polypeptide with the
anti-LAG3 antibody or fragment under conditions suitable for
binding and complex formation.
The anti-LAG3 antibodies (e.g., humanized antibodies such as
antagonist humanized antibodies) and antigen-binding fragments
thereof disclosed herein (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g.,
Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) may be used as
affinity purification agents. In this process, the anti-LAG3
antibodies and antigen-binding fragments thereof are immobilized on
a solid phase such a sephadex, glass or agarose resin or filter
paper, using methods well known in the art. The immobilized
antibody or fragment is contacted with a sample containing the LAG3
protein (or a fragment thereof) to be purified, and, thereafter,
the support is washed with a suitable solvent that will remove
substantially all of the material in the sample except the LAG3
protein which is bound to the immobilized antibody or fragment.
Finally, the support is washed with a solvent which elutes the
bound LAG3 (e.g., protein A). Such immobilized antibodies and
fragments form part of the present invention.
The present invention provides methods for using the anti-LAG3
antibodies and antigen-binding fragments thereof of the present
invention to determine the extent of T-cell activation that a
particular subject is having or could have in the present of the
antibody or fragment. For example, embodiments of the invention
include methods including (i) contacting T-cells (e.g., CD4+
T-cells) from a subject with superantigen (e.g., any one or more of
a staphylococcal superantigen such as SEA, SEB (Staphylococcus
enterotoxin B), SEC2, SEC3, SED, SEH and/or TSST; and/or any one or
more of a streptococcal superantigen such as SPE-A, SPE-C, SPE-H
and/or SMEZ-2), e.g., at a concentration of 500 pg/ml or more, such
as about 10 ng/ml or 100 ng/ml, in the presence of the anti-LAG3
antibody or fragment (optionally, the T-cells are pre-incubated
with the superantigen (e.g., SEB) and antibody or fragment for
about 48 or 72 hours) and (ii) determining the level of production
of cytokine (e.g., TNF-alpha, GM-C SF, IFN-gamma and/or IL-2)
production of said T-cells; wherein the level of production of said
cytokine(s) indicates the level of T-cell activation in the present
of the antibody or fragment. Subjects possessing T-cells which
exhibit cytokine production (e.g., high levels of cytokine
production such as an anti-LAG3-dependent increase thereof) in the
presence of superantigen and antibody are considered superior
candidates for receipt of the antibody or fragment as a therapy,
e.g., for treating cancer or infection. In an embodiment of the
invention, such superior candidates are selected for receipt of the
antibody or fragment. In an embodiment of the invention, such
superior candidates are administered an effective amount of the
antibody or fragment. In an embodiment of the invention, the method
includes the step of isolating the T-cells from the blood of the
subject. In an embodiment of the invention, the T-cells are
contacted with anti-LAG3 antibody or antigen-binding fragment
thereof of the present invention and pembrolizumab.
Further provided are antigens for generating secondary antibodies
which are useful, for example, for performing Western blots and
other immunoassays discussed herein. In particular, polypeptides
are disclosed which comprise the variable regions and/or CDR
sequences of an anti-LAG3 antibody or fragment disclosed herein
(e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5,
Ab6, Ab7, Ab8 and/or Ab9) and which may be used to generate
anti-idiotypic antibodies for use in specifically detecting the
presence of the antibody, e.g., in a therapeutic context.
The present invention includes cell-based ELISA methods using the
anti-LAG3 antibodies and antigen-binding fragments thereof of the
present invention. In an embodiment of the invention, the method
includes the steps: (i) contacting cells (e.g., cells or tissue
taken from a tumor, e.g., which include lymphocytes suspected of
expressing LAG3) immobilized to a solid surface (e.g., a
microplate) to be tested for the presence of LAG3 with an anti-LAG3
antibody or antigen-binding fragment thereof of the present
invention, (ii) optionally washing the mixture to remove unbound
anti-LAG3 antibody or fragment, (iii) contacting the anti-LAG3
antibody or fragment with a labeled secondary antibody or
antigen-binding fragment thereof that binds to the anti-LAG3
antibody or fragment, (iv) optionally washing the complex to remove
unbound antibodies or fragments and (v) detecting the presence of
the label on the secondary antibody or fragment; wherein detection
of the label indicates that the cells contain LAG3. For example,
the present invention includes such cell-based ELISA methods for
identifying LAG3+ cells in a tumor sample.
The present invention includes ELISA assays (enzyme-linked
immunosorbent assay) incorporating the use of an anti-LAG3 antibody
(e.g., humanized antibodies such as antagonist humanized
antibodies) or antigen-binding fragment thereof disclosed herein
(e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5,
Ab6, Ab7, Ab8 and/or Ab9).
For example, such a method comprises the following steps:
(a) coat a substrate (e.g., surface of a microtiter plate well,
e.g., a plastic plate) with anti-LAG3 antibody (e.g., humanized
antibodies such as antagonist humanized antibodies) or
antigen-binding fragment thereof (e.g., 4A10, 19E8, 11C9 and/or
22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9); (b)
apply a sample to be tested for the presence of LAG3 to the
substrate (e.g., cells taken from a tumor, e.g., which include
lymphocytes suspected of expressing LAG3); (c) wash the plate, so
that unbound material in the sample is removed; (d) apply
detectably labeled antibodies (e.g., enzyme-linked antibodies)
which are also specific to the LAG3 antigen; (e) wash the
substrate, so that the unbound, labeled antibodies are removed; (f)
if the labeled antibodies are enzyme linked, apply a chemical which
is converted by the enzyme into a fluorescent signal; and (g)
detect the presence of the labeled antibody.
Detection of the label associated with the substrate indicates the
presence of the LAG3 protein. The ELISA methods can also be used
identifying LAG3+ cells in a tumor sample.
In a further embodiment, the labeled antibody or antigen-binding
fragment thereof is labeled with peroxidase which react with ABTS
(e.g., 2,2'-azino-bis(3-ethylbenzthiazoline-6-sulphonic acid)) or
3,3',5,5'-Tetramethylbenzidine to produce a color change which is
detectable. Alternatively, the labeled antibody or fragment is
labeled with a detectable radioisotope (e.g., .sup.3H) which can be
detected by scintillation counter in the presence of a
scintillant.
An anti-LAG3 antibody (e.g., humanized antibodies such as
antagonist humanized antibodies) or antigen-binding fragment
thereof of the invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g.,
Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) may be used in a
Western blot or immune-protein blot procedure. Such a procedure
forms part of the present invention and includes e.g.,
(1) providing a membrane or other solid substrate comprising a
sample to be tested for the presence of LAG3, e.g., optionally
including the step of transferring proteins from a sample to be
tested for the presence of LAG3 (e.g., from a PAGE or SDS-PAGE
electrophoretic separation of the proteins in the sample) onto a
membrane or other solid substrate using a method known in the art
(e.g., semi-dry blotting or tank blotting); and contacting the
membrane or other solid substrate to be tested for the presence of
bound LAG3 or a fragment thereof with an anti-LAG3 antibody or
antigen-binding fragment thereof of the invention.
Such a membrane may take the form, for example, of a nitrocellulose
or vinyl-based (e.g., polyvinylidene fluoride (PVDF)) membrane to
which the proteins to be tested for the presence of LAG3 in a
non-denaturing PAGE (polyacrylamide gel electrophoresis) gel or
SDS-PAGE (sodium dodecyl sulfate polyacrylamide gel
electrophoresis) gel have been transferred (e.g., following
electrophoretic separation in the gel). Before contacting the
membrane with the anti-LAG3 antibody or fragment, the membrane is
optionally blocked, e.g., with non-fat dry milk or the like so as
to bind non-specific protein binding sites on the membrane.
(2) washing the membrane one or more times to remove unbound
anti-LAG3 antibody or fragment and other unbound substances;
and
(3) detecting the bound anti-LAG3 antibody or fragment.
Detection of the bound antibody or fragment indicates that the LAG3
protein is present on the membrane or substrate and in the sample.
Detection of the bound antibody or fragment may be by binding the
antibody or fragment with a secondary antibody (an
anti-immunoglobulin antibody) which is detectably labeled and,
then, detecting the presence of the secondary antibody label.
The anti-LAG3 antibodies (e.g., humanized antibodies such as
antagonist humanized antibodies) and antigen-binding fragments
thereof disclosed herein (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g.,
Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) may also be used
for immunohistochemistry. Such a method forms part of the present
invention and comprises, e.g.,
(1) contacting tissue comprising TILs and tumor cells (e.g.,
melanoma tumor) to be tested for the presence of LAG3 protein with
an anti-LAG3 antibody or antigen-binding fragment thereof of the
invention; and
(2) detecting the antibody or fragment on or in the TILs.
If the antibody or fragment itself is detectably labeled, it can be
detected directly. Alternatively, the antibody or fragment may be
bound by a detectably labeled secondary antibody wherein the label
is then detected.
Certain anti-LAG3 antibodies and antigen-binding fragments thereof
disclosed herein (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1,
Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) may also be used for
in vivo tumor imaging. Such a method may include injection of a
detectably labeled, e.g., radiolabeled, anti-LAG3 antibody or
antigen-binding fragment thereof (as discussed herein) into the
body of a patient to be tested for the presence of a tumor
associated with LAG3 expression (e.g., which expresses LAG3, for
example, on tumor infiltrating lymphocytes (TILs)) followed by
imagine, e.g., nuclear imaging, of the body of the patient to
detect the presence of the labeled antibody or fragment e.g., at
loci comprising a high concentration of the antibody or fragment
which are bound to or associated with the tumor. The detection of
the loci indicates the presence of the LAG3.sup.+ TILs in a
tumor.
Imaging techniques include SPECT imaging (single photon emission
computed tomography) or PET imaging (positron emission tomography).
Labels include e.g., iodine-123 (.sup.123I) and technetium-99m
(.sup.99mTc), e.g., in conjunction with SPECT imaging or .sup.11C,
.sup.13N, .sup.15O or .sup.18F, e.g., in conjunction with PET
imaging or Indium-111 (See e.g., Gordon et al., (2005)
International Rev. Neurobiol. 67:385-440).
The present invention provide a method for determining whether a
tumor in a subject is sensitive to treatment with an anti-LAG3
antibody or antigen-binding fragment thereof of the present
invention comprising determining whether the LAG3 is expressed in
or on the tumor infiltrating lymphocytes (TILs) and, if said
expression is identified, determining that the tumor is sensitive
to said treatment. The TILs can be determined to express LAG3 using
any of the methods set forth herein, e.g., ELISA or in vivo
imaging. In an embodiment of the invention, the method comprises
the step of obtaining a sample of said tumor tissue before making
the determination of LAG3 expression is done. For example, in an
embodiment of the invention, the sample is obtained surgically,
e.g., by biopsy, for example, needle biopsy or partial tumorectomy.
In an embodiment of the invention, LAG3 expression is determined by
contacting the TILs with the antibody or fragment and detecting the
presence of the antibody or fragment bound to the tumor tissue or
fragment.
Pharmaceutical Compositions and Administration
To prepare pharmaceutical or sterile compositions of the anti-LAG3
antibodies (e.g., humanized antibodies such as antagonist humanized
antibodies) and antigen-binding fragments thereof (e.g., 4A10,
19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7,
Ab8 and/or Ab9), the antibody or antigen-binding fragment thereof
is admixed with a pharmaceutically acceptable carrier or excipient.
See, e.g., Remington's Pharmaceutical Sciences and U.S.
Pharmacopeia: National Formulary, Mack Publishing Company, Easton,
Pa. (1984). Such compositions are part of the present
invention.
The scope of the present invention includes dessicated, e.g.,
freeze-dried, compositions comprising an anti-LAG3 antibody or
antigen-binding fragment thereof or a pharmaceutical composition
thereof that includes a pharmaceutically acceptable carrier but
substantially lacks water.
Formulations of therapeutic and diagnostic agents may be prepared
by mixing with acceptable carriers, excipients, or stabilizers in
the form of, e.g., lyophilized powders, slurries, aqueous solutions
or suspensions (see, e.g., Hardman, et al. (2001) Goodman and
Gilman's The Pharmacological Basis of Therapeutics, McGraw-Hill,
New York, N.Y.; Gennaro (2000) Remington: The Science and Practice
of Pharmacy, Lippincott, Williams, and Wilkins, New York, N.Y.;
Avis, et al. (eds.) (1993) Pharmaceutical Dosage Forms: Parenteral
Medications, Marcel Dekker, NY; Lieberman, et al. (eds.) (1990)
Pharmaceutical Dosage Forms: Tablets, Marcel Dekker, NY; Lieberman,
et al. (eds.) (1990) Pharmaceutical Dosage Forms: Disperse Systems,
Marcel Dekker, NY; Weiner and Kotkoskie (2000) Excipient Toxicity
and Safety, Marcel Dekker, Inc., New York, N.Y.).
The present invention includes any pharmaceutical formulation
comprising an anti-LAG3 antibody or antigen-binding fragment
thereof of the present invention, and PO.sub.4.sup.2-, for example,
sodium phosphate or potassium phosphate (e.g., about 10 mM), NaCl
(e.g., about 7.5 mM) and sucrose (e.g., about 3%), e.g., having a
pH of about 7.4 or about 7.3; or NaOAc (e.g., about 20 mM), and
sucrose (about 7 or about 9%), e.g., having a pH of about 5.0.
Toxicity and therapeutic efficacy of the antibody or fragment
compositions, administered alone or in combination with another
therapeutic agent, can be determined by standard pharmaceutical
procedures in cell cultures or experimental animals, e.g., for
determining the LD.sub.50 (the dose lethal to 50% of the
population) and the ED.sub.50 (the dose effective in 50% of the
population). The dose ratio between toxic and therapeutic effects
is the therapeutic index (LD.sub.50/ED.sub.50). In particular
aspects, antibodies exhibiting high therapeutic indices are
desirable. The data obtained from these cell culture assays and
animal studies can be used in formulating a range of dosage for use
in human. The dosage of such compounds lies preferably within a
range of circulating concentrations that include the ED.sub.50 with
little or no toxicity. The dosage may vary within this range
depending upon the dosage form employed and the route of
administration.
In a further embodiment, a further therapeutic agent that is
administered to a subject in association with an anti-LAG3 antibody
(e.g., humanized antibody such as antagonist humanized antibodies)
or antigen-binding fragment thereof disclosed herein (e.g., 4A10,
19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7,
Ab8 and/or Ab9) is administered to the subject in accordance with
the Physicians' Desk Reference 2003 (Thomson Healthcare; 57th
edition (Nov. 1, 2002)).
The mode of administration can vary. Routes of administration
include oral, rectal, transmucosal, intestinal, parenteral;
intramuscular, subcutaneous, intradermal, intramedullary,
intrathecal, direct intraventricular, intravenous, intraperitoneal,
intranasal, intraocular, inhalation, insufflation, topical,
cutaneous, transdermal, or intra-arterial.
The present invention provided methods for administering an
anti-LAG3 antibody or antigen-binding fragment thereof comprising
introducing the antibody or fragment into the body of a subject.
For example, the method comprises piercing the body of the subject
with a needle of a syringe and injecting the antibody or fragment
into the body of the subject, e.g., into the vein, artery, tumor,
muscular tissue or subcutis of the subject.
The present invention provides a vessel (e.g., a plastic or glass
vial, e.g., with a cap or a chromatography column, hollow bore
needle or a syringe cylinder) comprising any of the antibodies or
antigen-binding fragments (e.g., 4A10, 19E8, 11C9 and/or 22D2;
e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9),
polypeptides or polynucleotides set forth herein or a
pharmaceutical composition thereof comprising a pharmaceutically
acceptable carrier.
The present invention also provides an injection device comprising
any of the antibodies or antigen-binding fragments, polypeptides or
polynucleotides set forth herein or a pharmaceutical composition
thereof. An injection device is a device that introduces a
substance into the body of a patient via a parenteral route, e.g.,
intramuscular, subcutaneous or intravenous. For example, an
injection device may be a syringe (e.g., pre-filled with the
pharmaceutical composition, such as an auto-injector) which, for
example, includes a cylinder or barrel for holding fluid to be
injected (e.g., comprising the antibody or fragment or a
pharmaceutical composition thereof), a needle for piecing skin
and/or blood vessels for injection of the fluid; and a plunger for
pushing the fluid out of the cylinder and through the needle bore.
In an embodiment of the invention, an injection device that
comprises an antibody or antigen-binding fragment thereof of the
present invention or a pharmaceutical composition thereof is an
intravenous (IV) injection device. Such a device includes the
antibody or fragment or a pharmaceutical composition thereof in a
cannula or trocar/needle which may be attached to a tube which may
be attached to a bag or reservoir for holding fluid (e.g., saline;
or lactated ringer solution comprising NaCl, sodium lactate, KCl,
CaCl.sub.2 and optionally including glucose) introduced into the
body of the patient through the cannula or trocar/needle. The
antibody or fragment or a pharmaceutical composition thereof may,
in an embodiment of the invention, be introduced into the device
once the trocar and cannula are inserted into the vein of a subject
and the trocar is removed from the inserted cannula. The IV device
may, for example, be inserted into a peripheral vein (e.g., in the
hand or arm); the superior vena cava or inferior vena cava, or
within the right atrium of the heart (e.g., a central IV); or into
a subclavian, internal jugular, or a femoral vein and, for example,
advanced toward the heart until it reaches the superior vena cava
or right atrium (e.g., a central venous line). In an embodiment of
the invention, an injection device is an autoinjector; a jet
injector or an external infusion pump. A jet injector uses a
high-pressure narrow jet of liquid which penetrate the epidermis to
introduce the antibody or fragment or a pharmaceutical composition
thereof to a patient's body. External infusion pumps are medical
devices that deliver the antibody or fragment or a pharmaceutical
composition thereof into a patient's body in controlled amounts.
External infusion pumps may be powered electrically or
mechanically. Different pumps operate in different ways, for
example, a syringe pump holds fluid in the reservoir of a syringe,
and a moveable piston controls fluid delivery, an elastomeric pump
holds fluid in a stretchable balloon reservoir, and pressure from
the elastic walls of the balloon drives fluid delivery. In a
peristaltic pump, a set of rollers pinches down on a length of
flexible tubing, pushing fluid forward. In a multi-channel pump,
fluids can be delivered from multiple reservoirs at multiple
rates.
The pharmaceutical compositions disclosed herein may also be
administered with a needleless hypodermic injection device; such as
the devices disclosed in U.S. Pat. Nos. 6,620,135; 6,096,002;
5,399,163; 5,383,851; 5,312,335; 5,064,413; 4,941,880; 4,790,824 or
4,596,556. Such needleless devices comprising the pharmaceutical
composition are also part of the present invention. The
pharmaceutical compositions disclosed herein may also be
administered by infusion. Examples of well-known implants and
modules for administering the pharmaceutical compositions include
those disclosed in: U.S. Pat. No. 4,487,603, which discloses an
implantable micro-infusion pump for dispensing medication at a
controlled rate; U.S. Pat. No. 4,447,233, which discloses a
medication infusion pump for delivering medication at a precise
infusion rate; U.S. Pat. No. 4,447,224, which discloses a variable
flow implantable infusion apparatus for continuous drug delivery;
U.S. Pat. No. 4,439,196, which discloses an osmotic drug delivery
system having multi-chamber compartments. Many other such implants,
delivery systems, and modules are well known to those skilled in
the art and those comprising the pharmaceutical compositions of the
present invention are within the scope of the present
invention.
Alternately, one may administer the anti-LAG3 antibody (e.g.,
humanized antibody such as antagonist humanized antibodies) or
antigen-binding fragment (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g.,
Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) in a local
rather than systemic manner, for example, via injection of the
antibody or fragment directly into a tumor, e.g., a LAG3.sup.+
tumor. Furthermore, one may administer the antibody or fragment in
a targeted drug delivery system, for example, in a liposome coated
with a tissue-specific antibody, targeting, for example, a tumor
e.g., a LAG3.sup.- tumor, e.g., characterized by immunopathology.
The liposomes will be targeted to and taken up selectively by the
afflicted tissue. Such methods and liposomes are part of the
present invention.
"Treat" or "treating" means to administer anti-LAG3 antibodies or
antigen-binding fragments thereof of the present invention, to a
subject having one or more symptoms of a disease for which the
anti-LAG3 antibodies and antigen-binding fragments are effective,
e.g., in the treatment of a subject having cancer or an infectious
disease, or being suspected of having cancer or infectious disease,
for which the agent has therapeutic activity. Typically, the
antibody or fragment is administered in an "effective amount" or
"effective dose" which will alleviate one or more symptoms (e.g.,
of cancer or infectious disease) in the treated subject or
population, whether by inducing the regression or elimination of
such symptoms or by inhibiting the progression of such symptom(s),
e.g., cancer symptoms such as tumor growth or metastasis, by any
clinically measurable degree. The effective amount of the antibody
or fragment may vary according to factors such as the disease
stage, age, and weight of the patient, and the ability of the drug
to elicit a desired response in the subject.
Antibodies (e.g., humanized antibodies such as antagonist humanized
antibodies) or antigen-binding fragments thereof disclosed herein
(e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5,
Ab6, Ab7, Ab8 and/or Ab9) may be provided by continuous infusion,
or by doses administered, e.g., daily, 1-7 times per week, weekly,
bi-weekly, monthly, bimonthly, quarterly, semiannually, annually
etc. Doses may be provided, e.g., intravenously, subcutaneously,
topically, orally, nasally, rectally, intramuscular,
intracerebrally, intraspinally, or by inhalation. An effective dose
of an anti-LAG3 antibody or antigen-binding fragment thereof of the
present invention, is from about 0.1 mg/kg (body weight) to about
100 mg/kg (body weight), e.g., for treatment or prevention of
cancer or infectious diseases. In an embodiment of the invention,
an effective dose for treatment of a medical condition, wherein
overexpression of LAG3 occurs, is the dose at which complete
saturation of the LAG3 antigen occurs in the body of the subject,
e.g., on T-cells within tumors of the subject or wherein there is
about 10% saturation or more than about 10%.
Determination of the appropriate dose is made by the clinician,
e.g., using parameters or factors known or suspected in the art to
affect treatment. Generally, in determining the dose, the dose
begins with an amount somewhat less than the optimum dose and it is
increased by small increments thereafter until the desired or
optimum effect is achieved relative to any negative side effects.
Important diagnostic measures include those of symptoms of, e.g.,
the inflammation or level of inflammatory cytokines produced. In
general, it is desirable that a biologic that will be used is
derived from the same species as the animal targeted for treatment,
thereby minimizing any immune response to the reagent. In the case
of human subjects, for example, chimeric, humanized and fully human
antibodies are may be desirable. Guidance in selecting appropriate
doses of anti-LAG3 antibodies or fragments is available (see, e.g.,
Wawrzynczak (1996) Antibody Therapy, Bios Scientific Pub. Ltd,
Oxfordshire, UK; Kresina (ed.) (1991) Monoclonal Antibodies,
Cytokines and Arthritis, Marcel Dekker, New York, N.Y.; Bach (ed.)
(1993) Monoclonal Antibodies and Peptide Therapy in Autoimmune
Diseases, Marcel Dekker, New York, N.Y.; Baert et al. (2003) New
Engl. J. Med. 348:601-608; Milgrom et al. (1999) New Engl. J. Med.
341:1966-1973; Slamon et al. (2001) New Engl. J. Med. 344:783-792;
Beniaminovitz et al. (2000) New Engl. J. Med. 342:613-619; Ghosh et
al. (2003) New Engl. J. Med. 348:24-32; Lipsky et al. (2000) New
Engl. J. Med. 343:1594-1602).
Whether a disease symptom has been alleviated can be assessed by
any clinical measurement typically used by physicians or other
skilled healthcare providers to assess the severity or progression
status of that symptom. While an embodiment of the present
invention (e.g., a treatment method or article of manufacture) may
not be effective in alleviating the target disease symptom(s) in
every subject, it should alleviate the target disease symptom(s) in
a statistically significant number of subjects as determined by any
statistical test known in the art such as the Student's t-test, the
chi.sup.2-test, the U-test according to Mann and Whitney, the
Kruskal-Wallis test (H-test), Jonckheere-Terpstra-test and the
Wilcoxon-test.
Kits
Further provided are kits comprising one or more components that
include, but are not limited to, an anti-LAG3 antibody (e.g.,
humanized antibody such as antagonist humanized antibodies) or
antigen-binding fragment, as discussed herein (e.g., 4A10, 19E8,
11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8
and/or Ab9) in association with one or more additional components
including, but not limited to, a further therapeutic agent, as
discussed herein. The antibody or fragment and/or the therapeutic
agent can be formulated as a pure composition or in combination
with a pharmaceutically acceptable carrier, in a pharmaceutical
composition.
In one embodiment, the kit includes an anti-LAG3 antibody (e.g.,
humanized antibody such as antagonist humanized antibodies) or
antigen-binding fragment thereof of the invention (e.g., 4A10,
19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7,
Ab8 and/or Ab9) or a pharmaceutical composition thereof in one
container (e.g., in a sterile glass or plastic vial) and a further
therapeutic agent in another container (e.g., in a sterile glass or
plastic vial).
In another embodiment, the kit comprises a combination of the
invention, including an anti-LAG3 antibody (e.g., humanized
antibody such as antagonist humanized antibodies) or
antigen-binding fragment thereof of the invention (e.g., 4A10,
19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7,
Ab8 and/or Ab9) or pharmaceutical composition thereof in
combination with one or more therapeutic agents formulated
together, optionally, in a pharmaceutical composition, in a single,
common container.
If the kit includes a pharmaceutical composition for parenteral
administration to a subject, the kit can include a device for
performing such administration. For example, the kit can include
one or more hypodermic needles or other injection devices as
discussed above. Thus, the present invention includes a kit
comprising an injection device and the anti-LAG3 antibody or
antigen-binding fragment thereof of the present invention, e.g.,
wherein the injection device includes the antibody or fragment or
wherein the antibody or fragment is in a separate vessel.
The kit can include a package insert including information
concerning the pharmaceutical compositions and dosage forms in the
kit. Generally, such information aids patients and physicians in
using the enclosed pharmaceutical compositions and dosage forms
effectively and safely. For example, the following information
regarding a combination of the invention may be supplied in the
insert: pharmacokinetics, pharmacodynamics, clinical studies,
efficacy parameters, indications and usage, contraindications,
warnings, precautions, adverse reactions, overdosage, proper dosage
and administration, how supplied, proper storage conditions,
references, manufacturer/distributor information and patent
information.
Detection Kits and Therapeutic Kits
As a matter of convenience, an anti-LAG3 antibody (e.g., humanized
antibody such as antagonist humanized antibodies) or
antigen-binding fragment thereof of the invention (e.g., 4A10,
19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7,
Ab8 and/or Ab9) can be provided in a kit, i.e., a packaged
combination of reagents in predetermined amounts with instructions
for performing the diagnostic or detection assay. Where the
antibody or fragment is labeled with an enzyme, the kit will
include substrates and cofactors required by the enzyme (e.g., a
substrate precursor which provides the detectable chromophore or
fluorophore). In addition, other additives may be included such as
stabilizers, buffers (e.g., a block buffer or lysis buffer) and the
like. The relative amounts of the various reagents may be varied
widely to provide for concentrations in solution of the reagents
which substantially optimize the sensitivity of the assay.
Particularly, the reagents may be provided as dry powders, usually
lyophilized, including excipients which on dissolution will provide
a reagent solution having the appropriate concentration.
Also provided are diagnostic or detection reagents and kits
comprising one or more such reagents for use in a variety of
detection assays, including for example, immunoassays such as ELISA
(sandwich-type or competitive format). The kit's components may be
pre-attached to a solid support, or may be applied to the surface
of a solid support when the kit is used. In some embodiments of the
invention, the signal generating means may come pre-associated with
an antibody or fragment of the invention or may require combination
with one or more components, e.g., buffers, antibody-enzyme
conjugates, enzyme substrates, or the like, prior to use. Kits may
also include additional reagents, e.g., blocking reagents for
reducing nonspecific binding to the solid phase surface, washing
reagents, enzyme substrates, and the like. The solid phase surface
may be in the form of a tube, a bead, a microtiter plate, a
microsphere, or other materials suitable for immobilizing proteins,
peptides, or polypeptides. In particular aspects, an enzyme that
catalyzes the formation of a chemilluminescent or chromogenic
product or the reduction of a chemilluminescent or chromogenic
substrate is a component of the signal generating means. Such
enzymes are well known in the art. Kits may comprise any of the
capture agents and detection reagents described herein. Optionally
the kit may also comprise instructions for carrying out the methods
of the invention.
Also provided is a kit comprising an anti-LAG3 antibody (e.g.,
humanized antibody such as antagonist humanized antibodies) or
antigen-binding fragment thereof packaged in a container, such as a
vial or bottle, and further comprising a label attached to or
packaged with the container, the label describing the contents of
the container and providing indications and/or instructions
regarding use of the contents of the container to treat one or more
disease states as described herein.
In one aspect, the kit is for treating cancer and comprises an
anti-LAG3 antibody (e.g., humanized antibody such as antagonist
humanized antibodies) or antigen-binding fragment thereof and a
further therapeutic agent or a vaccine. The kit may optionally
further include a syringe for parenteral, e.g., intravenous,
administration. In another aspect, the kit comprises an anti-LAG3
antibody (e.g., humanized antibody such as antagonist humanized
antibodies) or antigen-binding fragment thereof and a label
attached to or packaged with the container describing use of the
antibody or fragment with the vaccine or further therapeutic agent.
In yet another aspect, the kit comprises the vaccine or further
therapeutic agent and a label attached to or packaged with the
container describing use of the vaccine or further therapeutic
agent with the anti-LAG3 antibody or fragment. In certain
embodiments, an anti-LAG3 antibody and vaccine or further
therapeutic agent are in separate vials or are combined together in
the same pharmaceutical composition.
As discussed above in the combination therapy section, concurrent
administration of two therapeutic agents does not require that the
agents be administered at the same time or by the same route, as
long as there is an overlap in the time period during which the
agents are exerting their therapeutic effect. Simultaneous or
sequential administration is contemplated, as is administration on
different days or weeks.
The therapeutic and detection kits disclosed herein may also be
prepared that comprise at least one of the antibody, peptide,
antigen-binding fragment, or polynucleotide disclosed herein and
instructions for using the composition as a detection reagent or
therapeutic agent. Containers for use in such kits may typically
comprise at least one vial, test tube, flask, bottle, syringe or
other suitable container, into which one or more of the detection
and/or therapeutic composition(s) may be placed, and preferably
suitably aliquoted. Where a second therapeutic agent is also
provided, the kit may also contain a second distinct container into
which this second detection and/or therapeutic composition may be
placed. Alternatively, a plurality of compounds may be prepared in
a single pharmaceutical composition, and may be packaged in a
single container means, such as a vial, flask, syringe, bottle, or
other suitable single container. The kits disclosed herein will
also typically include a means for containing the vial(s) in close
confinement for commercial sale, such as, e.g., injection or
blow-molded plastic containers into which the desired vial(s) are
retained. Where a radiolabel, chromogenic, fluorigenic, or other
type of detectable label or detecting means is included within the
kit, the labeling agent may be provided either in the same
container as the detection or therapeutic composition itself, or
may alternatively be placed in a second distinct container means
into which this second composition may be placed and suitably
aliquoted. Alternatively, the detection reagent and the label may
be prepared in a single container means, and in most cases, the kit
will also typically include a means for containing the vial(s) in
close confinement for commercial sale and/or convenient packaging
and delivery.
A device or apparatus for carrying out the detection or monitoring
methods described herein is also provided. Such an apparatus may
include a chamber or tube into which sample can be input, a fluid
handling system optionally including valves or pumps to direct flow
of the sample through the device, optionally filters to separate
plasma or serum from blood, mixing chambers for the addition of
capture agents or detection reagents, and optionally a detection
device for detecting the amount of detectable label bound to the
capture agent immunocomplex. The flow of sample may be passive
(e.g., by capillary, hydrostatic, or other forces that do not
require further manipulation of the device once sample is applied)
or active (e.g., by application of force generated via mechanical
pumps, electroosmotic pumps, centrifugal force, or increased air
pressure), or by a combination of active and passive forces.
In further embodiments, also provided is a processor, a computer
readable memory, and a routine stored on the computer readable
memory and adapted to be executed on the processor to perform any
of the methods described herein. Examples of suitable computing
systems, environments, and/or configurations include personal
computers, server computers, hand-held or laptop devices,
multiprocessor systems, microprocessor-based systems, set top
boxes, programmable consumer electronics, network PCs,
minicomputers, mainframe computers, distributed computing
environments that include any of the above systems or devices, or
any other systems known in the art.
General Methods
Standard methods in molecular biology are described Sambrook,
Fritsch and Maniatis (1982 & 1989 2.sup.nd Edition, 2001
3.sup.rd Edition) Molecular Cloning, A Laboratory Manual, Cold
Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.; Sambrook
and Russell (2001) Molecular Cloning, 3.sup.rd ed., Cold Spring
Harbor Laboratory Press, Cold Spring Harbor, N.Y.; Wu (1993)
Recombinant DNA, Vol. 217, Academic Press, San Diego, Calif.).
Standard methods also appear in Ausbel, et al. (2001) Current
Protocols in Molecular Biology, Vols.1-4, John Wiley and Sons, Inc.
New York, N.Y., which describes cloning in bacterial cells and DNA
mutagenesis (Vol. 1), cloning in mammalian cells and yeast (Vol.
2), glycoconjugates and protein expression (Vol. 3), and
bioinformatics (Vol. 4).
Methods for protein purification including immunoprecipitation,
chromatography, electrophoresis, centrifugation, and
crystallization are described (Coligan, et al. (2000) Current
Protocols in Protein Science, Vol. 1, John Wiley and Sons, Inc.,
New York). Chemical analysis, chemical modification,
post-translational modification, production of fusion proteins,
glycosylation of proteins are described (see, e.g., Coligan, et al.
(2000) Current Protocols in Protein Science, Vol. 2, John Wiley and
Sons, Inc., New York; Ausubel, et al. (2001) Current Protocols in
Molecular Biology, Vol. 3, John Wiley and Sons, Inc., NY, N.Y., pp.
16.0.5-16.22.17; Sigma-Aldrich, Co. (2001) Products for Life
Science Research, St. Louis, Mo.; pp. 45-89; Amersham Pharmacia
Biotech (2001) BioDirectory, Piscataway, N.J., pp. 384-391).
Production, purification, and fragmentation of polyclonal and
monoclonal antibodies are described (Coligan, et al. (2001) Current
Protcols in Immunology, Vol. 1, John Wiley and Sons, Inc., New
York; Harlow and Lane (1999) Using Antibodies, Cold Spring Harbor
Laboratory Press, Cold Spring Harbor, N.Y.; Harlow and Lane,
supra). Standard techniques for characterizing ligand/receptor
interactions are available (see, e.g., Coligan, et al. (2001)
Current Protocols in Immunology, Vol. 4, John Wiley, Inc., New
York).
Monoclonal, polyclonal, and humanized antibodies can be prepared
(see, e.g., Sheperd and Dean (eds.) (2000) Monoclonal Antibodies,
Oxford Univ. Press, New York, N.Y.; Kontermann and Dubel (eds.)
(2001) Antibody Engineering, Springer-Verlag, New York; Harlow and
Lane (1988) Antibodies A Laboratory Manual, Cold Spring Harbor
Laboratory Press, Cold Spring Harbor, N.Y., pp. 139-243; Carpenter,
et al. (2000) J. Immunol. 165:6205; He, et al. (1998) J. Immunol.
160:1029; Tang et al. (1999) J. Biol. Chem. 274:27371-27378; Baca
et al. (1997) J. Biol. Chem. 272:10678-10684; Chothia et al. (1989)
Nature 342:877-883; Foote and Winter (1992) J. Mol. Biol.
224:487-499; U.S. Pat. No. 6,329,511).
An alternative to humanization is to use human antibody libraries
displayed on phage or human antibody libraries in transgenic mice
(Vaughan et al. (1996) Nature Biotechnol. 14:309-314; Barbas (1995)
Nature Medicine 1:837-839; Mendez et al. (1997) Nature Genetics
15:146-156; Hoogenboom and Chames (2000) Immunol. Today 21:371-377;
Barbas et al. (2001) Phage Display: A Laboratory Manual, Cold
Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.; Kay et
al. (1996) Phage Display of Peptides and Proteins: A Laboratory
Manual, Academic Press, San Diego, Calif.; de Bruin et al. (1999)
Nature Biotechnol. 17:397-399).
Single chain antibodies and diabodies are described (see, e.g.,
Malecki et al. (2002) Proc. Natl. Acad. Sci. USA 99:213-218;
Conrath et al. (2001) J. Biol. Chem. 276:7346-7350; Desmyter et al.
(2001) J. Biol. Chem. 276:26285-26290; Hudson and Kortt (1999) J.
Immunol. Methods 231:177-189; and U.S. Pat. No. 4,946,778).
Bifunctional antibodies are provided (see, e.g., Mack, et al.
(1995) Proc. Natl. Acad. Sci. USA 92:7021-7025; Carter (2001) J.
Immunol. Methods 248:7-15; Volkel, et al. (2001) Protein
Engineering 14:815-823; Segal, et al. (2001) J. Immunol. Methods
248:1-6; Brennan, et al. (1985) Science 229:81-83; Raso, et al.
(1997) J. Biol. Chem. 272:27623; Morrison (1985) Science
229:1202-1207; Traunecker, et al. (1991) EMBO J. 10:3655-3659; and
U.S. Pat. Nos. 5,932,448, 5,532,210, and 6,129,914).
Bispecific antibodies are also provided (see, e.g., Azzoni et al.
(1998) J. Immunol. 161:3493; Kita et al. (1999) J. Immunol.
162:6901; Merchant et al. (2000) J. Biol. Chem. 74:9115; Pandey et
al. (2000) J. Biol. Chem. 275:38633; Zheng et al. (2001) J. Biol
Chem. 276:12999; Propst et al. (2000) J. Immunol. 165:2214; Long
(1999) Ann. Rev. Immunol. 17:875).
Purification of antigen is not necessary for the generation of
antibodies. Animals can be immunized with cells bearing the antigen
of interest. Splenocytes can then be isolated from the immunized
animals, and the splenocytes can fused with a myeloma cell line to
produce a hybridoma (see, e.g., Meyaard et al. (1997) Immunity
7:283-290; Wright et al. (2000) Immunity 13:233-242; Preston et
al., supra; Kaithamana et al. (1999) J. Immunol.
163:5157-5164).
Antibodies can be conjugated, e.g., to small drug molecules,
enzymes, liposomes, polyethylene glycol (PEG). Antibodies are
useful for therapeutic, diagnostic, kit or other purposes, and
include antibodies coupled, e.g., to dyes, radioisotopes, enzymes,
or metals, e.g., colloidal gold (see, e.g., Le Doussal et al.
(1991) J. Immunol. 146:169-175; Gibellini et al. (1998) J. Immunol.
160:3891-3898; Hsing and Bishop (1999) J. Immunol. 162:2804-2811;
Everts et al. (2002) J. Immunol. 168:883-889).
Methods for flow cytometry, including fluorescence activated cell
sorting (FACS), are available (see, e.g., Owens, et al. (1994) Flow
Cytometry Principles for Clinical Laboratory Practice, John Wiley
and Sons, Hoboken, N.J.; Givan (2001) Flow Cytometry, 2.sup.nd ed.;
Wiley-Liss, Hoboken, N.J.; Shapiro (2003) Practical Flow Cytometry,
John Wiley and Sons, Hoboken, N.J.). Fluorescent reagents suitable
for modifying nucleic acids, including nucleic acid primers and
probes, polypeptides, and antibodies, for use, e.g., as diagnostic
reagents, are available (Molecular Probes (2003) Catalogue,
Molecular Probes, Inc., Eugene, Oreg.; Sigma-Aldrich (2003)
Catalogue, St. Louis, Mo.).
Standard methods of histology of the immune system are described
(see, e.g., Muller-Harmelink (ed.) (1986) Human Thymus:
Histopathology and Pathology, Springer Verlag, New York, N.Y.;
Hiatt, et al. (2000) Color Atlas of Histology, Lippincott,
Williams, and Wilkins, Phila, Pa.; Louis, et al. (2002) Basic
Histology: Text and Atlas, McGraw-Hill, New York, N.Y.).
Software packages and databases for determining, e.g., antigenic
fragments, leader sequences, protein folding, functional domains,
glycosylation sites, and sequence alignments, are available (see,
e.g., GenBank, Vector NTI.RTM. Suite (Informax, Inc, Bethesda,
Md.); GCG Wisconsin Package (Accelrys, Inc., San Diego, Calif.);
DeCypher.RTM. (TimeLogic Corp., Crystal Bay, Nev.); Menne, et al.
(2000) Bioinformatics 16: 741-742; Menne, et al. (2000)
Bioinformatics Applications Note 16:741-742; Wren, et al. (2002)
Comput. Methods Programs Biomed. 68:177-181; von Heijne (1983) Eur.
J. Biochem. 133:17-21; von Heijne (1986) Nucleic Acids Res.
14:4683-4690).
EXAMPLES
These examples are intended to exemplify the present invention are
not a limitation thereof. Compositions and methods set forth in the
Examples form part of the present invention.
Example 1
Generation of Antibodies Against Human LAG3
To generate antibodies to human LAG3, Balb/C mice were immunized
with 5 ug of human LAG3-hFc tagged recombinant protein using RIBI
adjuvant and footpad injection on a biweekly schedule. Immunized
mice were bled and serum titers determined for binding to human
LAG3 transfected CHOK1 cells using a cell-based ELISA (described
below). Mice with the highest titers were given a final boost with
recombinant protein and draining popliteal lymph nodes isolated
four days later. Hybridomas were generated by electrofusion of
isolated lymphocytes with the myeloma fusion partner
P3.times.63-AG8.653 using the Cytopulse Hybrimmune electrofusion
system. Fused cells were plated in 96-well plates in DMEM/F12, 15%
BCS, HAT, IL-6, OPI supplement, and gentamycin.
Hybridoma supernatants were assayed for binding to human LAG3
expressing CHOK1 cells and cross-reactivity to cynomolgus LAG3
expressing CHO cells using a cell-based ELISA format. Human LAG3
and cynomolgus LAG3 expressing CHO-K1 cells were plated in 96-well
tissue-culture plates in 50 ul of DMEM/F12, 10% BCS and gentamycin
(CHO-K1 media). Cells were plated at either 2.times.10.sup.4
cells/well two days prior to the assay or 4.times.10.sup.4
cells/well one day prior to the assay. Media was removed from the
wells prior to the assay and 50 ul of hybridoma supernatant added.
Hybridoma supernatants were incubated for 30-60 minutes at
37.degree. C. and washed 3 times with PBS/0.05% Tween 20 using a
cell ELISA washing protocol on the Biotek EL405x Select CW plate
washer. Fifty microliters of the detection antibody, HRP-conjugated
goat anti-mouse IgG (Southern Biotech cat #1031-05), was added at a
1:2000 dilution in CHO-K1 media and incubated at 37.degree. C. for
30-60 minutes. Assay plates were washed as above and developed with
TMB and stopped with TMB stop solution (KPL cat #50-85-06). The
absorbance at 450 nm-620 nm was determined.
Positive hybridomas were subcloned by limiting dilution or
subcloned by plating hybridomas in semi-solid media and clones
picked on the ClonePix (Genetix). Final subclones were grown in
small-scale cultures in serum-free hybridoma production medium and
purified with protein G spin columns to generate purified antibody
for further characterization. Purified antibodies from clones
LB145.22D2.E1.1D1 (22D2), LB148.19E8.G1.1A1 (19E8), LB148.4A10.1H1
(4A10), and LB148.11C9.1C1 (11C9) were further characterized and
V.sub.H and V.sub.L sequencing performed.
Example 2
Binding of Mouse Anti-LAG3 Antibodies to Human LAG3 and Cynomolgous
Monkey LAG3 Expressed on the Surface of Chinese Hamster Ovary
Cells
Mouse anti-human LAG3 antibodies were tested for binding to human
LAG3 and cynomolgus LAG3 expressing CHO-K1 cells using a cell-based
ELISA. CHO-K1 cells were plated as described above and media
removed prior to adding the test samples. Purified antibody from
clones LB145.22D2.E1.1D1 (22D2), LB148.19E8.G1.1A1 (19E8),
LB148.4A10.1H1 (4A10), and LB148.11C9.1C1 (11C9) were
serially-diluted in DMEM/F12, 10% BCS (CHOK1 media) and added to
the CHO-K1 plates. The samples were incubated at 37.degree. C. for
30-60 minutes and plates were washed three times with PBS/0.05%
Tween-20 using the cell wash program on the Biotek washer as
described above. Binding was detected using an HRP-conjugated goat
anti-mouse IgG (Southern Biotech cat #1031-05) secondary antibody
added at a 1:2000 dilution in CHO-K1 media and incubated at
37.degree. C. for 30-60 minutes. Assay plates were washed as above
and developed with TMB and stopped with TMB stop solution (KPL cat
#50-85-06). The absorbance at 450 nm-620 nm was determined.
Representative binding curves for binding to human and cynomolgus
LAG3 transfected CHO-K1 cells are in FIG. 1.
Example 3
Affinity Determination for Binding of Mouse Anti-LAG3 Antibodies to
Human LAG3 Recombinant Protein
The kinetic binding activity of mouse anti-human LAG3 clones
LB148.19E8.G1.1A1, LB148.4A10.1H1, LB148.11C9.1C1 and
LB145.22D2.E1.1D1 using human LAG3-His tagged recombinant protein
was measured by surface plasmon resonance using a Biacore T200
system (Biacore, GE Healthcare, Piscataway, N.J.). Approximately
4000 RU of Goat Anti-Mouse IgG Fc gamma, Fragment Specific (Jackson
ImmunoResearch Catalog #115-006-071, Lot 81313) was immobilized via
amine coupling chemistry onto a Series S CM4 sensor chip, catalog
number BR-1005-34. Mouse anti-human LAG3 clones listed above were
injected over the immobilized goat anti-mouse surfaces at 1 ug/mL
for a capture level of 40 RU. HBS-EP+ buffer (BR-1006-69) was used
as the running buffer with a flow rate of 30 .mu.L/min.
Varying concentrations of human LAG3-His protein ranging from 0.15
nM to 18.8 nM, at a flow rate of 40 .mu.L/min were injected over
the antibody surfaces. Following each injection cycle, the Series S
CM4 chip surface was regenerated using one six second injection of
10 mM Glycine pH 1.5 solution followed by an injection of 12.5 mM
NaOH solution at a flow rate of 60 .mu.L/min.
Background subtraction binding sensorgrams were used for analyzing
the rate constant of association (k.sub.a) and dissociation
(k.sub.d), and the equilibrium dissociation constant K.sub.D. The
resulting data sets were fitted with a 1:1 Langmuir Binding Model
using the Biacore T200 evaluation software (version 2.0). Table 4
summarizes the affinities for the mouse anti-human LAG3 antibodies
to recombinant human LAG3.
TABLE-US-00061 TABLE 4 Measurement of Affinity for Mouse anti-Human
LAG3 Antibodies to Recombinant Human LAG3. ka1 kd1 K.sub.D Clone ID
(1/Ms) (1/s) (M) LB145.22D2.E1.1D1 1.39E+07 3.84E-05 2.77E-12
LB148.19E8.G1.1A1 7.43E+06 1.09E-04 1.47E-11 LB148.11C9.1C1
1.31E+06 1.92E-03 1.47E-09 LB148.4A10.1H1 1.25E+06 1.13E-04
9.03E-11
Moreover, Ab6 binding to human CD4, which is structurally related
to LAG3, both having four extracellular Ig-like domains, was not
detected by BiaCore of by FACS when CD4 was expressed on
transfected L-cells.
Example 4
Effect of Anti-LAG3 Antibodies on Murine T-cell Hybridoma 3A9 Cells
Expressing Human LAG3
The ability of anti-LAG3 antibodies to enhance antigen-specific T
cell activation was tested in a modified version of a previously
described T cell activation assay (Workman et al., (2002) Eur. J.
Immunol. 32:2255-2263).
A HEL peptide.sub.48-63-specific mouse T cell hybridoma (3A9) was
stimulated with a haplotype-matched, MHCII.sup.+, HEL
peptide.sub.48-63-pulsed B cell line (LK35.2) and IL-2 release was
assessed as a readout for antigen-specific T cell activation. The
3A9 T cell response to HEL peptide.sub.48-63-pulsed LK35.2 cells
was dose-dependent.
3A9 T cell lines stably overexpressing mouse or human LAG3 were
generated by retroviral transduction. We demonstrated that mouse
MHC2 on LK35.2 cells can engage both human and mouse LAG3,
resulting in a strong reduction of the antigen-specific IL-2
production, at suboptimal T cell activation concentrations. The
maximal effect of LAG3 activity was observed when titrating HEL
peptide.sub.48-63 at a concentration of 31.2 nM. The inhibitory
effect of LAG3 overexpression was not seen when using LK35.2 B
cells pulsed with higher peptide doses (corresponding to >100
nM). Treating with 10 ug/ml of a commercially available mouse LAG3
antibody, C9B7W, we were able to rescue IL-2 to levels of the
vector 3A9 cells.
To assess the effect of anti-LAG3 antibodies in this assay, mouse
or human LAG3-overexpressing 3A9 T cells (100,000 per well) were
pretreated with anti-LAG3 antibodies (serially diluted in 3-fold
dilutions from 10 ug/ml) for 30 minutes at 37.degree. C., and
stimulated with LK35.2 cells (33,333 per well) pulsed for 30
minutes prior to co-culture with 31.2 nM HEL peptide.sub.48-63.
After stimulation for 24 h at 37.degree. C. and 5.0% CO.sub.2, IL-2
secretion was assessed in culture supernatants by mesoscale.
Inhibition of LAG3 with an antagonist antibody restored T-cell
function resulting in the rescue of IL-2 production in a
dose-dependent manner. IL-2 production was not rescued when 3A9
cell were pre-treated with isotype control antibodies. The ability
of LAG3 overexpression to suppress IL-2 secretion coupled with IL-2
rescue after treatment with anti-LAG3 antibody validates this assay
as a robust screening tool. Table 5 lists the EC50s for IL-2 rescue
using the hLAG3-3A9 system for the mouse anti-human LAG3
antibodies.
TABLE-US-00062 TABLE 5 Mouse anti-human LAG3 antibodies stimulate
IL-2 production in the hLAG3-3A9 T cell system Clone ID EC50 (nM)
EC50 (nM) LB145.22D2.E1.1D1 1.06 1.65 LB148.19E8.G1.1A1 1.74 1.83
LB148.11C9.1C1 3.56 4.06 LB148.4A10.1H1 2.83 2.96
Example 5
Blocking of LAG3/MHC Class II Binding on Daudi Cells
Mouse anti-human LAG3 clones were tested for their ability to block
hLAG3 interaction with human MHC Class II. Daudi cells (ATCC
#CCL-213) were used as a cell line positive for human MHC class II
expression. Daudi cells were blocked with 10 ug/ml of goat IgG in
HBSS and 2% BCS on ice for 30 minutes and 0.5.times.10.sup.6
cells/sample were aliquoted into a 96-well V-bottom plate and
blocking buffer removed. Clones LB145.22D2.E1.1D1,
LB148.19E8.G1.1A1, LB148.4A10.1H1, and LB148.11C9.1C1 were serially
diluted starting at 20 ug/ml in HBSS/2% BCS and pre-incubated with
2 ug/ml of human LAG3-huFc in 96-well polypropylene U-bottom plates
in a final volume of 100 ul and incubated on ice for 30 minutes.
Following pre-incubation, the human LAG3-Fc/hybridoma supernatant
mixtures were added to the blocked Daudi cells and incubated for 45
minutes on ice. Cells were pelleted by centrifugation at 1200 rpm
and washed twice with HBSS/2% BCS. Human LAG3-Fc binding to Daudi
cells was detected using F(ab)'.sub.2 goat anti-human IgG-PE
conjugate (Southern Biotech Cat #) at 1:200 dilution in 100 ul
staining volume and incubated on ice for 20 minutes. Cells were
washed twice as described above, resuspended in HBSS/2% BCS and
read on the FACSCalibur. Table 6 summarizes the IC50s for MHC class
II blockade for the mouse anti-human LAG3 clones.
TABLE-US-00063 TABLE 6 Mouse anti-human LAG3 antibodies block the
interaction of human MHC Class II with human LAG3-Fc recombinant
protein. Clone ID IC50 (nM) LB145.22D2.E1.1D1 2.10
LB148.19E8.G1.1A1 2.80 LB148.11C9.1C1 2.00 LB148.4A10.1H1 1.90
Example 6
Evaluation of Four Anti-Human LAG3 Parental Antibodies for Tissue
Cross-Reactivity in Focused Set of Normal Human Tissues by
Immunohistochemistry
Frozen sections of a subset of normal human tissues (brain, heart,
kidney, liver, lung, pancreas, pituitary) were stained using four
anti-human LAG3 antibody clones (LB148.4A10.1H1 (4A10),
LB148.11C9.1C1 (11C9), LB148.19E8.G1.1A1 (19E8), LB145.22D2. E1.1D1
(22D2)) as immunohistochemical reagents, in order to screen for
potential unexpected tissue reactivity. Human tonsil was used as a
positive staining control. Mouse IgG2a, IgG1, and IgG2b, hereafter
"isotype control" antibodies, were run concurrent with the
respective anti-human LAG3 clones on all tissues to serve as
comparators for evaluation of non-specific labeling.
Immunohistochemical cross-reactivity testing of antibodies 4A10,
11C9, and 19E8 and 22D2 was performed in separate runs.
All slides were reviewed by a pathologist and immunohistochemical
signal was scored on a 0-3 scale (0=negative, +1=low, +2=moderate,
+3=high). Staining intensities and patterns were compared between
test article and isotype control reagents. Test article staining
was considered to be significant when the intensity substantially
exceeded that of the isotype control or had a distinct,
reproducible difference in distributional pattern within the
tissue.
TABLE-US-00064 TABLE 7 Lag3 clone 4A10 (5 ug/mL) Tissue
Identification Test IgG2a Slide# Antibody (Human) antibody isotype
Lag3 clone 4A10 5 ug/mL D6414 B1 brain +1 +1 Lag3 clone 4A10 5
ug/mL D1106 B1 heart +1 +1 Lag3 clone 4A10 5 ug/mL D7462 B1 kidney
+1 +1 Lag3 clone 4A10 5 ug/mL D7122 B1 liver +2 +2 Lag3 clone 4A10
5 ug/mL D7092 B1 lung +1 +1 Lag3 clone 4A10 5 ug/mL D5425 B1
pancreas +2, exocrine 0 cells Lag3 clone 4A10 5 ug/mL D5745 B1
pituitary +1 +1 Positive Control Lag3 clone 4A10 5 ug/mL D7530 B2
tonsil +2 +1 (Appropriate labeling)
Positive labeling of pancreatic exocrine cells (approximately 20%
of total population present) is only seen in the test antibody
treated sample but is limited to the cytoplasm.
TABLE-US-00065 TABLE 8 Lag3 clone 11C9 (10 ug/mL) Tissue
Identification Test IgG1 Slide# Antibody (Human) antibody isotype
Lag3 clone 11C9 10 ug/mL D6414 B1 brain +1 +1 Lag3 clone 11C9 10
ug/mL D1106 B1 heart 0 0 Lag3 clone 11C9 10 ug/mL D7462 B1 kidney 0
0 Lag3 clone 11C9 10 ug/mL D7122 B1 liver +1 +2 Lag3 clone 11C9 10
ug/mL D7092 B1 lung 0 0 Lag3 clone 11C9 10 ug/mL D5425 B1 pancreas
0 0 Lag3 clone 11C9 10 ug/mL D5745 B1 pituitary 0 0 Positive
Control Lag3 clone 11C9 10 ug/mL D7530 B2 tonsil +2 0 (Appropriate
labeling)
All positive signal cited in tables (except in positive controls)
is interpreted as artifactually associated with the procedure
performed and is identical to, or stronger in the isotype
control.
TABLE-US-00066 TABLE 9 Lag3 clone 19E8 (0.5 ug/mL) Tissue
Identification IgG2b Slide# Antibody (Human) Test antibody isotype
Lag3 clone 19E8 0.5 ug/mL D6414 B1 brain +1 (vascular smooth
muscle) 0 Lag3 clone 19E8 0.5 ug/mL D1106 B1 heart +1 (vascular
smooth muscle) 0 Lag3 clone 19E8 0.5 ug/mL D7462 B1 kidney +1
(vascular smooth muscle) +1 Lag3 clone 19E8 0.5 ug/mL D7122 B1
liver +1 (vascular smooth muscle) +1 Lag3 clone 19E8 0.5 ug/mL
D7092 B1 lung 0 +1 Lag3 clone 19E8 0.5 ug/mL D5425 B1 pancreas +1
(vascular smooth muscle) 0 Lag3 clone 19E8 0.5 ug/mL D5745 B1
pituitary +1 (vascular smooth muscle) 0 Positive Control Lag3 clone
19E8 0.5 ug/mL D7530 B2 tonsil +3 (Appropriate labeling) +1
Nonspecific labeling of vascular smooth muscle is only observed in
the test antibody treated samples but is limited to
sarcoplasm/cytoplasm.
TABLE-US-00067 TABLE 10 Lag3 clone 22D2 (10 ug/mL) Tissue
Identification Test IgG2a Antibody (Human) antibody isotype Lag3
clone 22D2 10 ug/mL D6414 B1 brain +2 +2 Lag3 clone 22D2 10 ug/mL
D1106 B1 heart +1 +1 Lag3 clone 22D2 10 ug/mL D7462 B1 kidney +2 +2
Lag3 clone 22D2 10 ug/mL D7122 B1 liver +1 +2 Lag3 clone 22D2 10
ug/mL D7092 B1 lung +2 +2 Lag3 clone 22D2 10 ug/mL D5425 B1
pancreas +1 +1 Lag3 clone 22D2 10 ug/mL D5745 B1 pituitary +2 +2
Positive Control Lag3 clone 22D2 10 ug/mL D7530 B2 tonsil +3 +2
(Appropriate labeling)
All positive signal cited in tables (except in positive controls)
is interpreted as artifactually associated with the procedure
performed and is identical to, or stronger in the isotype
control.
In conclusion, clone 19E8 exhibited relatively prominent
sarcoplasmic labeling of vascular smooth muscle in all tissues
examined except lung. Clone 4A10 exhibited cytoplasmic
immunohistochemical reactivity in approximately 20% of pancreatic
exocrine glandular cells. Clones 11C9 and 22D2 demonstrated no
labeling beyond that observed with isotype control.
Example 7
Binding of Lag3 Clones to T Cells Isolated from Human and
Cynomolgous Monkey Blood
Binding of Lag3 mAb clones to primary T-cells was accessed using
human and cynomolgous monkey (cyno) peripheral blood mononuclear
cells (PBMC). Human blood was obtained from the local donors; cyno
blood was obtained from Bioreclamation. PBMC were isolated from the
whole blood using Ficoll-Paque Plus (GE Healthcare, Cat
#17-1440-03) density gradient centrifugation at 524.times.g for 40
minutes. PBMC were collected from the medium:plasma interface and
washed 2 times with phosphate buffered saline (PBS). The residual
red blood cells were lysed using ammonium-chloride-potassium red
blood cell lysing solution (ACK, GIBCO, cat #A10492-010).
Cynomolgus monkey or human PBMC (3.times.10.sup.6/ml) were
stimulated with 4 .mu.g/ml PHA (Sigma, L2769) for 48 h and 20 h,
respectively. For flow cytometric analysis, 1.times.10.sup.6
PHA-activated PBMCs were used per staining in 50 .mu.l FACS
staining buffer (BD, cat #554657). Lag3 mAb clones or correspondent
isotype controls (Table 11) were incubated with human or cyno PBMS
followed by detection using goat anti-mouse IgG-PE (BD 550589).
Mouse anti-human CD3-pacific blue (BD 558124, clone SP34-2), mouse
anti-human CD4-PerCP (BD 550631, clone L200), and mouse anti-human
CD8-APC-Cy7 (BD 557834, clone SK1) were used as phenotypic markers.
Sample acquisition was performed on an LSR II flow cytometer and
the data were analyzed using FlowJo software version 10.0.6 (Tree
Star, Inc.).
Flow cytometry analysis revealed binding to all the analyzed Lag3
clones to primary human and cyno T cells (representative data shown
on FIG. 2).
TABLE-US-00068 TABLE 11 Lag 3 clones and isotype controls utilized
in the study TC31.3E1.C7 28ACM mIgG2a/K 10 mM NaPhosphate, 75 mM
NaCl, 3% sucrose, pH 7.3 TC31.27F11.C2 64AFW mIgG1/K 10 mM
phosphate, 75 mM NaCl, 3% sucrose pH 7.4 KM9.LP1.MAB3 63ADP
mIgG2b/K 20 mM NaAcetate, 7% sucrose, pH 5.5 In house Lag3 lot#
isotype formulation LB148.19E8.G1.1A1 42AGF mIgG2b/K 10 mM PO4, 75
mM NaCl, 3% sucrose pH 7.4 LB145.22D2.E1.1D1 98AGF mIgG2a/K 10 mM
PO4, 75 mM NaCl, 3% sucrose pH 7.4 LB148.4A10.1H1 45AGF mIgG2a/K 10
mM PO4, 75 mM NaCl, 3% sucrose pH 7.4 LB148.11C9.1C1 47AGF mIgG1/K
20 mM NaAc, 9% sucrose pH 5.0
Example 8
Epitope Mapping of hLAG3 antibodies by Hydrogen Deuterium Exchange
Mass Spectrometry
Contacts between anti-LAG3 antibodies and human LAG3 were
determined by use of hydrogen deuterium exchange mass spectrometry
analysis.
Materials
Human LAG3-His:[VEGF leader]-LAG3_H-[His9G]
TABLE-US-00069 (SEQ ID NO: 447)
(LQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGP
PAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQ
LDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASM
TASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHL
AESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVY
AGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLE
DVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEV
TPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLL
GAAVYFTELSSPGAQRSGRAPGALPAGHLLHHHHHHHHHGGQ)
Anti-hLAG3 clone 22D2 (chimeric antibody comprising the [LAG3_H]
mAb (LB145.22D2.E1.D1 (VH0/VL0) Geneart) IgG4 S228P/kappa (PX) and
the human IgG4 framework containing the hinge stabilizing S228P
mutation) Anti-hLAG3 clone 11C9 (mouse.times.[LAG3_H] mAb
(LB148.11C9.1C1) IgG1/kappa (HY)/mouse IgG1) Anti-hLAG3 clone 4A10
(mouse.times.[LAG3_H] mAb (LB148.4A10.1H1) IgG2a/kappa (HY)/mouse
IgG2a) Liquid Chromatography-Mass Spectrometry
The mass spectrometer was a Thermo Scientific Orbitrap-Velos. For
the measurement of deuterium labeled samples, the mass spectrometer
was set to acquire one full scan MS data in the orbitrap at 60,000
resolving power, a target ion count of 1E6 and a maximum ion
injection time of 500 millisecond. For the acquisition of MS/MS
data for peptide identifications, the mass spectrometer was set to
acquire one full scan spectrum at 60,000 resolving power followed
by ten data-dependent MS/MS spectra in the ion trap.
The liquid chromatography system was a Waters nanoAcquity for the
analytical column gradient and a Waters 515 isocratic pump for the
sample digestion and loading. For sample digestion and loading, the
buffer used was 2% acetonitrile and 0.05% trifluoroacetic acid at a
flow rate of 80 ul/min. For the analytical gradient, the buffers
were Buffer A) 0.1% formic acid in water and Buffer B) 0.1% formic
acid in acetonitrile.
The gradient was at 40 ul/min from 2% B to 36% B in 10 minutes,
followed by a wash of 80% B for 1.5 minute and a reequilibration at
2% B for 3 minutes. The column was then washed by cycling the
gradient between 2% and 80% B, three times with 1 minute at each
step, followed by a final equilibration at 2% B for 5 minutes. The
trapping column was a Waters Vanguard C18 BEH 1.7 um Guard Column
and the analytical column was a Waters C18 BEH300, 1.7 um
1.times.50 mm column.
Sample handling for the deuterium labeling was done by a Leaptec
H/D-X PAL system. The labeling sample tray was set to a temperature
of 25.degree. C., the quenching tray was set to 1.5.degree. C. and
the trap and analytical column chamber was set to 1.5.degree. C.
The immobilized pepsin column (Porosyme Immobilized Pepsin
2.1.times.30 mmm, Life Technologies) was kept outside the column
chamber at room temperature.
Deuterium Labeling
For the antibody clones 22D2 and 11C9, hLAG3-His (113 pmol/ul) was
mixed with an equal volume of the antibody (55 pmol/ul) or, as the
unbound control, PBS pH 7.6. The antibody bound samples and the
unbound control were incubated at room temperature for 1 hour
before beginning the labeling experiment. For 4A10, the antibody
(30 pmol/ul) was mixed with hLAG3-His at a 2:1 v/v ratio.
Subsequent steps were identical for all the samples.
To deuterium label the samples, 2 ul of sample was mixed with 25 ul
of PBS in deuterium oxide pD 7.6. Labeling time points were 30,
300, 3000 or 9000 seconds. After the set time, 25 ul of the
labeling mixture was added to 40 ul of cold quench buffer (8M Urea,
100 mM TCEP, 0.02% dodecylmaltoside). The quenched sample was
incubated at 1.5.degree. C. for 2 minutes. 55 ul was then injected
into the column cooling chamber where the sample was passed over
the pepsin column and the resulting peptides loaded onto the
trapping column. After three minutes, the analytical gradient and
the mass spectrometer were started.
A fully deuterated sample was generated by incubating 2 ul of hLAG3
with 108 ul of deuterated denaturing buffer (4M Urea, 100 mM TCEP,
0.01% DDM in 99.5% deuterium oxide). The sample was incubated at
37.degree. C. overnight. 55 ul was then directly injected into the
column chamber and the data acquired as before.
Data Analysis
LC-MS/MS data was acquired of an unlabeled sample and searched
before deuterium labeling to verify successful digestion of the
proteins and to generate a list of peptides. Data was database
searched using Proteome Discoverer 1.4 and the SEQUEST HT search
algorithm (ThermoFisher Scientific). The protein database used was
the human LAG3-His sequence concatenated to the yeast Saccharomyces
cerevisiae database.
MS data from the deuterium labeling experience was processed by
HDExaminer (Sierra Analytics). The mass and retention time selected
by the software for each peptide was verified manually.
Results
The human LAG3 residues protected by the 22D2, 4A10 and 11C9
antibodies, when bound to the LAG3 protein, are illustrated in
FIGS. 3, 4(a-c) and 5(a-b).
Example 9
Cell based KinExA
The affinities of the LAG3 antibodies for LAG3 were determined
using a cell based Kinetic Exclusion Assay (KinExA). Cell based
KinExA can be used to measure the affinity of a molecule for a
binding partner on a cell surface (Rathanaswami et al. Analylitical
Biochemistry 373(1): 52-60 (2008); Xie et al. J. Immunol. Methods
304 (1-2): 1-14 (2005)). In this case, BaF/3 cells were stably
transfected with human and cynomolgus monkey LAG3 proteins.
Transfected cells or the parental BaF/3 control cell line were
grown to a density of 1.7.times.10.sup.6 to 3.2.times.10.sup.6
cells per ml at 37.degree. C., 120 RPM, 5% CO.sub.2, in
1.times.RPMI 1640 media with 10% FBS, 10 ng/ml IL-3, 5 .mu.g/ml
puromycin. Cells were concentrated, mixed with 15 pM or 150 pM
antibody in cell culture media and incubated 24 to 48 hours at room
temperature while rotating at 20 to 30 RPM. Cells were present at a
top concentration of 2.times.10.sup.7 cells per ml (parental BaF/3
or cynomolgus LAG3 transfectants) or 1.times.10.sup.7 cells per ml
(human LAG3 transfectants) and diluted in a 2-fold, 18 member
series. The cells were pelleted and free antibody in the
supernatant was measured using a KinExA 3200 instrument (Sapidyne,
Id., USA). The instrument bound the free antibody to polymethyl
methacrylate beads (Sapidyne) that had been coated with goat
F(ab').sub.2 anti-human Fc.gamma. (Jackson ImmunoResearch
Laboratories, Pennsylvania, USA). Antibody on the beads was labeled
with 1.5 .mu.g/ml Alexa Fluor.RTM. 647 conjugated goat anti-human
(Fab').sub.2 (Jackson ImmunoResearch Laboratories), washed and the
fluorescent signal was read all using the KinExA.TM. 3200. The data
from the 15 pM and 150 pM concentrations of each antibody were fit
simultaneously using KinExA.TM. Pro n-Curve Analysis software
version 4.0.11 (Sapidyne).
TABLE-US-00070 TABLE 12 KinExA affinity measurements. human LAG3
K.sub.D cynomolgus K.sub.D LAG3 K.sub.D (pM) n K.sub.D (pM) n 22D2
Chimera 3 2 11 2 Hu22D2 VH6/VL3 (Ab 5) 6 2 25 2 Hu22D2 VH6/VL3 N55S
(Ab 7) 10 2 11 2 Hu22D2 VH6/VL3 N55Q 11 2 16 2 (Ab 8) Hu22D2
VH6/VL3 N55D (Ab 6) 2 3 12 3
Example 10
Effect of Anti-LAG3 Antibodies on Murine T-Cell Hybridoma 3A9 Cells
Expressing Human LAG3
The ability of anti-LAG3 antibodies to enhance antigen-specific T
cell activation was tested in a modified version of a previously
described T cell activation assay (Workman et al., Eur. J. Immunol.
32:2255-2263 (2002)).
A HEL peptide.sub.48-63-specific mouse T cell hybridoma (3A9) was
stimulated with a haplotype-matched, MHCII.sup.+, HEL
peptide.sub.48-63-pulsed B cell line (LK35.2) and IL-2 release was
assessed as a readout for antigen-specific T cell activation. The
3A9 T cell response to HEL peptide.sub.48-63-pulsed LK35.2 cells
was dose-dependent.
3A9 T cell lines stably overexpressing mouse or human LAG3 were
generated by retroviral transduction. It was demonstrated that
mouse MHC2 on LK35.2 cells can engage both human and mouse LAG3,
resulting in a strong reduction of the antigen-specific IL-2
production, at suboptimal T cell activation concentrations. The
maximal effect of LAG3 activity was observed when titrating HEL
peptide.sub.48-.sub.63 at a concentration of 31.2 nM. The
inhibitory effect of LAG3 overexpression was not seen when using
LK35.2 B cells pulsed with higher peptide doses (corresponding to
>100 nM). Treating with 10 ug/ml of a commercially available
mouse LAG3 antibody, C9B7W, IL-2 levels were rescued to that of the
vector 3A9 cells.
To assess the effect of anti-LAG3 antibodies in this assay, mouse
or human LAG3-overexpressing 3A9 T cells (100,000 per well) were
pretreated with anti-LAG3 antibodies (serially diluted in 3-fold
dilutions from 10 ug/ml) for 30 minutes at 37.degree. C., and
stimulated with LK35.2 cells (33,333 per well) pulsed for 30
minutes prior to co-culture with 31.2 nM HEL peptide.sub.48-63.
After stimulation for 24 h at 37.degree. C. and 5.0% CO.sub.2, IL-2
secretion was assessed in culture supernatants by mesoscale.
Inhibition of LAG3 with an antagonist antibody restored T-cell
function resulting in the rescue of IL-2 production in a
dose-dependent manner. IL-2 production was not rescued when 3A9
cell were pre-treated with isotype control antibodies. The ability
of LAG3 overexpression to suppress IL-2 secretion coupled with IL-2
rescue after treatment with anti-LAG3 antibody validated this assay
as a robust screening tool. Table 13 lists the EC.sub.50s for IL-2
rescue using the hLAG3-3A9 system for the mouse anti-human and
humanized anti-LAG3 antibodies.
TABLE-US-00071 TABLE 13 Mouse anti-human LAG3 antibodies stimulate
IL-2 production in the hLAG3-3A9 T cell system Range EC50, nM
Antibody (n) LB145.22D2.E1.1D1 1.06-1.65 (2) LB148.19E8.G1.1A1
1.74-1.83 (2) LB148.11C9.1C1 3.56-4.06 (2) LB148.4A10.1H1 2.83-2.96
(2) 22D2 chimera 0.69-1.91 (5) Hu22D2 VH6/VL3 0.57-1.07 (Ab 5) (6)
Hu22D2 VH6/VL3 0.45-1.27 N55S (Ab 7) (6) Hu22D2 VH6/VL3 0.47-1.01
N55D (Ab 6) (6) Hu22D2 VH6/VL3 0.72-1.08 N55Q (Ab 8) (6)
Example 11
Blocking of LAG3/MHC Class II Binding on Daudi Cells
Mouse anti-human LAG3 and humanized anti-LAG3 clones were tested
for their ability to block hLAG3 interaction with human MHC Class
II. Daudi cells (ATCC #CCL-213) were used as a cell line positive
for human MHC class II expression. Daudi cells were blocked with 10
ug/ml of goat IgG in HBSS and 2% BCS on ice for 30 minutes and
0.5.times.10.sup.6 cells/sample were aliquoted into a 96-well
V-bottom plate and blocking buffer removed. Clones
LB145.22D2.E1.1D1, LB148.19E8.G1.1A1, LB148.4A10.1H1, and
LB148.11C9.1C1 and hu22D2 VH6/VL3, hu22D2 VH6/VL3 N55Q, hu22D2
VH6/VL3 N55S, hu22D2 VH6/VL3 N55D, and chimeric 22D2 were serially
diluted starting at 20 ug/ml in HBSS/2% BCS and pre-incubated with
2 ug/ml of human LAG3-huFc or biotinylated human LAG3-huFc in
96-well polypropylene U-bottom plates in a final volume of 100 ul
and incubated on ice for 30 minutes. Following pre-incubation, the
human LAG3-Fc/antibody antibody mixtures were added to the blocked
Daudi cells and incubated for 45 minutes on ice. Cells were
pelleted by centrifugation at 1200 rpm and washed twice with
HBSS/2% BCS. Human LAG3-Fc binding to Daudi cells was detected
using F(ab)'.sub.2 goat anti-human IgG-PE conjugate (Southern
Biotech Cat #) at 1:200 for unconjugated huLAG3-huFc or 1:500
dilution of streptavidin-PE for biotinylated huLAG3-huFc in 100 ul
staining volume and incubated on ice for 20 minutes. Cells were
washed twice as described above, resuspended in HBSS/2% BCS and
read on the FACSCalibur. Table 14 summarizes the IC50s for MEW
class II blockade for the mouse anti-human LAG3 clones.
Humanized anti-human LAG3 antibodies (VH6/VL3, VH6/VL3 N55D,
VH6/VL3 N55Q, VH6/VL3 N55S, and chimeric 22D2) were tested for
their ability to block hLAG3 interaction with human MEW class II as
described above. Biotinylated human LAG3-huFc was used and
detection was using streptavidin-PE.
TABLE-US-00072 TABLE 14 Mouse anti-human LAG3 antibodies block the
interaction of human MHC Class II with human LAG3-Fc recombinant
protein. Antibody IC50 (nM) LB145.22D2.E1.1D1 2.1 LB148.19E8.G1.1A1
2.8 LB148.11C9.1C1 2.0 LB148.4A10.1H1 1.9 Chimeric 22D2 2.5 Hu22D2
VH6/VL3 2.6 (Ab 5) Hu22D2 VH6/VL3 N55S 2.1 (Ab 7) Hu22D2 VH6/VL3
N55D 2.4 (Ab 6) Hu22D2 VH6/VL3 2.5 N55Q (Ab 8)
Example 12
Binding of Lag3 Clones to T Cells Isolated from Human and
Cynomolgous Monkey Blood
Binding of LAG-3 mAb clones to primary T-cells was assessed using
human and cynomolgous monkey (cyno) peripheral blood mononuclear
cells (PBMC). Human blood was obtained from the local donors; cyno
blood was obtained from Bioreclamation. PBMC were isolated from the
whole blood using Ficoll-Paque Plus (GE Healthcare, Cat
#17-1440-03) density gradient centrifugation at 524.times.g for 40
minutes. PBMC were collected from the medium:plasma interface and
washed 2 times with phosphate buffered saline (PBS). The residual
red blood cells were lysed using ammonium-chloride-potassium red
blood cell lysing solution (ACK, GIBCO, cat #A10492-010).
Cynomolgus monkey or human PBMC (3.times.10.sup.6/ml) were
stimulated with 4 .mu.g/ml PHA (Sigma, L2769) for 48 h and 20 h,
respectively. For flow cytometric analysis, 1.times.10.sup.6
PHA-activated PBMCs were used per staining in 50 .mu.l FACS
staining buffer (BD, cat #554657). LAG-3 mAb clones or
correspondent isotype controls were incubated with human or cyno
PBMS followed by detection using goat anti-mouse IgG-PE (BD
550589). Mouse anti-human CD3-pacific blue (BD 558124, clone
SP34-2), mouse anti-human CD4-PerCP (BD 550631, clone L200), and
mouse anti-human CD8-APC-Cy7 (BD 557834, clone SK1) were used as
phenotypic markers. Sample acquisition was performed on an LSR II
flow cytometer and the data were analyzed using FlowJo software
version 10.0.6 (Tree Star, Inc.).
Flow cytometry analysis revealed binding of all the analyzed
anti-LAG3 antibodies to primary human and cyno T cells. EC.sub.50
for binding to human and cynomolgus CD4.sup.+ and CD8.sup.+ T cells
were determined for humanized 22D2 antibodies and are summarized in
Table 15. The data represent 3 human and 3 cynomolgus donors after
stimulation with 4 ug/ml of PHA for 40 hours prior to staining.
TABLE-US-00073 TABLE 15 EC.sub.50 for binding to human and
cynomolgus CD4.sup.+ and CD8.sup.+ T cells. (EC50, pM) Human
Cynomolgus LAG-3 LAG-3 CD4.sup.+ CD8.sup.+ CD4.sup.+ CD8.sup.+
Hu22D2 VH6/VL3 N55S 57 49 35 41 (Ab 7) Hu22D2 VH6/VL3 N55D 39 33 30
30 (Ab 6) Hu22D2 VH6/VL3 N55Q 41 35 27 31 (Ab 8)
Example 13
Effect of Anti-Human LAG-3 Antibody Treatment+/-Anti-PD-1 Treatment
on IL-2 Production in SEB Stimulated Human PBMCs
Human primary T cell assays--The first assay tested the function of
blocking LAG3 alone or in combination with anti-PD-1 to increase
IL-2 production by T cells following SEB activation of human PBMCs
(FIG. 7). Neutralization of LAG3 activity, alone and in the
presence of anti-PD-1, resulted in enhanced IL-2 production.
Examples of the IL-2 mesoscale counts from 2 donors across a dose
titration of anti-LAG3 antibody are shown. Hu22D2-enhanced IL-2
production by SEB-stimulated PBMC by 1.54-fold (range
1.15-2.36--fold, n=8) compared to isotype control and in
combination with anti-PD1 by 1.45 fold (range 1.15-2.36--fold, n=4
at 10 or 0.3 .mu.g/ml of anti-PD-1) as compared to anti-PD-1 alone
plus isotype control. Hu22D2 alone or in combination with
anti-PD-1, showed comparable activity to a benchmark anti-LAG3
antibody. Hu2D2 is Ab6. .alpha.-PD-1 is a fully human IgG4
anti-human PD1 monoclonal antibody. Benchmark anti-LAG3 is a fully
human IgG4 anti-human LAG3 monoclonal antibody that binds to the
human LAG3 extraloop.
Example 14
Effect of hu22D2 Treatment+/-Anti-PD-1 Treatment on IFN-Gamma and
TNF.alpha. Production in MLR Stimulated Human PBMCs
A MLR system was also used to test the activity of hu22D2 in
primary T cells. Human PBMCs are stimulated with monocyte-derived
dendritic cells from a different donor, leading to T cell
activation due to MEW mismatch. A high degree of variability in
donor responses was observed in this assay. However, preliminary
data demonstrated that neutralization of LAG3 activity, alone and
in the presence of anti-PD-1 enhanced T cell activation in two out
of three donors, as assessed by IFN-.gamma. and TNF-.alpha.
production (FIG. 8). Hu2D2 is Ab6.
Example 15
Pharmacokinetic and Pharmacodynamics Analysis of Anti-LAG3 in
Cynomolgous Monkeys
Pharmacokinetic and pharmacodynamics profile of Ab6 in cynomolgous
monkeys was evaluated. Procedures involving the care and use of
animals in the study were reviewed and approved. During the study,
the care and use of animals were conducted in accordance with the
principles outlined in the guidance of the Association for
Assessment and Accreditation of Laboratory Animal Care (AAALAC),
the Animal Welfare Act, the American Veterinary Medical Association
(AVMA) Euthanasia Panel on Euthanasia, and the Institute for
Laboratory Animal Research (ILAR) Guide to the Care and Use of
Laboratory Animals.
25 naive male cynomolgus monkeys of Chinese origin (4.0-7.0 kg at
time of dosing) were used. Animals were observed twice daily.
Additionally, animals were observed at each blood collection time
point. Body weights were recorded once prior to each dosing
occasion.
In the study, five males were assigned into each of 5 groups.
Animals in all groups were administered 5 doses of test or control
articles IV via a cephalic vein over 10 minutes. The doses for the
groups were 0.03 mg/kg, 0.3 mg/kg, 1 mg/kg, 10 mg/kg and 30 mg/kg.
Pharmacokinetic samples were drawn for all animals on Day 1:
predose and 15 minutes and 1, 4, 8, 24 (Day 2), 48 (Day 3) and 96
(Day 5) hours post dose. Samples were also collected on Day 8:
predose and 1, 8, 24 (Day 9), 48, (Day 10), 120 (Day 13) and 168
(Day 15) hours post dose. All samples were processed to plasma,
stored frozen at -70.degree. C..+-.10.degree. C. until analyzed.
Pharmacodynamic samples were drawn for all animals on Day 1:
predose and 15 minutes and 1, 4, 8, 24 (Day 2), 48 (Day 3) and 96
(Day 5) hours post dose. Samples were also collected on Day 8:
predose and 1, 8, 24 (Day 9), 48 (Day 10), 120 (Day 13) and 168
(Day 15) hours post dose. All samples were processed to plasma,
stored frozen at -70.degree. C..+-.10.degree. C. until
analyzed.
Total antibody and free (unbound antibody and partially bound) were
evaluated by two different assays, universal assay and antigen
capture assay, respectively. The data from this evaluations were
set forth in FIG. 9 (Ag-Capture assay results) and FIG. 10
(Universal Assay results). The clearance and volume of distribution
at steady state for each dose level were estimated and tabulated in
Tables 16 (antigen capture assay) and 17 (universal assay). The
differences between the antibody clearance and volume of
distribution parameters demonstrated that a portion of the Ab6
antibody was engaging its target in the cynomolgous monkey
subjects.
TABLE-US-00074 TABLE 16 LAG3 antigen-capture assay-Clearance of Ab6
and volume of distribution at steady state (Vss) at various doses.
Dose Clearance Vss (mg/kg) (mL/hr/kg) (mL/kg) 0.03 6.8 76.4 0.3
0.48 75.5 1 0.45 95.3 10 0.33 72.3 30 0.29 63.6
The antigen-capture data detected free antibody in the sample.
These antigen-capture data (data not shown) demonstrated a 23-fold
difference in clearance over the dose range investigated (0.003
mg/kg-30 mg/kg) (Table 16).
TABLE-US-00075 TABLE 17 Total antibody assay-Clearance of Ab6 and
volume of distribution at steady state (Vss) at various doses. Dose
Clearance Vss (mg/kg) (mL/hr/kg) (mL/kg) 0.03 0.94 47 0.3 0.36 48.9
1 0.33 56.1 10 0.26 60.9 30 0.26 66.5
The total antibody data detected total antibody in the sample.
These total antibody data (FIG. 9) demonstrated a 3.6-fold
difference in clearance over the dose range investigated (0.003
mg/kg-30 mg/kg) (Table 17).
The total concentration of Ab6 in cynolmolgous monkeys at the 0.03
mg/kg, 0.3 mg/kg, 1 mg/kg, 10 mg/kg and 30 mg/kg doses over time
were evaluated. The data from this evaluation are set forth in FIG.
10. As the dose increased, the clearance of the antibody from the
subjects decreased. The dose-normalized concentration data of Ab6
over time is set forth in FIG. 11. At later timepoints, after the
second IV bolus administration of Ab6, there was loss of exposure
indicating potential immunogenicity against the antibody.
LAG3 target-mediated clearance of the Ab6 antibody was observed
when concentration of the antibody were observed in the monkey
subjects over time. A two compartment PK model with linear and
non-linear (Vmax, Km) clearance parameters was developed to
describe the concentration-time profiles for Ab6. These data are
set forth in FIG. 12.
All references cited herein are incorporated by reference to the
same extent as if each individual publication, database entry (e.g.
Genbank sequences or GeneID entries), patent application, or
patent, was specifically and individually indicated to be
incorporated by reference. This statement of incorporation by
reference is intended by Applicants, pursuant to 37 C.F.R. .sctn.
1.57(b)(1), to relate to each and every individual publication,
database entry (e.g. Genbank sequences or GeneID entries), patent
application, or patent, each of which is clearly identified in
compliance with 37 C.F.R. .sctn. 1.57(b)(2), even if such citation
is not immediately adjacent to a dedicated statement of
incorporation by reference. The inclusion of dedicated statements
of incorporation by reference, if any, within the specification
does not in any way weaken this general statement of incorporation
by reference. Citation of the references herein is not intended as
an admission that the reference is pertinent prior art, nor does it
constitute any admission as to the contents or date of these
publications or documents.
The present invention is not to be limited in scope by the specific
embodiments described herein. Indeed, various modifications of the
invention in addition to those described herein will become
apparent to those skilled in the art from the foregoing description
and the accompanying figures. Such modifications are intended to
fall within the scope of the appended claims.
The foregoing written specification is considered to be sufficient
to enable one skilled in the art to practice the invention. Various
modifications of the invention in addition to those shown and
described herein will become apparent to those skilled in the art
from the foregoing description and fall within the scope of the
appended claims.
SEQUENCE LISTINGS
0 SQTB SEQUENCE LISTING The patent contains a lengthy "Sequence
Listing" section. A copy of the "Sequence Listing" is available in
electronic form from the USPTO web site
(https://seqdata.uspto.gov/?pageRequest=docDetail&DocID=US11278620B2-
). An electronic copy of the "Sequence Listing" will also be
available from the USPTO upon request and payment of the fee set
forth in 37 CFR 1.19(b)(3).
* * * * *
References