U.S. patent application number 14/612665 was filed with the patent office on 2015-05-28 for method of inducing antibodies to human immunodeficiency virus involving the administration of mper peptide-liposome conjugates.
The applicant listed for this patent is DUKE UNIVERSITY. Invention is credited to S. Munir Alam, Barton F. HAYNES, Hua-Xin Liao.
Application Number | 20150147387 14/612665 |
Document ID | / |
Family ID | 39864256 |
Filed Date | 2015-05-28 |
United States Patent
Application |
20150147387 |
Kind Code |
A1 |
HAYNES; Barton F. ; et
al. |
May 28, 2015 |
METHOD OF INDUCING ANTIBODIES TO HUMAN IMMUNODEFICIENCY VIRUS
INVOLVING THE ADMINISTRATION OF MPER PEPTIDE-LIPOSOME
CONJUGATES
Abstract
The present invention relates to a method of inducing the
production in a patient of anti-HIV antibodies. The method
comprises administering to a patient in need thereof an amount of
at least one liposome-peptide conjugate in an amount sufficient to
effect that induction. The peptide comprises a membrane external
proximal region (MPER) epitope and the liposome comprises
lysophosphorylcholine or phosphatidylserine.
Inventors: |
HAYNES; Barton F.; (Durham,
NC) ; Alam; S. Munir; (Durham, NC) ; Liao;
Hua-Xin; (Durham, NC) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
DUKE UNIVERSITY |
Durham |
NC |
US |
|
|
Family ID: |
39864256 |
Appl. No.: |
14/612665 |
Filed: |
February 3, 2015 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
12450779 |
Oct 13, 2009 |
8956627 |
|
|
PCT/US2008/004709 |
Apr 11, 2008 |
|
|
|
14612665 |
|
|
|
|
11785077 |
Apr 13, 2007 |
|
|
|
12450779 |
|
|
|
|
11812992 |
Jun 22, 2007 |
|
|
|
11785077 |
|
|
|
|
60960413 |
Sep 28, 2007 |
|
|
|
Current U.S.
Class: |
424/450 ;
424/188.1 |
Current CPC
Class: |
A61K 2039/55572
20130101; A61K 2039/55561 20130101; A61K 39/12 20130101; A61K
2039/575 20130101; A61K 2039/62 20130101; A61P 37/04 20180101; C12N
2740/15022 20130101; C07K 2317/76 20130101; A61K 2039/625 20130101;
A61P 31/18 20180101; A61K 2039/627 20130101; A61K 2039/64 20130101;
A61K 2039/6018 20130101; C07K 2317/21 20130101; C12N 7/00 20130101;
A61K 2039/55566 20130101; C12N 2740/16134 20130101; A61K 39/21
20130101; C07K 14/005 20130101; A61K 2039/55555 20130101; C07K
16/1063 20130101; C12N 2740/16122 20130101; A61K 39/385 20130101;
A61K 47/6911 20170801; C07K 2317/34 20130101; A61K 2039/545
20130101 |
Class at
Publication: |
424/450 ;
424/188.1 |
International
Class: |
A61K 39/21 20060101
A61K039/21; A61K 47/48 20060101 A61K047/48; C12N 7/00 20060101
C12N007/00 |
Goverment Interests
[0002] The invention was made with government support under Grant
Number U01 Al 067854 awarded by the National Institutes of Health.
The government has certain rights in the invention.
Claims
1. An immunogenic composition comprising a peptide comprising an
epitope of the human immunodeficiency virus type-1 (HIV-1) envelope
gp41 membrane proximal region (MPER) and a linker, wherein the
peptide is embedded in a liposome via the linker, and wherein said
liposome comprises cholesterol.
2. The composition of claim 1 further comprising an adjuvant.
3. A method of inducing an immune response in a subject comprising
administering the composition of claim 1 in an amount sufficient to
induce such response.
4. A method of inducing an immune response in a subject comprising
administering the composition of claim 2 in an amount sufficient to
induce such response.
Description
[0001] This is a continuation of U.S. application Ser. No.
12/450,779 (published as US 2010-0047331 A1), filed Oct. 13, 2009
(allowed), which is a U.S. national phase of International
Application No. PCT/US2008/004709 filed 11 Apr. 2008 which
designated the U.S. PCT/US2008/004709 is a continuation-in-part of
U.S. application Ser. No. 11/785,077 (published as US 2008-0031890
A1) filed 13 Apr. 2007 (pending) and a continuation-in-part of U.S.
application Ser. No. 11/812,992 (published as US 2008-0057075 A1)
filed 22 Jun. 2007 (abandoned). PCT/US2008/004709 claims priority
to U.S. Provisional Application No. 60/960,413 filed 28 Sep. 2007.
The entire contents of each of which are hereby incorporated by
reference.
TECHNICAL FIELD
[0003] The present invention relates, in general, to human
immunodeficiency virus (HIV), and, in particular, to a method of
inducing neutralizing antibodies to HIV and to compounds and
compositions suitable for use in such a method.
BACKGROUND
[0004] The first antibodies that are made in acute HIV-1 infection
are against the CD4 binding site (Moore et al, J. Virol. 68(8) 5142
(1994)), the CCR5 co-receptor binding site (Choe et al, Cell
114(2):161-170 (2003)), and the V3 loop (Moore et al, J. Acquir.
Immun. Def. Syn. 7(4):332 (1994)). However, these antibodies do not
control HIV-1 and are easily escaped (Burton et al, Nature Immun.
5:233-236 (2004), Wei et al, Nature 422(6929):307-312 (2003)).
Neutralizing antibodies against autologous virus develop fifty to
sixty days after infection, but antibodies capable of neutralizing
heterologous HIV-1 strains do not arise until after the first year
of infection (Richman et al, Proc. Natl. Acad. Sci. USA
100(7):4144-4149 (2003), Wei et al, Nature 422(6929):307-312
(2003)).
[0005] The four epitopes on HIV-1 envelope to which rare broadly
reactive neutralizing antibodies bind are the CD4 binding site
(CD4BS) (mab (monoclonal antibody) IgG1b12) (Zwick et al, J. Virol.
77(10):5863-5876 (2003)), the membrane proximal external region
(MPER) epitopes defined by human mabs 2F5 and 4E10 (Armbruster et
al, J. Antimicrob. Chemother. 54:915-920 (2004), Stiegler and
Katinger, J. Antimicrob. Chemother. 51:757-759 (2003), Zwick et al,
Journal of Virology 79:1252-1261 (2005), Purtscher et al, AIDS
10:587 (1996)) (FIG. 1), and the mannan glycan epitope defined by
human mab 2G12 (Scanlan et al, Adv. Exper. Med. Biol. 535:205-218
(2003)). These four rare human mabs are all unusual: two are IgG3
(2F5 and 4E10), one has a unique Ig dimer structure (2G12), one has
a very hydrophobic CDR3 (2F5) (Ofek et al, J. Virol. 198:10724
(2004)), and, in all four, the CDR3 is unusually long (Burton et
al, Nature Immunol. 5(3):233-236 (2004), Kunert et al, AIDS Res.
Hum. Retroviruses 20(7):755-762 (2004), Zwick et al, J. Virol.
78(6):3155-3161 (2004), Cardoso et al, Immunity 22:163-172 (2005)).
Of these, 2F5- and 4E10-like human mabs are quite rare. Acute HIV-1
patients do not make antibodies against the MPER or 2G12 epitopes
(Robinson, unpublished (2005), Shaw, unpublished (2005), MPER can
be defined as amino acids 652 to 683 of HIV envelope (Cardoso et
al, Immunity 22:163-173 (2005) (e.g.,
QQEKNEQELLELDKWASLWNWFDITNWLWYIK). CD4 binding site (BS) antibodies
are commonly made early in HIV-1 infection, but these antibodies
generally do not have the broad spectrum of neutralization shown by
mab IgG1b12 (Burton et al, Nat. Immunol. 5(3):233-236 (2004)).
[0006] A number of epitopes of the HIV-1 envelope have been shown
to cross-react with host tissues (Pinto et al, AIDS Res. Hum.
Retrov. 10:823-828 (1994), Douvas et al, AIDS Res. Hum. Retrov.
10:253-262 (1994), Douvas et al, AIDS Res. Hum. Retrov.
12:1509-1517 (1996)), and autoimmune patients have been shown to
make antibodies that cross-react with HIV proteins (Pinto et al,
AIDS Res. Hum. Retrov. 10:823-828 (1994), Douvas et al, AIDS Res.
Hum. Retrov. 10:253-262 (1994), Douvas et al, AIDS Res. Hum.
Retrov. 12:1509-1517 (1996), Barthel et al, Semin. Arthr. Rheum.
23:1-7 (1993)). Similarly, induction of immune responses to
self-epitopes has been suggested to be a cause of the autoimmune
abnormalities and T cell depletion in AIDS (Douvas et al, AIDS Res.
Hum. Retrov. 12:1509-1517 (1996), Ziegler et al, Clin. Immunol.
Immunopath. 41:305-313 (1986)).
[0007] High affinity peptide ligands for the 2F5 mab have been made
that induce high levels of antibody against the peptide but do not
broadly neutralize HIV-1 primary isolates (McGaughey et al,
Biochemistry 42(11):3214-3223 (2003), Zhang et al, J. Virol.
78(15):8342-8348 (2004), rev. in Zwick et al, J. Virol.
79:1252-1261 (2005)). These results have been interpreted to mean
that the peptide ligands for 2F5 are not in the appropriate
conformation for induction of anti-MPER antibodies (Burton et al,
Nature Immunology 5(3):233-236 (2004), Zwick et al, J. Virol.
79:1252-1261 (2005)). A series of highly constrained HIV-1 Env
immunogens have been made with the IgG1b12, 2G12, 2F5 and 4E10
epitopes stably expressed, and it has been demonstrated that these
immunogens do not induce broadly reactive neutralizing antibodies
in guinea pigs or rabbits, and, specifically, do not make
neutralizing antibodies to the MPER epitopes (Liao et al, J. Virol.
78(10):5270-5278 (2004); Haynes, unpublished (2005)). These results
have raised the question as to whether broadly reactive
neutralizing antibodies to HIV-1 envelope are not made in normal
animals and humans because they cannot be made.
[0008] Because long, hydrophobic CDR3 regions are typical of
natural polyreactive autoantibodies (Meffre et al, J. Clin. Invest.
108:879-886 (2001), Ramsland et al, Exp. Clin. Immun. 18:176-198
(2001)), and HIV-1-infected patient B lymphocytes are polyclonally
driven to make cardiolipin antibodies (Weiss et al, Clin. Immunol.
Immunopathol. 77:69-74 (1995), Grunewald et al, Clin. Exp. Immunol.
15:464-71 (1999)), studies were undertaken to assay these and other
anti-HIV-1 mabs for cardiolipin and other autoantigen reactivities.
The present invention results, at least in part, from the
realization that two broadly reactive HIV-1 envelope gp 41 human
mabs, 2F5 and 4E10, are polyspecific autoantibodies reactive with
cardiolipin.
SUMMARY OF THE INVENTION
[0009] The present invention relates generally to human HIV. More
specifically, the invention relates to a method of inducing
neutralizing antibodies to HIV and to compounds and compositions
suitable for use in such a method. In a specific embodiment, the
present invention provides immunogens that present MPER epitopes in
their native membrane bound environment, and immunization methods
using such immunogens that break tolerance.
[0010] Objects and advantages of the present invention will be
clear from the description that follows.
BRIEF DESCRIPTION OF THE DRAWINGS
[0011] FIG. 1. Broadly neutralizing antibodies (2F5, 4E10) bind to
epitopes that lie proximal to the host membrane (SEQ ID NO:12 and
SEQ ID NO:21, respectively). Both 2F5 and 4E1 mAbs are IgG3, have
long CDR3s, and bind to epitopes that lie within HIV-1 gp41 (aa
660-683) membrane proximal external region (MPER).
[0012] FIGS. 2A-2D. Reactivity of 2F5, 4E10, IgG1 b12 Mabs with
human Hep-2 epithelial cells. FIG. 2A shows Mab 2F5 reacting with
Hep-2 cells in a diffuse cytoplasmic and nuclear pattern, FIG. 2B
shows Mab 4E10 reacting with HEp-2 cells in a pattern similar to
2F5. FIG. 2C shows Mab IgG1 b12 reacting with Hep-2 cells in a
diffuse cytoplasmic pattern, with nucleoli reactive in the nucleus.
FIG. 2C insert shows higher magnification of cells showing the
nucleolar reactivity of IgG1 b12 (arrows). FIG. 2D shows negative
reactivity of Mab 1.9F on Hep-2 cells. Antibody amounts per slide
assayed in FIGS. 2A-2D were 3.75 .mu.g per slide of Mab. Mab 2F5
was positive on HEp-2 cells at 0.125 .mu.g per slide (5 .mu.g/ml).
Mab 4E10 was positive on HEp-2 at 0.125 .mu.g per slide (5
.mu.g/ml), and IgG1b12 was positive at 1.25 .mu.g per slide (50
.mu.g/ml). All Figs. X200; FIG. 2C insert X400. Images shown are
from an experiment representative of three performed.
[0013] FIGS. 3A-3D. Assay of Mabs 2F5 and 4E10 against lipids and
specificity of binding. FIG. 3A shows ELISA reactivity of MAbs 4E10
(solid bars) and 2F5 (open bars) to cardiolipin (CL),
phosphatidylserine (PS), phosphatidylcholine (PC),
phophatidylethanolamine (PE), and sphingomyelin (SM). Whereas both
4E10 and 2F5 reacted with cardiolipin, only 4E10 reacted with the
other lipids tested. Reactivity of control human anti-CCR5 binding
site MAb 1.7b was negative (data not shown). Reactivity of MAbs
against empty coated plate was similarly negative (not shown). To
show specificity of binding of MAb 2F5 to cardiolipin, 150-300
.mu.g/ml of 2F5 and 1000 .mu.g/ml of anti-2F5 idiotype murine MAb
3H6, which blocks the neutralization of HIV-1 by MAb 2F5 (Kunert et
al, AIDS 16:667 (2002)), were used. The 2F5 anti-idiotype
significantly blocked the binding of MAb 2F5 to cardiolipin by a
mean of 70% in 3 separate experiments (p<0.03) (FIG. 3B). In a
separate ELISA, MAb 2F5 bound to cardiolipin in half-maximal (EC50)
response of 660 nM (not shown). FIG. 3C shows the dose response
curve of 4E10 MAb binding to cardiolipin. The half-maximal (EC50)
response of 4E10 binding (80 nM) was calculated from a four
parametric, sigmoidal curve fitting analysis. Binding data was
acquired from an ELISA of 4E10 MAb binding (0.5 nM-1000 nM) to
cardiolipin coated on ELISA plate (1.35 .mu.g/well). FIG. 3D shows
soluble HIV-1 Env gp140 oligomers (CON-S) expressing the 4E10
epitope inhibits binding of 4E10 MAb to cardiolipin. The IC50 of
inhibition of 4E10 binding to cardiolipin was calculated to be 145
nM. The inhibition assay was carried out by using varying
concentrations of gp140 (19.25-1230 nM) mixed with 10 .mu.g/ml of
4E10 MAb, which were then added to wells containing 1.35 .mu.g of
cardiolipin. MAb 3H6 (1 mg/ml) (but not control MAb) also blocked
the binding of MAb 2F5 to SSA/Ro, centromere B, and histones (not
shown). All data in FIGS. 3A-3D are representative of at least two
experiments performed.
[0014] FIGS. 4A and 4B. Amino acid (FIG. 4A) (SEQ ID NO:24) and
nucleic acid (FIG. 4B) (SEQ ID NO:25) sequences of CON-S Env gp160.
A CFI form of the protein of FIG. 4A was used in Example 2.
(Gp140CFI refers to an HIV-1 envelope design with the cleavage site
(C), fusion site (F), and gp41 immunodominant region (I) deleted in
addition to the deletion of the transmembrane and cytoplasmic
domains.)
[0015] FIG. 5. Structures of phosphospholipids used in immunization
regimens and resulting neutralization titers.
[0016] FIGS. 6A and 6B. Peptide sequences used in the generation of
peptide-liposome conjugates (SEQ ID NOs:26, 27, 2-11, 13 and 14,
respectively). The nominal epitopes of mAbs 2F5 and 4E10 binding
epitopes include sequences ELDKWAS (SEQ ID NO:12) and WFNITNW (SEQ
ID NO:21), respectively, and are underlined. The V3 sequences were
derived from gp120 of HIV-1 MN strain and were used as a control
construct. Scrambled sequences are used controls.
[0017] FIG. 7. Schematic presentation of various designs of MPER
gp41 constructs (SEQ ID NOs:15-20, respectively). The functional
regions are indicated above the schematic constructs. Amino acid
sequences are indicated below each of schematic constructs.
Initiation and maturation signal sequences are highlighted in blue;
immunodominant regions are highlighted in bold; MPER regions are
highlighted in brown and GTH1 domains are highlighted in red and
transmembrane domains are underlined. His-tags were added to the
C-terminal ends of the constructs for easy purification and are
highlighted in green.
[0018] FIG. 8. Binding of mAb 4E10 to peptide-liposome conjugates.
BIAcore binding curves show specific and markedly higher binding of
mAb 4E10 to GTH1-4E10 liposomes. Low levels of binding with fast
kinetics to GTH1-2F5 liposomes were also detected.
[0019] FIG. 9. Binding of 2F5 mAb to peptide-liposomes. MAb 2F5
bound specifically to GTH1-2F5 liposomes and showed no binding to
GTH1-4E10 liposomes.
[0020] FIG. 10. A32 mAb binding to peptide-liposomes. A control
anti-gp120 Mab, A32, showed no binding to any of the liposome
conjugates. 17b, a CD4-inducible mAb, also showed no binding to the
above liposome conjugates (data not shown).
[0021] FIG. 11. Generation of fluorescein conjugated
peptide-liposomes. Peptide-liposomes were conjugated with a
fluorescein tag by incorporating fluorescein-POPE in the lipid
composition. Binding assays show that the specificity of mAb 4E10
binding is retained in fluorescein conjugated liposomes.
Fluorescein-conjugated GTH1-2F5 liposomes gave similar results.
[0022] FIG. 12. Reactivity of immunized guinea pig sera with 4E10
peptide. ELISA binding assay show strong positive reactivity of
sera to 4E10 peptide from two guinea pigs immunized with GTH1-4E10
liposomes. All pre-bleed sera gave background binding while a low
level of binding was observed in a serum from an animal immunized
with 4E10 peptide. Both the positive sera from the peptide-liposome
immunized animals also showed neutralizing activity (Table 2). One
serum (1102) showed neutralization of MN and SS1196 strains with
antibody titers at 1:209 and 1:32 respectively. The second serum
(1103) was only effective against the MN virus (1:60).
[0023] FIG. 13. MPER mAb binding to peptide epitope follows a
simple model (Langmuir equation).
[0024] FIG. 14. Neutralizing MPER mAb binding to epitope
peptide-lipid conjugate follows a 2-step conformational change
model.
[0025] FIG. 15. Human cluster II mAbs (98-6, 167-D, 126-6) bind
strongly to Env gp140.
[0026] FIGS. 16A-16D. Human Cluster II mAbs bound strongly to the
anionic phospholipid, cardiolipin.
[0027] FIGS. 17A-17E. Human Cluster II mAb 98-6 bound to 2F5
peptide-lipid conjugates with higher avidity and followed the
2-step conformational change model.
[0028] FIGS. 18A-18C: Structures of TLR adjuvants formulated with
liposomes. FIG. 18A Lipid A; FIG. 18B Oligo CpG (SEQ ID NO:28);
FIG. 18C R-848.
[0029] FIGS. 19A-19C: Pictorial representation of TLR adjuvant-MPER
peptide liposomes. FIG. 19A Lipid A; FIG. 19B Oligo CpG; FIG. 19C
R-848.
[0030] FIGS. 20A-20C: Interaction of 2F5 mAB with MPER
peptide-liposomes conjugated to TLR adjuvants. FIG. 20A shows
strong binding of 2F5 mab to gp41 MPER liposome constructs with
Lipid A (200 .mu.g dose equivalent). FIG. 20B shows binding of 2F5
mAb to oCpG (50 .mu.g dose equivalent) conjugated gp41 MPER
liposomes. FIG. 20C shows binding of 2F5 mAb to R848-conjugated
gp41 MPER containing liposomes. In comparison to control liposomes
with only TLR adjuvants, strong binding of 2F5 mAb was observed to
each of the gp41 MPER-adjuvant liposomal constructs.
[0031] FIG. 21: Amino acid sequence of the MPER656-TMD peptide (SEQ
ID NOs:29 and 30, respectively).
[0032] FIGS. 22A and 22B: Pictorial representation of liposome
immobilization on L-1 chip. FIG. 22A Synthetic liposomes. FIG. 22B
MPER656-TMD liposomes.
[0033] FIGS. 23A and 23B: Interaction of 2F5 and 4E10 mAbs with
MPER656-TMD liposomes. FIG. 23A 2F5 and FIG. 23B 4E10.
DETAILED DESCRIPTION OF THE INVENTION
[0034] The present invention results, at least in part, from
studies demonstrating that certain broadly neutralizing HIV-1
antibodies are autoantibodies. A large number of HIV.sup.+ patients
transiently make low levels of such antibodies, however, the
studies described herein indicate that gp41 epitopes do not induce
these antibody specificities but, rather, that cross-reactive
autoantigens, including cardiolipin, are the priming antigen.
[0035] The present invention provides a method of inducing
antibodies that neutralize HIV. The method comprises administering
to a patient in need thereof an amount of at least one heterologous
(e.g., non-human) or homologous (e.g., human) cross-reactive
autoantigen sufficient to effect the induction. Cross-reactive
autoantigens suitable for use in the instant invention include
cardiolipin, SS-A/RO, dsDNA from bacteria or mammalian cells,
centromere B protein and RiBo nucleoprotein (RNP).
[0036] Suitable autoantigens also include phospholipids in addition
to cardiolipin, such as phosphatidylserine,
phosphatidylethanolamine, phosphatidylcholine,
phosphotidylinositol, sphingomyelin, and derivatives thereof, e.g.,
1-palmitoyl-2-oleoyl-sn-glycero-3-[phospho-L-serine] (POPS),
1-palmitoyl-2-oleoyl-phosphatidylethanolamine (POPE), and dioleoyl
phosphatidylethanolamine (DOPE). Use of hexagonal II phases of
phospholipids can be advantageous and phospholipids that readily
form hexagonally packed cylinders of the hexagonal II tubular phase
(e.g., under physiological conditions) are preferred, as are
phospholipids that can be stabilized in the hexagonal II phase.
(See Rauch et al, Proc. Natl. Acad. Sci. USA 87:4112-4114 (1990);
Aguilar et al et al, J. Biol. Chem. 274: 25193-25196 (1999)).
[0037] Fragments of such autoantigens comprising the cross-reactive
epitopes can also be used.
[0038] The autoantigen, or fragment thereof, can be used, for
example, in prime boost regimens that can be readily optimized by
one skilled in the art (DNA sequences encoding proteinaceous
components of such regimens can be administered under conditions
such that the proteinaceous component is produced in vivo). By way
of example, cross-reactive autoantigen can be used as a first
vaccine prime to boost natural auto-antibodies (e.g.,
anti-cardiolipin 4E10- and 2F5-like antibodies). Either autoantigen
(e.g., cardiolipin (or fragment thereof)), or an HIV-envelope
protein/polypeptide/peptide comprising a cross-reactive epitope(s),
such as the 2F5 and/or 4E10 epitopes (which epitopes can include at
least the sequences ELDKWA (SEQ ID NO:23) and NWFDIT (SEQ ID
NO:22), respectively), can be used as the boost. (See sequences
disclosed in PCT/US04/30397.) (It will be appreciated that
HIV-envelope is not an autoantigen.)
[0039] The mode of administration of the autoantigen and/or
HIV-protein/polypeptide/peptide, or encoding sequence, can vary
with the immunogen, the patient and the effect sought, similarly,
the dose administered. Optimum dosage regimens can be readily
determined by one skilled in the art. Typically, administration is
subcutaneous, intramuscular, intravenous, intranasal or oral.
[0040] The immunogenic agents can be administered in combination
with an adjuvant. While a variety of adjuvants can be used,
preferred adjuvants include CpG oligonucleotides and other agents
(e.g., TRL9 agonists) that can break tolerance to autoantigens
without inducing autoimmune disease (Tran et al, Clin. Immunol.
109:278-287 (2003), US Appin Nos. 20030181406, 20040006242,
20040006032, 20040092472, 20040067905, 20040053880, 20040152649,
20040171086, 20040198680, 200500059619).
[0041] In a specific embodiment, the invention relates to a
liposome based adjuvant conjugate that presents Toll like receptor
(TLR) ligands and HIV-1 gp41 neutralizing antigens. In accordance
with this embodiment, immune response enhancing TLR ligands such as
Lipid A, oligo CpG and R-848 can be formulated individually into
liposomes that have HIV-1 gp41 MPER peptide immunogen conjugated in
them. As described in Example 7 below, broadly neutralizing gp41
membrane proximal external region (MPER) antibodies (2F5, 4E10)
bind strongly to each of the TLR ligand adjuvant associated
liposome constructs. Constructs of this embodiment have application
in enhancing an immune response against poorly immunogenic of HIV-1
gp41 MPER.
[0042] In a further specific embodiment, the present invention
relates to the transmembrane domain anchoring of HIV-1 gp41 MPER
peptide to liposomes for functional display of the epitopes of
broadly neutralizing antibodies, such as 2F5 and 4E10. In
accordance with this embodiment, the transmembrane domain (TMD) of
HIV-1 gp41 can be used to anchor the MPER peptide into liposomes
comprising synthetic lipids. As described in Example 8 below,
broadly neutralizing anti-gp41 antibodies 2F5 and 4E10 both bind to
the MPER-TMD-liposome conjugates. This construct provides a
strategy to present gp41 neutralizing epitopes anchored on liposome
using the native TMD of HIV-1. Induction of trimerization of the
TMD can facilitate formation of trimeric forms of gp41 MPER.
[0043] The invention includes compositions suitable for use in the
instant method, including compositions comprising the autoantigen,
and/or HIV protein/polypeptide/peptide comprising one or more
cross-reactive epitopes (e.g., 4E10 and/or 2F5 epitopes), or 4E10
or 2F5 epitope mimics, and a carrier. When a DNA prime or boost can
be used, suitable formulations include a DNA prime and a
recombinant adenovirus boost and a DNA prime and a recombinant
mycobacteria boost, where the DNA or the vectors encode, for
example, either HIV envelope or a protein autoantigen, such as
SS-A/Ro. Other combinations of these vectors can be used as primes
or boosts, either with or without HIV protein/polypeptide/peptide
and/or autoantigen. The composition can be present, for example, in
a form suitable for injection or nasal administration.
Advantageously, the composition is sterile. The composition can be
present in dosage unit form.
[0044] The present invention also relates to a passive
immunotherapy approach wherein B cells from patients with a primary
autoimmune disease, such as systemic lupus erythematosis (SLE) or
anti-phospholipid antibody syndrome or patients with infectious
diseases such as syphilis, leishmaniasis, and leprosy, can be used
in the production of cross-reactive antibodies (including
monoclonal antibodies other than 4E10 and 2F5). Autoimmune disease
patients can make antibodies that, in some capacity, have the
ability to neutralize HIV-1, either in binding to the HIV envelope
or in binding to lipids on the surface of the virion, or both.
Moreover autoimmune disease patients can make a protective
neutralizing type antibody either constitutively or after HIV-1
infection.
[0045] That is, the invention includes the use of B cells from SLE
patients, as well as other patients with disordered
immunoregulation (that is, patients with a primary autoimmune
disease, or a non-HIV infection such as those noted above, that
produce autoantibodies cross-reactive with HIV envelope), in the
production of immortal cell lines that provide a source of
antibodies that cross-react with HIV envelope (such as 2F5-like and
4E10-like antibodies) (see Stiegler et al, AIDS Res. Hum.
Retroviruses 17:1757-1765 (2001), Armbruster et al, J. Antimicrob.
Chemother. 54:915-920 (2004), U.S. Pat. No. 5,831,034).
Advantageously, the B cells are from an SLE patient (or patient
with another primary autoimmune disease) that is HIV infected or
that has received an envelope-based HIV vaccine (while not wishing
to be bound by theory, HIV infection or vaccination may serve to
"boost" primed B1 cells (e.g., cardiolipin-primed B1 cells) to
produce 2F5- and/or 4E10-like antibodies and escape deletion (which
would occur in a normal subject)--the "boost" may trigger somatic
hypermutation so that the resulting Ig genes encode antibodies that
fit 2F5 and or 4E10-like epitopes--or that fit other gp160 epitopes
that induce broadly neutralizing antibodies but are deleted in
normal subjects). The production of immortal cell lines from B
cells can be effected using any of a variety of art recognized
techniques, including, but not limited to, fusing such B cells with
myeloma cells to produce hybridomas. The invention also includes
antibodies from normal subjects and from autoimmune disease
patients that do not react HIV envelope but rather with
virus-infected cells and or virions, that is, they bind to lipid on
the virus or virus-infected cells (see Example 6).
[0046] Once selected, sequences encoding such cross-reactive
antibodies (or binding fragments thereof) can be cloned and
amplified (see, for example, Huse et al, Science 246:1275-1281
(1989), and phage--display technology as described in WO 91/17271,
WO 92/01047, U.S. Pat. Nos. 5,877,218, 5,871,907, 5,858,657,
5,837,242, 5,733,743 and 5,565,332). Soluble antibodies for therapy
can then be designed and produced using art recognized techniques
(Stiegler et al, AIDS Res. Hum. Retroviruses 17:1757-1765 (2001),
Armbruster et al, J. Antimicrob. Chemother. 54:915-920 (2004)).
Suitable antibodies can be produced in Chinese Hamster Ovary (CHO)
cells.
[0047] In accordance with this approach, the antibody (or binding
fragment thereof) can be administered in doses ranging from about
10 to 100 mg/dose, preferably 25 mg/dose. The dosage and frequency
can vary with the antibody (or binding fragment thereof), the
patient and the effect sought (see Armbruster et al, J. Antimicrob.
Chemother. 54:915-920 (2004)). The antibodies described above can
be used prophylactically or therapeutically.
[0048] The antibodies (or binding fragments thereof), or DNA
encoding the antibodies or binding fragments, can be formulated
with a carrier (e.g., pharmaceutically acceptable carrier) and can
be administered by, for example, parenteral, intravenous,
subcutaneous, intramuscular or intranasal routes.
[0049] Finally, animal species such as camels (Ramsland et al, Exp.
Clin. Immunogenet. 18:176-198 (2001), Litman et al, Annu. Rev.
Immunol. 7:109-147 (1999)), cows (Ramsland et al, Exp. Clin.
Immunogenet. 18:176-198 (2001), Litman et al, Annu. Rev. Immunol.
7:109-147 (1999)) and sharks (Ramsland et al, Exp. Clin.
Immunogenet. 18:176-198 (2001), Litman et al, Annu. Rev. Immunol.
7:109-147 (1999), Hohman et al, Proc. Natl. Acad. Sci. USA.
90:9882-9886 (1993)) have very long CDR3 lengths, and their
antibodies show polyreactivitiy. These engineered CDR3s that show
polyreactivity to HIV envelope can be utilized for making potent
therapeutic antibodies (e.g, monoclonal antibodies, including, for
example, chimeric and humanized antibodies, and antigen binding
fragments thereof) to HIV and to many infectious agents.
[0050] In a specific embodiment, the present invention further
relates to synthetic liposome-peptide conjugates and to methods of
using same as immunogens for the generation of broadly neutralizing
antibodies against HIV-1. This embodiment of the invention provides
compositions and methods for embedding into synthetic liposomes
nominal epitope peptides of broadly neutralizing antibodies that
bind to the MPER of HIV-1 gp41. Also provided are immunization
strategies and protocols for the generation of anti-HIV-1
neutralizing antibodies and for the detection of antigen specific B
cell responses.
[0051] In accordance with this embodiment of the invention, peptide
sequences that include a nominal epitope of a broadly neutralizing
anti-HIV antibody and a hydrophobic linker, such as GTH1 (see FIG.
6 for sequence), are embedded into synthetic liposomes. In a
preferred aspect, the nominal epitope is that of mAbs 2F5 (ELDKWAS)
(SEQ ID NO:12) or 4E10 (WFNITNW) (SEQ ID NO:21), which, as noted
above, lie in the MPER of HIV-1 envelope gp41. The epitope can be
present in the peptide such that antibodies specific therefor have
relatively unconstrained access or, alternatively, the epitope can
be present in the peptide in relation to the hydrophobic linker so
as to mimic the native orientation of the MPER region. Specific
examples of peptide sequences suitable for use in the invention are
set forth in FIG. 6. In addition, the MPER gp41 region can be
expressed as recombinant proteins in recombinant vaccinia virus, in
human cell expression systems, and formulated with amphipathic
alpha helices at the N or C termini of the gp41 component for ease
in association with liposomes (FIG. 7).
[0052] Liposomes suitable for use in the invention include, but are
not limited to, those comprising POPC, POPE, DMPA (or sphingomyelin
(SM)), lysophosphorylcholine, phosphatidylserine, and cholesterol
(Ch). While optimum ratios can be determined by one skilled in the
art, examples include POPC:POPE (or POPS):SM:Ch or POPC:POPE (or
POPS):DMPA:Ch at ratios of 45:25:20:10. Alternative formulations of
liposomes that can be used include DMPC
(1,2-dimyristoyl-sn-glycero-3-phosphocholine) (or
lysophosphorylcholine), cholesterol (Ch) and DMPG
(1,2-dimyristoyl-sn-glycero-3-phoshpho-rac-(1-glycerol) formulated
at a molar ratio of 9:7.5:1 (Wassef et al, ImmunoMethods 4:217-222
(1994); Alving et al, G. Gregoriadis (ed.), Liposome technology
2.sup.nd ed., vol. III CRC Press, Inc., Boca Raton, Fla. (1993);
Richards et al, Infect. Immun. 66(6):285902865 (1998)). The
above-described lipid compositions can be complexed with lipid A
and used as an immunogen to induce antibody responses against
phospholipids (Schuster et al, J. Immunol. 122:900-905 (1979)). A
preferred formulation comprises POPC:POPS:Ch at ratios of 60:30:10
complexed with lipid A according to Schuster et al, J. Immunol.
122:900-905 (1979). Peptides suitable for inclusion in such a
formulation include, but are not limited to, 2F5-GTH1, 4E10-GTH1,
SP8926-GTH1, and SP8928-GTH1.
[0053] The optimum ratio of peptide to total lipid can vary, for
example, with the peptide and the liposome. For the peptides of
Example 3, a ratio 1:420 was advantageous.
[0054] The above-described liposomes can be admixed with
recombinant domain V of .beta.2 glycoprotein 1 to elicit antibodies
against this domain.
[0055] The liposome-peptide conjugates can be prepared using
standard techniques (see too Examples 3 and 4 that follow).
[0056] The peptide-liposome immunogens of the invention can be
formulated with, and/or administered with, adjuvants such as lipid
A, oCpGs, TRL4 agonists or TLR 7 agonists that facilitate robust
antibody responses (Rao et al, Immunobiol. Cell Biol. 82(5):523
(2004)). Other adjuvants that can be used include alum and Q521
(which do not break existing B cell tolerance). Preferred
formulations comprise an adjuvant that is designed to break forms
of B cell tolerance, such as oCpGs in an oil emulsion such as
Emulsigen (an oil in water emulsion) (Tran et al, Clin. Immunol.
109(3):278-287 (2003)). Additional suitable adjuvants include those
described in Ser. No. 11/302,505, filed Dec. 14, 2005, including
the TRL agonists disclosed therein.
[0057] The peptide-liposome immunogens can be administered, for
example, IV, intranasally, subcutaneously, intraperitoneally,
intravaginally, or intrarectally. The route of administration can
vary, for example, with the patient, the conjugate and/or the
effect sought, likewise the dosing regimen. The peptide-liposome
immunogens are preferred for use prophylactically, however, their
administration to infected individuals may reduce viral load.
[0058] As described in Example 3 that follows, the peptide-liposome
conjugates can be used as reagents for the detection of
MPER-specific B cell responses. For example, the peptide-liposome
constructs can be conjugated with a detectable label, e.g., a
fluorescent label, such as fluorescein. The fluorescein-conjugated
liposomes can be used in flow cytometric assays as a reagent for
the detection of anti-MPER specific B cell responses in hosts
immunized with HIV-1 Env proteins that present exposed MPER region.
These reagents can be used to study peripheral blood B cells to
determine the effectiveness of immunization for anti-MPER antibody
induction by measuring the number of circulating memory B cells
after immunization. The data presented in the Examples that follow
indicate that conformational change associated binding of HIV-1
cluster II monoclonal antibodies to nominal epitope peptide lipid
conjugates correlates with HIV-1 neutralization (see Example
5).
[0059] It will be appreciated from a reading of the foregoing that
if HIV has evolved to escape the host immune response by making the
immune system blind to it, other infectious agents may have evolved
similarly. That is, this may represent a general mechanism of
escape. That being the case, approaches comparable to those
described herein can be expected to be useful in the treatment of
such other agents well.
[0060] Certain aspects of the invention are described in greater
detail in the non-limiting Examples that follow (see also Maksyutov
et al, J. Clin. Virol. December; 31 Suppl 1:S26-38 (2004), US
Appin. 20040161429, and Haynes et al, Science 308:1906 (2005)).
[0061] This application is related to U.S. application Ser. No.
11/812,992, filed Jun. 22, 2007, U.S. application Ser. No.
11/785,077, filed Apr. 13, 2007, PCT/US2006/013684, filed Apr. 12,
2006, U.S. Prov. Appin. No. 60/670,243, filed Apr. 12, 2005, U.S.
Prov. Appin. No. 60/675,091, filed Apr. 27, 2005, U.S. Prov. Appin.
No. 60/697,997, filed Jul. 12, 2005, and U.S. Prov. Appin. No.
60/757,478, filed Jan. 10, 2006, the entire contents of which
applications are incorporated herein by reference.
Example 1
[0062] Design of an HIV-1 immunogen that can induce broadly
reactive neutralizing antibodies is a major goal of HIV-1 vaccine
development. While rare human mabs exist that broadly neutralize
HIV-1, HIV-1 envelope immunogens do not induce these antibody
specificities. In this study, it was demonstrated that the two most
broadly reactive HIV-1 envelope gp41 human mabs, 2F5 and 4E10, are
polyspecific, autoantibodies reactive with cardiolipin. Thus,
current HIV-1 vaccines may not induce antibodies against membrane
proximal gp41 epitopes because of gp41 membrane proximal epitopes
mimicry of autoantigens.
Experimental Details
Monoclonal Antibodies
[0063] Mabs 2F5, 2G12, and 4E10 were produced as described
(Steigler et al, AID Res. Human Retroviruses 17:1757 (2001),
Purtscher et al, AIDS 10:587 (1996), Trkola et al, J. Virol.
70:1100 (1996)). IgG1b12 (Burton et al, Science 266:1024-1027
(1994)) was the generous gift of Dennis Burton, Scripps Institute,
La Jolla, Calif. Mab 447-52D (Zolla-Pazner et al, AIDS Res. Human
Retrovirol. 20:1254 (2004)) was obtained from the AIDS Reagent
Repository, NIAID, NIH. The remainder of the mabs in Table 1 were
produced from HIV-1 infected subjects and used as described
(Robinson et al, AIDS Res. Human Retrovirol. 6:567 (1990), Binley
et al, J. Virol. 78:13232 (2004)).
[0064] Autoantibody Assays.
[0065] An anti-cardiolipin ELISA was used as described (DeRoe et
al, J. Obstet. Gynecol. Neonatal Nurs. 5:207 (1985), Harris et al,
Clin. Exp. Immunol. 68:215 (1987)). A similar ELISA was adapted for
assay for mab reactivity to phosphatidylserine,
phosphatidylcholine, phosphatidyethanolamine, and sphingomyelin
(all purchased from Sigma, St. Louis, Mo.). The Luminex AtheNA
Multi-Lyte ANA Test (Wampole Laboratories, Princeton, N.J.) was
used for mab reactivity to SS-A/Ro, SS-B/La, Sm, ribonucleoprotein
(RNP), Scl-70, Jo-1, double stranded (ds) DNA, centromere B, and
histone. Mab concentrations assayed were 150 .mu.g, 50 .mu.g, 15
.mu.g, and 5 .mu.g/ml. Ten .mu.l of each concentration (0.15 .mu.g,
0.05 .mu.g, 0.015 .mu.g, and 0.005 .mu.g, respectively, per assay)
were incubated with the Luminex fluorescence beads and the test
performed per manufacturer's specifications. Values in Table 1 are
results of assays with 0.15 .mu.g added per test. In addition, an
ELISA for SS-A/Ro (ImmunoVision, Springdale, Ark.) and dsDNA (Inova
Diagnostics, San Diego, Calif.) was also used to confirm these
autoantigen specificities. Reactivity to human epithelial Hep-2
cells was determined using indirect immunofluoresence on Hep-2
slides using Evans Blue as a counterstain and FITC-conjugated goat
anti-human IgG (Zeus Scientific, Raritan N.J.). Slides were
photographed on a Nikon Optiphot fluorescence microscope.
Rheumatoid factor was performed by nephelometry (Dade Behring, Inc
(Newark, Del.). Lupus anticoagulant assay was performed by
activated partial thromboplastin (aPTT) and dilute Russell viper
venom testing, as described (Moll and Ortel, Ann. Int. Med. 127:177
(1997)). Fourty .mu.l of 1 mg/ml of 2F5, 4E10 and control mabs were
added to pooled normal plasma (final mab concentration, 200
.mu.g/ml) for lupus anticoagulant assay. Anti-.beta.2
glycoprotein-1 assay was an ELISA (Inova Diagnostics, Inc.). Serum
antibodies to dsDNA, SS-A/Ro, SS-B/La, Sm, RNP and histone occur in
patients with SLE; serum antibodies to centromere B and scl-70
(topoisomerase I) are found in systemic sclerosis; and antibodies
to Jo-1 are found in association with polymyositis (Rose and
MacKay, The Autoimmune Diseases, Third Ed. Academic Press, San
Diego, Calif. (1998)).
Results
[0066] The reactivity of mabs 2F5 and 4E10, two additional rare
broadly reactive neutralizing mabs (2G12 and IgG1b12), and
thirty-one common anti-HIV-1 Env human mabs, with cardiolipin
(Robinson et al, AIDS Res. Human Retrovirol. 6:567 (1990)) was
determined (Table 1). Both 2F5 and 4E10 reacted with cardiolipin,
whereas all 33 of the other mabs were negative. Mab 2F5 also
reacted with SS-A/Ro, histones and centromere B autoantigen, while
mab 4E10 reacted with the systemic lupus erythematosus (SLE)
autoantigen, SS-A/Ro. Both 2F5 and 4E10 reacted with Hep-2 human
epithelial cells in a diffuse cytoplasmic and nuclear pattern
(Robinson et al, AIDS Res. Human Retrovirol. 6:567 (1990)) (FIG.
2). Thus, both 2F5 and 4E10 are characterized by polyspecific
autoreactivity.
TABLE-US-00001 TABLE 1 Hep-2 Cell Mab Type and Antibody Name
Cardiolipin Reactivity Ro (SSA) dsDNA Centromere B Histones
Membrane Proximal External 47 +Cytoplasmic 290 -- 1,776 1,011
Region (2F5) nuclear Membrane Proximal External 15,434 +Cytoplasmic
221 -- -- -- Region (4E10) nuclear CD4 Binding Site (IgG1b12) --
+Cytoplasmic -- 513 479 185 nucleolar CD4 Binding Site (F1.5E, 25G)
-- - -- -- -- -- Adjacent CD4 Binding Site -- - -- -- 1,131 --
(A32) Adjacent CD4 Binding Site -- - -- 768 1,422 539 (1.4G)
Adjacent CD4 Binding Site -- - -- -- -- -- (1.4C, 4.6H, 4.11C)
Third variable loop (CO11, -- - -- -- -- -- F2A3, F3.9F, LA21,
447-52D) gp41 immunodominant region -- - -- -- -- -- (7B2, KU32)
gp41 immunodominant region -- +intermediate -- -- 314 -- (2.2B)
filament C1-C4 gp120 (8.2A, 2.3B) -- - -- -- -- -- C1-C4 gp120
(EH21, C11) -- - -- -- -- -- Glycan-dependent (2G12) -- - -- -- --
-- CCR5 binding site (1.7B, 2.1C, -- - -- -- -- -- LF17, E51 1.9F,
LA15, 4.8E, LA28, 1.9E, E047, 2.5E, ED10) Positive control serum 34
+homogeneous 1365 228 624 34 nuclear Negative controls <16 -
<120 <120 <120 <120 All Mabs were negative in assays
for reactivity with La (SSB), Sm, Scl-70 and Jo-1, except for Ku32
mab that reacted with Sm. Ro (SSA), dsDNA, centromere B, histone
and cardiolipin antibody values are in relative units based on a
standard curve. - = negative
[0067] Of the two other rare neutralizing mabs, one mab, 2G12, was
not autoreactive, while another mab against the CD4 binding site,
IgG1b12 (Stiegler et al, AIDS Res. Hum. Retroviruses 17:1757
(2001)), reacted with ribonucleoprotein, dsDNA, and centromere B as
well as with Hep-2 cells in a cytoplamic and nucleolar pattern
(Table 1 and FIG. 2). Of the 31 more common anti-HIV-1 mabs
studied, only two mabs with specificity for binding near the CD4
binding site (A32, 1.4G) and a mab to a non-neutralizing gp41
epitope (2.2 B) showed evidence of polyreactivity (Table 1).
[0068] To determine if 2F5 and 4E10 were similar to prothrombotic
anti-cardiolipin antibodies found in SLE-associated
anti-phospholipid syndrome (Burton et al, Science 266:1024-1027
(1994)), both mabs were tested for lupus anticoagulant activity,
and for the ability to bind to prothombin (PT), beta-2
glycoprotein-1, phosphatidylserine (PS), phosphatidylcholine (PC),
phosphatidylethanolamine (PE), and sphingomyelin (SM) (Robinson et
al, AIDS Res. Human Retrovirol. 6:567 (1990)). Whereas 2F5 was
negative for these reactivities, 4E10 had lupus anticoagulant
reactivity, and reacted strongly with PS, PC, PE, weakly with SM
and PT, and negatively with .beta.2 glycoprotein-1. (See FIG.
3.)
[0069] Anti-cardiolipin antibodies can be found in patients with
disordered immunoregulation due to autoimmune disease or infection
(Burton et al, Science 266:1024-1027 (1994)). Anti-cardiolipin
autoantibodies are induced by syphilis, leprosy, leishmaniasis,
Epstein Barr virus, and HIV-1 (Burton et al, Science 266:1024-1027
(1994)). Unlike anti-cardiolipin antibodies found in SLE,
"infectious" anti-cardiolipin antibodies are rarely prothrombotic,
and are transient. Thus, 4E10 is similar to anti-cardiolipin
antibodies in autoimmune disease, and 2F5 is similar to
anti-cardiolipin antibodies in infectious diseases.
[0070] Autoreactive B cell clones with long CDR3 lengths are
normally deleted or made tolerant to self antigens ((Zolla-Pazner
et al, AIDS Res. Human Retrovirol. 20:1254 (2004)). Thus, HIV-1 may
have evolved to escape membrane proximal antibody responses by
having conserved neutralizing epitopes as mimics of autoantibody
epitopes. These data suggest that current HIV-1 vaccines do not
routinely induce robust membrane proximal anti-envelope
neutralizing antibodies because antibodies targeting these epitopes
are derived from autoreactive B cell clones that are normally
deleted or made tolerant upon antigenic stimulation by HIV-1 Env.
These observations may also explain the rare occurrence of HIV-1 in
SLE patients who may be unable to delete such clones (Fox et al,
Arth. Rhum. 40:1168 (1997)).
Example 2
[0071] The ability of autoantigens of the invention to induce the
production of neutralizing antibodies was studied using, as
autoantigen, cardiolipin (lamellar and hexagonal phases),
1-palmitoyl-2-oleoyl-sn-glycero-3-[phospho-L-serine](POPS)
(lamellar and hexagonal phases),
1-palmitoyl-2-oleoyl-phosphatidylethanolamine (POPE) (lamellar
phase) and dioleoyl phosphatidylethanolamine (DOPE) (hexagonal
phase). Guinea pigs (4 per group) were immunized with phospholopid
(cardiolipin lamellar phase, cardiolipin hexagonal phase, POPS
lamellar phase, POPS hexagonal phase, POPE lamellar phase or DOPE
hexagonal phase) in 10:g of oCpGs, four times, with each
immunization being two weeks apart. Following the four phospholipid
immunizations, a final immunization was made IP with 10:g of oCpGs
with 100:g of group M consensus Env, CON-S gp140CFI oligomer (that
is, the CFI form of the protein shown in FIG. 4A).
[0072] Neutralization assays were performed using an Env pseudotype
neutralization assay in TMZ cells (Wei et al, Nature 422:307-312
(2003), Derdeyn et al, J Virol 74:8358-8367 (2000), Wei et al,
Antimicrob Agents Chemother 46:1896-1905 (2002), Platt et al, J
Virol 72:2855-2864 (1998), Mascola et al, J. Virol. 79:10103-10107
(2005)), as described below:
Cell Culture
[0073] TZM-bl is an adherent cell line and is maintained in T-75
culture flasks. Complete growth medium (GM) consists of D-MEM
supplemented with 10% fetal bovine serum (FBS, heat-inactivated)
and gentamicin (50 .mu.g/ml). Cell monolayers are disrupted and
removed by treatment with trypsin/EDTA:
Trypsin-EDTA Treatment for Disruption of TZM-bl Cell
Monolayers:
[0074] Cell monolayers maintained in T-75 culture flasks are
disrupted and removed by treatment with trypsin/EDTA at confluency
when splitting cells for routine maintenance and when preparing
cells for assay. 1. Decant the culture medium and remove residual
serum by rinsing monolayers with 6 ml of sterile PBS. 2. Slowly add
2.5 ml of an 0.25% Trypin-EDTA solution to cover the cell
monolayer. Incubate at room temp for 30-45 seconds. Decant the
trypsin solution and incubate at 37.degree. C. for 4 minutes. Do
not agitate the cells by hitting or shaking the flask while waiting
for the cells to detach. 3. Add 10 ml of GM and suspend the cells
by gentle pipet action. Count cells. 4. Seed new T-75 culture
flasks with approximately 10.sup.6 cells in 15 ml of GM. Cultures
are incubated at 37.degree. C. in a 5% CO.sub.2/95% air
environment. Cells should be split approximately every 3 days.
Virus Stocks
[0075] Stocks of uncloned viruses may be produced in either PBMC or
T cell lines. Pseudoviruses may be produced by transfection in an
appropriate cell type, such as 293T cells. All virus stocks should
be made cell free by low speed centrifugation and filtration
(0.45-micron) and stored at -80.degree. C. in GM containing 20%
FBS.
TCID50 Determination
[0076] It is necessary to determine the TCID50 of each virus stock
in a single-cycle infection assay (2-day incubation) in TZM-bl
cells prior to performing neutralization assays. A cut-off value of
2.5-times background RFU is used when quantifying positive
infection in TCID50 assays.
[0077] Too much virus in the neutralization assay can result in
strong virus-induced cytopathic effects that interfere with
accurate measurements. Most virus stocks must be diluted at least
10-fold to avoid cell-killing. A standard inoculum of 200 TCID50
was chosen for the neutralization assay to minimize virus-induced
cytopathic effects while maintaining an ability to measure a 2-log
reduction in virus infectivity. It should be noted that different
strains vary significantly in their cytopathicity. Virus-induced
cytopathic effects may be monitored by visual inspection of
syncytium formation under light microscopy. Cytopthic effects may
also be observed as reductions in luminescence at high virus doses
in the TCID50 assay.
Neutralizing Antibody Assay Protocol
[0078] NOTE 1: All incubations are performed in a humidified
37.degree. C., 5% CO.sub.2 incubator unless otherwise specified.
NOTE 2: Assays with replication-competent viruses are performed in
DEAE-GM containing 1 .mu.M indinavir. 1. Using the format of a
96-well flat-bottom culture plate, place 150 .mu.l of GM in all
wells of column 1 (cell control). Place 100 .mu.l in all wells of
columns 2-11 (column 2 will be the virus control). Place an
additional 40 .mu.l in all wells of columns 3-12, row H (to receive
test samples). 2. Add 11 .mu.l of test sample to each well in
columns 3 & 4, row H. Add 11 .mu.l of a second test sample to
each well in columns 5 & 6, row H. Add 11 .mu.l of a third test
sample to each well in columns 7 & 8, row H. Add 11 .mu.l of a
fourth test sample to each well in columns 9 & 10, row H. Add
11 .mu.l of a fifth test sample to each well in columns 11 &
12, row H. Mix the samples in row H and transfer 50 .mu.l to row G.
Repeat the transfer and dilution of samples through row A (these
are serial 3-fold dilutions). After final transfer and mixing is
complete, discard 50 .mu.l from the wells in is columns 3-12, row A
into a waste container of disinfectant. 3. Thaw the required number
of vials of virus by placing in an ambient temperature water bath.
When completely thawed, dilute the virus in GM to achieve a
concentration of 4,000 TCID.sub.50/ml.
[0079] Cell-Free Stocks of Virus should be Prepared in Advance and
Cryopreserved in Working Aliquots of Approximately 1 ml.
4. Dispense 50 .mu.l of cell-free virus (200 TCID.sub.50) to all
wells in columns 2-12, rows A through H. Mix by pipet action after
each transfer. Rinse pipet tips in a reagent reservoir containing
40 ml sterile PBS between each transfer to avoid carry-over. 5.
Cover plates and incubate for 1 hour. 6. Prepare a suspension of
TZM-bl cells (trypsinize approximately 10-15 minutes prior to use)
at a density of 1.times.10.sup.5 cells/ml in GM containing DEAE
dextran (37.5 .mu.g/ml). Dispense 100 .mu.l of cell suspension
(10,000 cells per well) to each well in columns 1-12, rows A though
H. Rinse pipet tips in a reagent reservoir filled with sterile PBS
between each transfer to avoid carry-over. The final concentration
of DEAE dextran is 15 .mu.g/ml. 7. Cover plates and incubate for 48
hours. 8. Remove 150 .mu.l of culture medium from each well,
leaving approximately 100 .mu.l. Dispense 100 .mu.l of Bright
Glo.TM. Reagent to each well. Incubate at room temperature for 2
minutes to allow complete cell lysis. Mix by pipet action (at least
two strokes) and transfer 150 .mu.l to a corresponding 96-well
black plate. Read the plate immediately in a luminometer. 9.
Percent neutralization is determined by calculating the difference
in average RLU between test wells (cells+serum sample+virus) and
cell control wells (cells only, column 1), dividing this result by
the difference in average RLU between virus control (cell+virus,
column 2) and cell control wells (column 1), subtracting from 1 and
multiplying by 100. Neutralizing antibody titers are expressed as
the reciprocal of the serum dilution required to reduce RLU by
50%.
[0080] As shown in FIG. 5, animals receiving DOPE (hexagonal phase)
had a neutralization titer of 170.
Example 3
Immunogen Design
[0081] Peptide sequences that include the nominal epitopes of mAbs
2F5 and 4E10, respectively, linked to a hydrophobic linker (GTH1)
were synthesized and embedded into synthetic liposomes (FIG. 6).
The first generation of immunogens was designed with the 2F5 and
4E10 epitope sequences at the distal end of the lipid bilayer (FIG.
6A). These constructs provided unconstrained access of mAbs to
their respective epitopes. The second generation constructs have
been designed to mimic the native orientation of the MPER region
with the 2F5 and 4E10 mAb epitope sequences linked proximal to the
hydrophobic linker (FIGS. 6A, 6B).
[0082] The composition of the synthetic liposomes comprised the
following phospholipids, POPC
(1-Palmitoyl-2-Oleoyl-sn-Glycero-3-Phosphocholine), POPE
(1-Palmitoyl-2-Oleoyl-sn-Glycero-3-Phosphoethanolamine), DMPA
(1,2-Dimyristoyl-sn-Glycero-3-Phosphate), and Cholesterol dissolved
in chloroform (purchased from Avanti Polar Lipids (Alabaster,
Ala.).).
[0083] Synthetic liposomes were prepared by dispensing appropriate
molar amounts of phospholipids (POPC:POPE:DMPA:Ch=45:25:20:10) in
chloroform resistant tubes. The phospholipids were mixed by
vortexing and the mixture was dried in the fume hood under a gentle
stream of nitrogen. Any residual chloroform was removed by storing
the lipids under a high vacuum (15 h). Aqueous suspensions of
phospholipids were prepared by adding PBS or TBS buffer, pH 7.4,
and incubating at 37.degree. C. for 10-30 minutes, with
intermittent, vigorous vortexing to resuspend the phospholipids.
The milky, uniform suspension of phospholipids was then sonicated
in a bath sonicator (Misonix Sonicator 3000, Misonix Inc.,
Farmingdale, N.Y.). The sonicator was programmed to run 3
consecutive cycles of 45 seconds of total sonication per cycle.
Each cycle included 5 seconds of sonication pulse (70 watts power
output) followed by a pulse off period of 12 seconds. At the end of
sonication, the suspension of lamellar liposomes was stored at
4.degree. C.
[0084] HIV-1 MPER peptides GTH1-2F5 and GTH1-4E10 (FIG. 6) were
dissolved in 70% chloroform, 30% methanol. Chloroform solutions of
lipids were added to the peptide solution, in the molar ratios of
45:25:20:10 (POPC:POPE:DMPA:Cholesterol). Each peptide was added to
a ratio of peptide:total phospholipids of 1:420. The mixture was
vortexed, then dried and resuspended as described above.
[0085] Binding assays to test specificity of mAb binding to each
peptide-lipid conjugate were performed following capture of the
liposomes on a BAcore L1 sensor chip, which allows immobilization
of lipid bilayer via a hydrophobic linker. 2F5, 4E10 and control
mAbs (A32 or 17b) were injected over each of the sensor surfaces
with either synthetic liposomes, or peptide-lipid conjugates and
the binding monitored on a BIAcore 3000 instrument (FIGS.
8-11).
Immunization Strategy
[0086] The immunization strategy incorporated a regimen that allows
temporary breaks in tolerance. The protocol involves the use of
oCpGs, the TLR9 ligand that has been used to break tolerance for
the production of anti-dsDNA antibodies in mice (Tran et al, Clin.
Immunol. 109(3):278-287 (2003)). The peptide-liposome conjugates
were mixed (1:1) with the adjuvant, Emulsigen plus oCpG. The
Emulsigen mixed adjuvant (2.times.) was prepared by mixing 375
.mu.L of Emulsigen, 250 .mu.L of oCpG and 625 .mu.L of saline. Each
guinea pig was immunized on a 21-day interval with 250 .mu.g of
either peptide alone or peptide-liposome conjugates with equivalent
amount of peptide. Serum samples were harvested as pre-bleed prior
to first immunization and at each subsequent immunizations. Serum
samples were analyzed by ELISA assay (FIG. 12) for binding to
peptide epitopes and for viral neutralization assay (Table 2). Data
in FIG. 12, show strong reactivity to 4E10 peptide of sera from two
guinea pigs immunized with GTH1-4E10 liposomes, while only low
level of reactivity was observed in a serum from 4E10 peptide
immunized animal. Both the positive sera also neutralized HIV-1 MN
strain (Table 2).
TABLE-US-00002 TABLE 2 Induction of neutralizing antibodies in
guinea pigs immunized with 4E10 peptide-liposomes HIV-1
Strain/antibody titer Animal No. MN SS1196 1102 Bleed 4 209 32 1103
Bleed 4 60 <20
Application of Peptide-Liposome Conjugates in the Detection of
Antigen Specific B Cell Responses.
[0087] The above peptide-liposome conjugates have been utilized as
a reagent for the detection of MPER specific B cell responses. The
peptide-liposome constructs (2F5 and 4E10) were conjugated with
fluorescein by incorporating fluorescein-POPE in the lipid
composition. The flourescein-POPE was mixed with unonjugated POPE
at a ratio of 45:55 and then mixed with the rest of the lipids in
the molar ratio as described above. In BIAcore binding assays, both
fluorescein conjugated 2F5 and 4E10-peptide-liposomes retained
their specificity in binding to their respective mAbs (FIG.
11).
Example 4
[0088] Generation of Peptide-Lipid Conjugates.
[0089] Phospholipids POPC
(1-Palmitoyl-2-Oleoyl-sn-Glycero-3-Phosphatidylcholine), POPE
(1-Palmitoyl-2-Oleoyl-sn-Glycero-3-Phosphatidylethanolamine), DOPE
(1,2-Dioleoyl-sn-Glycero-3-Phosphatidylethanolamine); DMPA
(1,2-Dimyristoyl-sn-Glycero-3-Phosphate) and cholesterol dissolved
in chloroform were purchased from Avanti Polar Lipids (Alabaster,
Ala.). Phospholipid liposomes were prepared by dispensing
appropriate molar amounts of phospholipids in chloroform resistant
tubes. Chloroform solutions of lipids were added to the peptide
solution, in molar ratios of 45:25:20:10
(POPC:POPE:DMPA:Cholesterol). HIV-1 membrane proximal peptides were
dissolved in 70% chloroform, 30% methanol. Each peptide was added
to a molar ratio of peptide:total phospholipids of 1:420. The
phospholipids were mixed by gentle vortexing and the mixture was
dried in the fume hood under a gentle stream of nitrogen. Any
residual chloroform was removed by storing the lipids under a high
vacuum (15 h). Aqueous suspensions of phospholipids were prepared
by adding PBS or TBS buffer, pH 7.4 and kept at a temperature above
the Tm for 10-30 minutes, with intermittent, vigorous vortexing to
resuspend the phospholipids followed by Sonication in a bath
sonicator (Misonix Sonicator 3000, Misonix Inc., Farmingdale,
N.Y.). The sonicator was programmed to run 3 consecutive cycles of
45 seconds of total sonication per cycle. Each cycle included 5
seconds of sonication pulse (70 watts power output) followed by a
pulse off period of 12 seconds. At the end of sonication, the
suspension of lamellar liposomes was stored at 4.degree. C. and was
thawed and sonicated again as described above prior to capture on
BIAcore sensor chip.
[0090] Design of Peptide-Lipid Conjugates.
[0091] Peptides were synthesized and purified by reverse-phase HPLC
and purity was confirmed by mass spectrometric analysis. Peptides
used in this study include the following--HIV-1 gp41 2F5 epitope
peptides-2F5-GTH1 (QQEKNEQELLELDKWASLWN-YKRWIILGLNKIVRMYS) (SEQ ID
NO:13); and HIV-1 gp41 4E10 epitope peptides-4E10-GTH1
(SLWNWFNITNWLWYIK-YKRWIILGLNKIVRMYS) (SEQ ID NO:10). Additional
peptides to be incorporated into liposomes include--SP8926-GTH1
(EQELLELDKWASLWN-YKRWIILGLNKIVRMYS) (residues 6-37 of SEQ ID
NO:13); and Sp8928-GTH1 (KWASLWNWFDITNWL-YKRWIILGLNKIVRMYS) (SEQ ID
NO:31).
[0092] Peptide-Lipid Conjugates.
[0093] Each of these peptides will be incorporated into synthetic
liposomes of varying composition which include:
[0094] i) POPC:POPE:DMPA:Cholesterol
[0095] ii) POPC:POPS
[0096] iii) POPC:POPS:lysoPC
[0097] iv) POPC:POPE:Sphingomyelin:Cholesterol
The liposomes will be complexed with and without monophosphoryl
Lipid A (Avanti Polar Lipids).
Example 5
[0098] Biotinylated 2F5 nominal epitope peptide (SP62) was anchored
on streptavidin coated BIAcore sensor chip (SA) and either 2F5 mab
or 2F5 Fab was injected over the peptide surfaces. Specific binding
of 2F5 mAb (46.6-1800 nM) or 2F5 Fab (120-2000 nM) was derived
following subtraction of non-specific signal on a HR-1 peptide
control surface. Kd was calculated following global curve fitting
to a simple Langmuir equation using the BIAevaluation software. The
data presented in. FIG. 13 show that MPER mAb binding to peptide
epitope follows a simple model (Langmuir equation).
[0099] About 600 RU of either 2F5 peptide-lipid (FIG. 14, left
panel) or 4E10 peptide-lipid conjugates were anchored to a BIAcore
L1 sensor chip and then 2F5 mAb or 4E10 mAb was injected at
100:g/mL. Curve fitting analysis show that binding of both Mab
bound to peptide-lipid conjugates follow a 2-step conformational
change mode (FIG. 14). In each of the overlay, the binding data is
shown in black and represents the observed total binding response.
The component curves for the encounter complex (red) and the docked
complex (blue) were simulated from the experimentally determined
rate constants.
[0100] Envelope gp140 oligomers were anchored on a BIAcore CM5 chip
and each of the mAbs indicated in FIG. 15 were injected over each
of the Env surfaces. Human cluster II mAbs, 98-6, 126-6, and 167-D
bound strongly to Env gp140, while no binding was detected with the
non-neutralizing murine MPER mAbs, 2F5, and 4E10.
[0101] Synthetic liposomes (PC:PE; green), or cardiolipin (red) was
anchored on a BIAcore L1 sensor chip through hydrophobic
interactions with the lipid linker (FIG. 16). Each of the indicated
mAbs (500 nM) was injected over each of the lipid surface and a
blank control surface. Strong binding of Cluster II mAb 98-6 and
167-D and moderate binding of mAb 126-6 is shown (FIGS. 16A-C). No
binding of the anti-MPER mAb 13H11 to either lipid was
observed.
[0102] 2F5-peptide (SP62) lipid conjugates were anchored to a
BIAcore L1 surface and binding to mAb 98-6, 167-D or 126-6 was
monitored (FIG. 17A). Mab 98-6 bound strongly to the peptide-lipid
conjugates, while relatively lower avidity binding was detected
with mAb 167-D and 126-6. Curve fitting analysis show a 2-step
conformational change associated binding of 2F5 (FIG. 17B) and 98-6
(FIG. 17C); while the binding of mAbs 167-D (FIG. 17D) and 126-6
(FIG. 17E) followed a simple model (Langmuir equation).
[0103] The data presented in Table 3 show binding and
neutralization characteristics of 25F and other prototype anti-MPER
cluster II mAbs. Only mAb 2F5 and 98-6, which bound strongly to
linear epitope peptide and followed a 2-step conformational change
model, neutralized HIV-1 in a PBMC assay.
TABLE-US-00003 TABLE 3 Nominal HIV Epitope Env gp140 Phospholipid
Peptide-Lipid Neutralization MAb (HR-2 peptide) JRFL Cardiolipin
Conjugates ID.sub.50 In PBMC assay 2F5 ++ ++ + 2-step 1 .mu.g/mL
conformational 98-6 ++ ++ +++ 2-step 3.5 .mu.g/mL conformational
126-6 + ++ +++ Simple model Non-Neut* 167-D + ++ ++ Simple model
Non-Neut* 13H11 + + -ve +/- >50 .mu.g/mL 5A9 + + -ve +/- >50
.mu.g/mL *Gorny et al, J. Virol. 74: 6168 (2000); Nyambi et al, J.
Virol. 74: 7096 (2000)
Example 6
[0104] Human monoclonal antibodies (termed CL1, IS4 and IS6)
derived from patients with anti-phospholipid syndrome have been
studied. (See Table 4.) (Giles et al, J. Immunol. 177: 1729-1736
(2006), Zhu et al, Brit. Jour. Haematol. 105:102-109 (1999),
Chukwuocha et al, Mol. Immunol. 39:299-311 (2002), Zhu et al, Brit.
Jour. Haematol. 135:214-219 (2006), Pierangeli et al, Thromb.
Haemost. 84:388-395 (2000), Lin et al, Arth Rheum 56:1638 (2007),
Alam et al, J. Immunol. 178:4424-4435 (2007), Zhao et al, Arth.
Rheum. 42:2132-2138 (1999), Lu et al, Arth. Rheum. 52:4018-4027
(2005)). IS4 and IS6 are pathogenic anti-lipid antibodies whereas
CL1 is a non-pathogenic anti-lipid autoantibody (Table 4). Whereas
none of these antibodies neutralized HIV pseudoviruses in the
pseudovirus inhibition assay that reflects primarily infection by
virion-cell fusion (Li et al, J. Virol. 79:10108-25 (2005) (Table
5), all three of these antibodies neutralized HIV-1 in the PBMC HIV
neutralization assay that depends on endocytosis of HIV and is a
mirror of HIV infectivity of CD4 cells in vivo (Table 6). That CL1
neutralized HIV evidences the facts that: a) humans can make
non-pathogenic anti-lipid antibodies that neutralize HIV, and b)
CL1 is an antibody that can be safely used as a therapeutic Mab for
treatment of HIV infected subjects or in the setting of
post-exposure prophylaxis of subjects following needle, sexual or
other exposure to HIV or HIV infected materials.
TABLE-US-00004 TABLE 4 MAbs Derived From an Anti-Phospholipid
Syndrome Patient Antibody Name Antibody Reactivity IS1 IS4 IS6
cardiolipin/PS ++ ++ +/- .beta.-2-glycoprotein-1 domain 5 1 -
prothrombin - - +++ thrombosis in vivo in a mouse model - +++ ++
pathogenic MAb No Yes Yes
TABLE-US-00005 TABLE 5 Neutralization of HIV-1 in Pseudovirus Assay
by Anti-Membrane MAbs ID50 in Pseudovirus Assay (.mu.g/mL) MAb
B.6535 Humanized Anti-PS >50 (Bavituximab) Control (Erbitux)
>50 Anti-CL (IS4) >50 Anti-CL/PS (CL1) >50
Anti-CL/prothrombin (IS6) >50
TABLE-US-00006 TABLE 6 Neutralization of HIV-1 Primary Isolates by
Anti-Membrane Antibodies IC 80 Neutralization Levels, ug/ml HIV-1
Isolates CL1 IS4 IS6 Anti-RSV Tri-Mab* B.Torno 0.6 0.6 5 >50
0.03 B.PAVO 0.3 0.3 1.6 >50 0.01 B.6535 0.06 0.06 0.62 ND ND
C.DU123 0.4 0.6 4.6 >50 >50 C.DU156 2.6 2.6 11.6 >50
>50 C.DU151 4.1 5.2 >50 >50 >50 C.DU172 0.6 0.9 4.1
>50 >50 SHIV SP162P3 0.06 0.2 0.46 >50 0.9 SHIV 89.6P
>50 50 >50 >50 1.8 SIV MAC239 >50 >50 >50 ND ND
*TRI-Mab = 2F5, 2G12, 1b12 Mabs
[0105] Alving and colleagues have made a mouse mab against
phosphatidyl inositol phosphate and have shown that it neutralizes
HIV in a PBMC assay (Wassef et al, Mol. Immunol. 21: 863-868
(1984), Brown et al, Virol. 81: 2087-2091 (2007), Beck et al,
Biochem. Biophys Res. Comm. 354: 747-751 (2007)). What the present
studies show is that humans can spontaneously make anti-lipid
antibodies and that these antibodies can broadly neutralize HIV in
an unprecendented manner.
[0106] Summarizing, autoimmune disease patients can make antibodies
that bind to virus-infected cells and, presumably, to budding HIV
virions by virtue of their reactivity to HIV membranes and host
membranes. Certain anti-lipid antibodies from autoimmune disease
patients can also react with the Envelope trimer (such as IS6) but
not all of the antibodies react also with the trimer (i.e., CL1 and
IS4 do not react). Therefore, reactivity with the HIV envelope is
not a prerequisite for neutralization in these antibodies.
[0107] These studies also demonstrate that it may be possible to
safely stimulate the production of CL1 like antibodies in humans
using gp41 lipid complexes (Alam et al, J. Immunol. 178:4424-4435
(2007), Schuster et al, J. Immunol. 122:900-905 (1984)).
Example 7
[0108] Toll like receptor ligands, shown in FIG. 18, were
formulated into liposomal forms with gp41 MPER peptide
immunogens.
[0109] The construction of Lipid A and R-848 containing MPER
peptide liposomes utilized the method of co-solubilization of MPER
peptide having a membrane anchoring amino acid sequence and
synthetic lipids 1-Palmitoyl-2-Oleoyl-sn-Glycero-3-Phosphocholine
(POPC), 1-Palmitoyl-2-Oleoyl-sn-Glycero-3-Phosphoethanolamine
(POPE), 1,2-Dimyristoyl-sn-Glycero-3-Phosphate (DMPA) and
cholesterol at mole fractions 0.216, 45.00, 25.00, 20.00 and 1.33,
respectively. Appropriate amount of MPER peptide dissolved in
chloroform-methanol mixture (7:3 v/v), Lipid A dissolved in
chloroform or R-848 dissolved in methanol, appropriate amounts of
chloroform stocks of phospholipids were dried in a stream of
nitrogen followed by over night vacuum drying. Liposomes were made
from the dried peptide-lipid film in phosphate buffered saline (pH
7.4) using extrusion technology. Construction of oligo-CpG
complexed MPER peptide liposomes used the cationic lipid
1-Palmitoyl-2-Oleoyl-sn-Glycero-3-ethylphospho choline (POEPC)
instead of POPC. Conjugation of oCpG was done by mixing of cationic
liposomes containing the peptide immunogen with appropriate amounts
of oCpG stock solution (1 mg/ml) for the desired dose.
[0110] A schematic of the designs displayed in FIG. 19 shows the
peptide-liposomes containing different TLR adjuvants; TLR4 (Lipid
A); TLR9 (oCpG) and TLR7 (R848).
[0111] Biacore assay for the binding of 2F5 mAb to its epitope in
the peptide-liposome constructs revealed that incorporation or
conjugation of TLR adjuvants does not affect binding of HIV
neutralizing antibody 2F5. Strong binding of both mAbs 2F5 and 4E10
was observed. (See FIG. 20.)
Example 8
[0112] The HIV-1 gp41 membrane proximal external region that
precedes the transmembrane domain is the target for the broadly
neutralizing antibodies 2F5 and 4E10. The fact that the MPER
peptide partitions into membrane interfaces and the lipid
reactivity of the antibodies 2F5 and 4E10 led to the design of MPER
peptide-liposome conjugates as candidate immunogens for the
induction of broadly neutralizing gp41 MPER antibodies. The
peptide-liposome conjugation strategy used here involved the design
of a synthetic peptide, MPER656-TMD (FIG. 21), corresponding to the
MPER that contains the epitopes for both 2F5 and 4E10 mAbs and the
incorporation of the transmembrane domain of HIV-1 gp41 (residues
656 to 707 of the gp160).
[0113] The MPER656-TMD peptide-liposome conjugate construction
involved co-solubilization of MPER656-TMD peptide and synthetic
lipids 1-Palmitoyl-2-Oleoyl-sn-Glycero-3-Phosphocholine (POPC),
1-Palmitoyl-2-Oleoyl-sn-Glycero-3-Phosphoethanolamine (POPE),
1,2-Dimyristoyl-sn-Glycero-3-Phosphate (DMPA) and cholesterol at
mole fractions 0.43, 45.00, 25.00, 20.00 and 1.33, respectively. An
appropriate amount of MPER656-TMD peptide dissolved in
chloroform-methanol mixture (8:2 v/v), mixed with appropriate
amounts of chloroform stocks of phospholipids was dried in a stream
of nitrogen followed by over night vacuum drying. Liposomes were
made from the dried peptide-lipid film in phosphate buffered saline
(pH 7.4) using extrusion technology.
[0114] To assess the presentation of MPER epitopes on the TMD
liposome constructs, MPER656-GTH1 and peptide free synthetic
liposomes were captured on the Biacore L-1 chip that had
.about.3000 RU BSA immobilized on each flow cell (FIG. 22).
[0115] Testing of functional presentation of MPER region in the
MPER656-TMD-liposome construct involved examining the interaction
of 2F5 and 4E10 mAbs with the liposomes immobilized on the Biacore
L-1 chip shown in FIG. 23. Peptide specific binding of 2F5 mAb
followed by that of 4E10 mAb or vice versa (FIG. 23) confirmed the
functional presentation of their respective epitopes contained in
the MPER656-TMD peptide.
[0116] Thus, 2F5 and 4E10 bound strongly to the gp41 MPER-TMD
construct. Therefore, this strategy provides a novel means to
present gp41 MPER anchored via the native TMD. The MPER656-TMD
peptide that contains the amino acid sequence of the HIV-1 gp41
MPER and transmembrane domain (residues 656 thru 707 of gp160) was
used to conjugate the MPER peptide to synthetic liposomes
successfully. The functional display of epitopes of both 2F5 and
4E10 mAbs in MPER656-TMD-liposome conjugate makes this construct a
very promising immunogen to test for the induction of 2F5 and 4E10
like antibodies.
[0117] All documents and other information sources cited above are
hereby incorporated in their entirety by reference.
Sequence CWU 1
1
31132PRTArtificial SequenceDescription of Artificial SequenceHIV
1Gln Gln Glu Lys Asn Glu Gln Glu Leu Leu Glu Leu Asp Lys Trp Ala 1
5 10 15 Ser Leu Trp Asn Trp Phe Asp Ile Thr Asn Trp Leu Trp Tyr Ile
Lys 20 25 30 257PRTArtificial SequenceDescription of Artificial
SequenceHIV 2Tyr Lys Arg Trp Ile Ile Leu Gly Leu Asn Lys Ile Val
Arg Met Tyr 1 5 10 15 Ser Lys Gln Ile Ile Asn Met Trp Gln Glu Val
Gly Lys Ala Met Tyr 20 25 30 Ala Cys Thr Arg Pro Asn Tyr Asn Lys
Arg Lys Arg Ile His Ile Gly 35 40 45 Pro Gly Arg Ala Phe Tyr Thr
Thr Lys 50 55 349PRTArtificial SequenceDescription of Artificial
SequenceHIV 3Gln Gln Glu Lys Asn Glu Gln Glu Leu Leu Glu Leu Asp
Lys Trp Ala 1 5 10 15 Ser Leu Trp Asn Trp Phe Asn Ile Thr Asn Trp
Leu Trp Tyr Ile Lys 20 25 30 Tyr Lys Arg Trp Ile Ile Leu Gly Leu
Asn Lys Ile Val Arg Met Tyr 35 40 45 Ser 445PRTArtificial
SequenceDescription of Artificial SequenceHIV 4Asn Glu Gln Glu Leu
Leu Glu Leu Asp Lys Trp Ala Ser Leu Trp Asn 1 5 10 15 Trp Phe Asn
Ile Thr Asn Trp Leu Trp Tyr Ile Lys Tyr Lys Arg Trp 20 25 30 Ile
Ile Leu Gly Leu Asn Lys Ile Val Arg Met Tyr Ser 35 40
45549PRTArtificial SequenceDescription of Artificial SequenceHIV
5Glu Ala Trp Leu Trp Asp Leu Leu Ile Trp Asn Leu Gln Phe Glu Trp 1
5 10 15 Lys Asn Asn Trp Thr Glu Gln Asn Gln Leu Glu Lys Ser Tyr Ile
Lys 20 25 30 Tyr Lys Arg Trp Ile Ile Leu Gly Leu Asn Lys Ile Val
Arg Met Tyr 35 40 45 Ser 636PRTArtificial SequenceDescription of
Artificial SequenceHIV 6Ser Leu Trp Asn Trp Phe Asn Ile Thr Asn Trp
Leu Trp Tyr Ile Lys 1 5 10 15 Gly Gly Gly Tyr Lys Arg Trp Ile Ile
Leu Gly Leu Asn Lys Ile Val 20 25 30 Arg Met Tyr Ser 35
736PRTArtificial SequenceDescription of Artificial SequenceHIV 7Lys
Asn Ile Trp Leu Ser Asn Tyr Phe Trp Leu Ile Asn Trp Trp Thr 1 5 10
15 Gly Gly Gly Tyr Lys Arg Trp Ile Ile Leu Gly Leu Asn Lys Ile Val
20 25 30 Arg Met Tyr Ser 35 840PRTArtificial SequenceDescription of
Artificial SequenceHIV 8Gln Gln Glu Lys Asn Glu Gln Glu Leu Leu Glu
Leu Asp Lys Trp Ala 1 5 10 15 Ser Leu Trp Asn Gly Gly Gly Tyr Lys
Arg Trp Ile Ile Leu Gly Leu 20 25 30 Asn Lys Ile Val Arg Met Tyr
Ser 35 40940PRTArtificial SequenceDescription of Artificial
SequenceHIV 9Asn Lys Glu Gln Asp Gln Ala Glu Glu Ser Leu Gln Leu
Trp Glu Lys 1 5 10 15 Leu Asn Trp Leu Gly Gly Gly Tyr Lys Arg Trp
Ile Ile Leu Gly Leu 20 25 30 Asn Lys Ile Val Arg Met Tyr Ser 35
401033PRTArtificial SequenceDescription of Artificial SequenceHIV
10Ser Leu Trp Asn Trp Phe Asn Ile Thr Asn Trp Leu Trp Tyr Ile Lys 1
5 10 15 Tyr Lys Arg Trp Ile Ile Leu Gly Leu Asn Lys Ile Val Arg Met
Tyr 20 25 30 Ser 1133PRTArtificial SequenceDescription of
Artificial SequenceHIV 11Lys Asn Ile Trp Leu Ser Asn Tyr Phe Trp
Leu Ile Asn Trp Trp Thr 1 5 10 15 Tyr Lys Arg Trp Ile Ile Leu Gly
Leu Asn Lys Ile Val Arg Met Tyr 20 25 30 Ser 127PRTArtificial
SequenceDescription of Artificial SequenceHIV 12Glu Leu Asp Lys Trp
Ala Ser 1 5 1337PRTArtificial SequenceDescription of Artificial
SequenceHIV 13Gln Gln Glu Lys Asn Glu Gln Glu Leu Leu Glu Leu Asp
Lys Trp Ala 1 5 10 15 Ser Leu Trp Asn Tyr Lys Arg Trp Ile Ile Leu
Gly Leu Asn Lys Ile 20 25 30 Val Arg Met Tyr Ser 35
1437PRTArtificial SequenceDescription of Artificial SequenceHIV
14Asn Lys Glu Gln Asp Gln Ala Glu Glu Ser Leu Gln Leu Trp Glu Lys 1
5 10 15 Leu Asn Trp Leu Tyr Lys Arg Trp Ile Ile Leu Gly Leu Asn Lys
Ile 20 25 30 Val Arg Met Tyr Ser 35 15117PRTArtificial
SequenceDescription of Artificial SequenceHIV 15Met Arg Val Arg Gly
Ile Gln Arg Asn Cys Gln His Leu Trp Arg Trp 1 5 10 15 Gly Thr Leu
Ile Leu Gly Met Leu Met Ile Cys Ser Ala Ala Leu Gly 20 25 30 Ile
Trp Gly Cys Ser Gly Lys Leu Ile Cys Thr Thr Ala Val Pro Trp 35 40
45 Asn Ala Ser Trp Ser Asn Lys Ser Leu Glu Tyr Thr Ser Leu Ile His
50 55 60 Ser Leu Ile Glu Glu Ser Gln Asn Gln Gln Glu Lys Asn Glu
Gln Glu 65 70 75 80Leu Leu Glu Leu Asp Lys Trp Ala Ser Leu Trp Asn
Trp Phe Tyr Lys 85 90 95 Arg Trp Ile Ile Leu Gly Leu Asn Lys Ile
Val Arg Met Tyr Ser His 100 105 110 His His His His His 115
1689PRTArtificial SequenceDescription of Artificial SequenceHIV
16Met Arg Val Arg Gly Ile Gln Arg Asn Cys Gln His Leu Trp Arg Trp 1
5 10 15 Gly Thr Leu Ile Leu Gly Met Leu Met Ile Cys Ser Ala Ala Tyr
Thr 20 25 30 Ser Leu Ile His Ser Leu Ile Glu Glu Ser Gln Asn Gln
Gln Glu Lys 35 40 45 Asn Glu Gln Glu Leu Leu Glu Leu Asp Lys Trp
Ala Ser Leu Trp Asn 50 55 60 Trp Phe Tyr Lys Arg Trp Ile Ile Leu
Gly Leu Asn Lys Ile Val Arg 65 70 75 80Met Tyr Ser His His His His
His His 85 17117PRTArtificial SequenceDescription of Artificial
SequenceHIV 17Met Arg Val Arg Gly Ile Gln Arg Asn Cys Gln His Leu
Trp Arg Trp 1 5 10 15 Gly Thr Leu Ile Leu Gly Met Leu Met Ile Cys
Ser Ala Ala Tyr Lys 20 25 30 Arg Trp Ile Ile Leu Gly Leu Asn Lys
Ile Val Arg Met Tyr Ser Leu 35 40 45 Gly Ile Trp Gly Cys Ser Gly
Lys Leu Ile Cys Thr Thr Ala Val Pro 50 55 60 Trp Asn Ala Ser Trp
Ser Asn Lys Ser Leu Glu Tyr Thr Ser Leu Ile 65 70 75 80His Ser Leu
Ile Glu Glu Ser Gln Asn Gln Gln Glu Lys Asn Glu Gln 85 90 95 Glu
Leu Leu Glu Leu Asp Lys Trp Ala Ser Leu Trp Asn Trp Phe His 100 105
110 His His His His His 115 1889PRTArtificial SequenceDescription
of Artificial SequenceHIV 18Met Arg Val Arg Gly Ile Gln Arg Asn Cys
Gln His Leu Trp Arg Trp 1 5 10 15 Gly Thr Leu Ile Leu Gly Met Leu
Met Ile Cys Ser Ala Ala Tyr Lys 20 25 30 Arg Trp Ile Ile Leu Gly
Leu Asn Lys Ile Val Arg Met Tyr Ser Tyr 35 40 45 Thr Ser Leu Ile
His Ser Leu Ile Glu Glu Ser Gln Asn Gln Gln Glu 50 55 60 Lys Asn
Glu Gln Glu Leu Leu Glu Leu Asp Lys Trp Ala Ser Leu Trp 65 70 75
80Asn Trp Phe His His His His His His 85 19132PRTArtificial
SequenceDescription of Artificial SequenceHIV 19Met Arg Val Arg Gly
Ile Gln Arg Asn Cys Gln His Leu Trp Arg Trp 1 5 10 15 Gly Thr Leu
Ile Leu Gly Met Leu Met Ile Cys Ser Ala Ala Leu Gly 20 25 30 Ile
Trp Gly Cys Ser Gly Lys Leu Ile Cys Thr Thr Ala Val Pro Trp 35 40
45 Asn Ala Ser Trp Ser Asn Lys Ser Leu Glu Tyr Thr Ser Leu Ile His
50 55 60 Ser Leu Ile Glu Glu Ser Gln Asn Gln Gln Glu Lys Asn Glu
Gln Glu 65 70 75 80Leu Leu Glu Leu Asp Lys Trp Ala Ser Leu Trp Asn
Trp Phe Asn Ile 85 90 95 Thr Asn Trp Leu Trp Tyr Ile Lys Leu Phe
Ile Met Ile Val Gly Gly 100 105 110 Leu Val Gly Leu Arg Ile Val Phe
Ala Val Leu Ser Val Val His His 115 120 125 His His His His 130
20104PRTArtificial SequenceDescription of Artificial SequenceHIV
20Met Arg Val Arg Gly Ile Gln Arg Asn Cys Gln His Leu Trp Arg Trp 1
5 10 15 Gly Thr Leu Ile Leu Gly Met Leu Met Ile Cys Ser Ala Ala Tyr
Thr 20 25 30 Ser Leu Ile His Ser Leu Ile Glu Glu Ser Gln Asn Gln
Gln Glu Lys 35 40 45 Asn Glu Gln Glu Leu Leu Glu Leu Asp Lys Trp
Ala Ser Leu Trp Asn 50 55 60 Trp Phe Asn Ile Thr Asn Trp Leu Trp
Tyr Ile Lys Leu Phe Ile Met 65 70 75 80Ile Val Gly Gly Leu Val Gly
Leu Arg Ile Val Phe Ala Val Leu Ser 85 90 95 Val Val His His His
His His His 100 217PRTArtificial SequenceDescription of Artificial
SequenceHIV 21Trp Phe Asn Ile Thr Asn Trp 1 5 226PRTArtificial
SequenceDescription of Artificial SequenceHIV 22Asn Trp Phe Asp Ile
Thr 1 5 236PRTArtificial SequenceDescription of Artificial
SequenceHIV 23Glu Leu Asp Lys Trp Ala 1 5 24852PRTArtificial
SequenceDescription of Artificial SequenceHIV consensus sequence
24Met Arg Val Arg Gly Ile Gln Arg Asn Cys Gln His Leu Trp Arg Trp 1
5 10 15 Gly Thr Leu Ile Leu Gly Met Leu Met Ile Cys Ser Ala Ala Glu
Asn 20 25 30 Leu Trp Val Thr Val Tyr Tyr Gly Val Pro Val Trp Lys
Glu Ala Asn 35 40 45 Thr Thr Leu Phe Cys Ala Ser Asp Ala Lys Ala
Tyr Asp Thr Glu Val 50 55 60 His Asn Val Trp Ala Thr His Ala Cys
Val Pro Thr Asp Pro Asn Pro 65 70 75 80Gln Glu Ile Val Leu Glu Asn
Val Thr Glu Asn Phe Asn Met Trp Lys 85 90 95 Asn Asn Met Val Glu
Gln Met His Glu Asp Ile Ile Ser Leu Trp Asp 100 105 110 Gln Ser Leu
Lys Pro Cys Val Lys Leu Thr Pro Leu Cys Val Thr Leu 115 120 125 Asn
Cys Thr Asn Val Asn Val Thr Asn Thr Thr Asn Asn Thr Glu Glu 130 135
140 Lys Gly Glu Ile Lys Asn Cys Ser Phe Asn Ile Thr Thr Glu Ile Arg
145 150 155 160Asp Lys Lys Gln Lys Val Tyr Ala Leu Phe Tyr Arg Leu
Asp Val Val 165 170 175 Pro Ile Asp Asp Asn Asn Asn Asn Ser Ser Asn
Tyr Arg Leu Ile Asn 180 185 190 Cys Asn Thr Ser Ala Ile Thr Gln Ala
Cys Pro Lys Val Ser Phe Glu 195 200 205 Pro Ile Pro Ile His Tyr Cys
Ala Pro Ala Gly Phe Ala Ile Leu Lys 210 215 220 Cys Asn Asp Lys Lys
Phe Asn Gly Thr Gly Pro Cys Lys Asn Val Ser 225 230 235 240Thr Val
Gln Cys Thr His Gly Ile Lys Pro Val Val Ser Thr Gln Leu 245 250 255
Leu Leu Asn Gly Ser Leu Ala Glu Glu Glu Ile Ile Ile Arg Ser Glu 260
265 270 Asn Ile Thr Asn Asn Ala Lys Thr Ile Ile Val Gln Leu Asn Glu
Ser 275 280 285 Val Glu Ile Asn Cys Thr Arg Pro Asn Asn Asn Thr Arg
Lys Ser Ile 290 295 300 Arg Ile Gly Pro Gly Gln Ala Phe Tyr Ala Thr
Gly Asp Ile Ile Gly 305 310 315 320Asp Ile Arg Gln Ala His Cys Asn
Ile Ser Gly Thr Lys Trp Asn Lys 325 330 335 Thr Leu Gln Gln Val Ala
Lys Lys Leu Arg Glu His Phe Asn Asn Lys 340 345 350 Thr Ile Ile Phe
Lys Pro Ser Ser Gly Gly Asp Leu Glu Ile Thr Thr 355 360 365 His Ser
Phe Asn Cys Arg Gly Glu Phe Phe Tyr Cys Asn Thr Ser Gly 370 375 380
Leu Phe Asn Ser Thr Trp Ile Gly Asn Gly Thr Lys Asn Asn Asn Asn 385
390 395 400Thr Asn Asp Thr Ile Thr Leu Pro Cys Arg Ile Lys Gln Ile
Ile Asn 405 410 415 Met Trp Gln Gly Val Gly Gln Ala Met Tyr Ala Pro
Pro Ile Glu Gly 420 425 430 Lys Ile Thr Cys Lys Ser Asn Ile Thr Gly
Leu Leu Leu Thr Arg Asp 435 440 445 Gly Gly Asn Asn Asn Thr Asn Glu
Thr Glu Ile Phe Arg Pro Gly Gly 450 455 460 Gly Asp Met Arg Asp Asn
Trp Arg Ser Glu Leu Tyr Lys Tyr Lys Val 465 470 475 480Val Lys Ile
Glu Pro Leu Gly Val Ala Pro Thr Lys Ala Lys Arg Arg 485 490 495 Val
Val Glu Arg Glu Lys Arg Ala Val Gly Ile Gly Ala Val Phe Leu 500 505
510 Gly Phe Leu Gly Ala Ala Gly Ser Thr Met Gly Ala Ala Ser Ile Thr
515 520 525 Leu Thr Val Gln Ala Arg Gln Leu Leu Ser Gly Ile Val Gln
Gln Gln 530 535 540 Ser Asn Leu Leu Arg Ala Ile Glu Ala Gln Gln His
Leu Leu Gln Leu 545 550 555 560Thr Val Trp Gly Ile Lys Gln Leu Gln
Ala Arg Val Leu Ala Val Glu 565 570 575 Arg Tyr Leu Lys Asp Gln Gln
Leu Leu Gly Ile Trp Gly Cys Ser Gly 580 585 590 Lys Leu Ile Cys Thr
Thr Thr Val Pro Trp Asn Ser Ser Trp Ser Asn 595 600 605 Lys Ser Gln
Asp Glu Ile Trp Asp Asn Met Thr Trp Met Glu Trp Glu 610 615 620 Arg
Glu Ile Asn Asn Tyr Thr Asp Ile Ile Tyr Ser Leu Ile Glu Glu 625 630
635 640Ser Gln Asn Gln Gln Glu Lys Asn Glu Gln Glu Leu Leu Ala Leu
Asp 645 650 655 Lys Trp Ala Ser Leu Trp Asn Trp Phe Asp Ile Thr Asn
Trp Leu Trp 660 665 670 Tyr Ile Lys Ile Phe Ile Met Ile Val Gly Gly
Leu Ile Gly Leu Arg 675 680 685 Ile Val Phe Ala Val Leu Ser Ile Val
Asn Arg Val Arg Gln Gly Tyr 690 695 700 Ser Pro Leu Ser Phe Gln Thr
Leu Ile Pro Asn Pro Arg Gly Pro Asp 705 710 715 720Arg Pro Glu Gly
Ile Glu Glu Glu Gly Gly Glu Gln Asp Arg Asp Arg 725 730 735 Ser Ile
Arg Leu Val Asn Gly Phe Leu Ala Leu Ala Trp Asp Asp Leu 740 745 750
Arg Ser Leu Cys Leu Phe Ser Tyr His Arg Leu Arg Asp Phe Ile Leu 755
760 765 Ile Ala Ala Arg Thr Val Glu Leu Leu Gly Arg Lys Gly Leu Arg
Arg 770 775 780 Gly Trp Glu Ala Leu Lys
Tyr Leu Trp Asn Leu Leu Gln Tyr Trp Gly 785 790 795 800Gln Glu Leu
Lys Asn Ser Ala Ile Ser Leu Leu Asp Thr Thr Ala Ile 805 810 815 Ala
Val Ala Glu Gly Thr Asp Arg Val Ile Glu Val Val Gln Arg Ala 820 825
830 Cys Arg Ala Ile Leu Asn Ile Pro Arg Arg Ile Arg Gln Gly Leu Glu
835 840 845 Arg Ala Leu Leu 850 252559DNAArtificial
SequenceDescription of Artificial SequenceProbe 25atgcgcgtgc
gcggcatcca gcgcaactgc cagcacctgt ggcgctgggg caccctgatc 60ctgggcatgc
tgatgatctg ctccgccgcc gagaacctgt gggtgaccgt gtactacggc
120gtgcccgtgt ggaaggaggc caacaccacc ctgttctgcg cctccgacgc
caaggcctac 180gacaccgagg tgcacaacgt gtgggccacc cacgcctgcg
tgcccaccga ccccaacccc 240caggagatcg tgctggagaa cgtgaccgag
aacttcaaca tgtggaagaa caacatggtg 300gagcagatgc acgaggacat
catctccctg tgggaccagt ccctgaagcc ctgcgtgaag 360ctgacccccc
tgtgcgtgac cctgaactgc accaacgtga acgtgaccaa caccaccaac
420aacaccgagg agaagggcga gatcaagaac tgctccttca acatcaccac
cgagatccgc 480gacaagaagc agaaggtgta cgccctgttc taccgcctgg
acgtggtgcc catcgacgac 540aacaacaaca actcctccaa ctaccgcctg
atcaactgca acacctccgc catcacccag 600gcctgcccca aggtgtcctt
cgagcccatc cccatccact actgcgcccc cgccggcttc 660gccatcctga
agtgcaacga caagaagttc aacggcaccg gcccctgcaa gaacgtgtcc
720accgtgcagt gcacccacgg catcaagccc gtggtgtcca cccagctgct
gctgaacggc 780tccctggccg aggaggagat catcatccgc tccgagaaca
tcaccaacaa cgccaagacc 840atcatcgtgc agctgaacga gtccgtggag
atcaactgca cccgccccaa caacaacacc 900cgcaagtcca tccgcatcgg
ccccggccag gccttctacg ccaccggcga catcatcggc 960gacatccgcc
aggcccactg caacatctcc ggcaccaagt ggaacaagac cctgcagcag
1020gtggccaaga agctgcgcga gcacttcaac aacaagacca tcatcttcaa
gccctcctcc 1080ggcggcgacc tggagatcac cacccactcc ttcaactgcc
gcggcgagtt cttctactgc 1140aacacctccg gcctgttcaa ctccacctgg
atcggcaacg gcaccaagaa caacaacaac 1200accaacgaca ccatcaccct
gccctgccgc atcaagcaga tcatcaacat gtggcagggc 1260gtgggccagg
ccatgtacgc cccccccatc gagggcaaga tcacctgcaa gtccaacatc
1320accggcctgc tgctgacccg cgacggcggc aacaacaaca ccaacgagac
cgagatcttc 1380cgccccggcg gcggcgacat gcgcgacaac tggcgctccg
agctgtacaa gtacaaggtg 1440gtgaagatcg agcccctggg cgtggccccc
accaaggcca agcgccgcgt ggtggagcgc 1500gagaagcgcg ccgtgggcat
cggcgccgtg ttcctgggct tcctgggcgc cgccggctcc 1560accatgggcg
ccgcctccat caccctgacc gtgcaggccc gccagctgct gtccggcatc
1620gtgcagcagc agtccaacct gctgcgcgcc atcgaggccc agcagcacct
gctgcagctg 1680accgtgtggg gcatcaagca gctgcaggcc cgcgtgctgg
ccgtggagcg ctacctgaag 1740gaccagcagc tgctgggcat ctggggctgc
tccggcaagc tgatctgcac caccaccgtg 1800ccctggaact cctcctggtc
caacaagtcc caggacgaga tctgggacaa catgacctgg 1860atggagtggg
agcgcgagat caacaactac accgacatca tctactccct gatcgaggag
1920tcccagaacc agcaggagaa gaacgagcag gagctgctgg ccctggacaa
gtgggcctcc 1980ctgtggaact ggttcgacat caccaactgg ctgtggtaca
tcaagatctt catcatgatc 2040gtgggcggcc tgatcggcct gcgcatcgtg
ttcgccgtgc tgtccatcgt gaaccgcgtg 2100cgccagggct actcccccct
gtccttccag accctgatcc ccaacccccg cggccccgac 2160cgccccgagg
gcatcgagga ggagggcggc gagcaggacc gcgaccgctc catccgcctg
2220gtgaacggct tcctggccct ggcctgggac gacctgcgct ccctgtgcct
gttctcctac 2280caccgcctgc gcgacttcat cctgatcgcc gcccgcaccg
tggagctgct gggccgcaag 2340ggcctgcgcc gcggctggga ggccctgaag
tacctgtgga acctgctgca gtactggggc 2400caggagctga agaactccgc
catctccctg ctggacacca ccgccatcgc cgtggccgag 2460ggcaccgacc
gcgtgatcga ggtggtgcag cgcgcctgcc gcgccatcct gaacatcccc
2520cgccgcatcc gccagggcct ggagcgcgcc ctgctgtaa
25592637PRTArtificial SequenceDescription of Artificial SequenceHIV
26Tyr Lys Arg Trp Ile Ile Leu Gly Leu Asn Lys Ile Val Arg Met Tyr 1
5 10 15 Ser Gln Gln Glu Lys Asn Glu Gln Glu Leu Leu Glu Leu Asp Lys
Trp 20 25 30 Ala Ser Leu Trp Asn 35 2733PRTArtificial
SequenceDescription of Artificial SequenceHIV 27Tyr Lys Arg Trp Ile
Ile Leu Gly Leu Asn Lys Ile Val Arg Met Tyr 1 5 10 15 Ser Ser Leu
Trp Asn Trp Phe Asn Ile Thr Asn Trp Leu Trp Tyr Ile 20 25 30 Lys
2822DNAArtificial SequenceDescription of Artificial SequenceProbe
28tcgtcgttgt cgttttgtcg tt 222928PRTArtificial SequenceDescription
of Artificial SequenceHIV 29Asn Glu Gln Glu Leu Leu Glu Leu Asp Lys
Trp Ala Ser Leu Trp Asn 1 5 10 15 Trp Phe Asn Ile Thr Asn Trp Leu
Trp Tyr Ile Lys 20 25 3023PRTArtificial SequenceDescription of
Artificial SequenceHIV 30Phe Ile Met Ile Val Gly Gly Leu Val Gly
Leu Arg Ile Val Phe Ala 1 5 10 15 Val Leu Ser Ile Val Asn Arg
203132PRTArtificial SequenceDescription of Artificial SequenceHIV
31Lys Trp Ala Ser Leu Trp Asn Trp Phe Asp Ile Thr Asn Trp Leu Tyr 1
5 10 15 Lys Arg Trp Ile Ile Leu Gly Leu Asn Lys Ile Val Arg Met Tyr
Ser 20 25 30
* * * * *